WO2022010736A1 - High throughput screening for monoclonal antibody pairs - Google Patents
High throughput screening for monoclonal antibody pairs Download PDFInfo
- Publication number
- WO2022010736A1 WO2022010736A1 PCT/US2021/040106 US2021040106W WO2022010736A1 WO 2022010736 A1 WO2022010736 A1 WO 2022010736A1 US 2021040106 W US2021040106 W US 2021040106W WO 2022010736 A1 WO2022010736 A1 WO 2022010736A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cov
- high throughput
- protein
- antigen
- sars
- Prior art date
Links
- 238000013537 high throughput screening Methods 0.000 title claims abstract description 77
- 102000036639 antigens Human genes 0.000 claims abstract description 412
- 239000000427 antigen Substances 0.000 claims abstract description 411
- 108091007433 antigens Proteins 0.000 claims abstract description 411
- 238000012360 testing method Methods 0.000 claims abstract description 243
- 241000700605 Viruses Species 0.000 claims abstract description 17
- 241000711573 Coronaviridae Species 0.000 claims description 502
- 108090000623 proteins and genes Proteins 0.000 claims description 456
- 102000004169 proteins and genes Human genes 0.000 claims description 454
- 241000710831 Flavivirus Species 0.000 claims description 255
- 241000725619 Dengue virus Species 0.000 claims description 193
- 238000003018 immunoassay Methods 0.000 claims description 171
- 101710128560 Initiator protein NS1 Proteins 0.000 claims description 135
- 101710144127 Non-structural protein 1 Proteins 0.000 claims description 135
- 241000907316 Zika virus Species 0.000 claims description 100
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 85
- 241001678559 COVID-19 virus Species 0.000 claims description 84
- 230000003612 virological effect Effects 0.000 claims description 83
- 238000000034 method Methods 0.000 claims description 79
- 208000003152 Yellow Fever Diseases 0.000 claims description 78
- 241000609530 Ilheus virus Species 0.000 claims description 76
- 241000710886 West Nile virus Species 0.000 claims description 76
- 241000725177 Omsk hemorrhagic fever virus Species 0.000 claims description 74
- 241000710771 Tick-borne encephalitis virus Species 0.000 claims description 74
- 239000002105 nanoparticle Substances 0.000 claims description 73
- 108091006197 SARS-CoV-2 Nucleocapsid Protein Proteins 0.000 claims description 65
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 claims description 63
- 239000012528 membrane Substances 0.000 claims description 60
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 claims description 51
- 239000003795 chemical substances by application Substances 0.000 claims description 48
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 48
- 241000315672 SARS coronavirus Species 0.000 claims description 44
- 241000710842 Japanese encephalitis virus Species 0.000 claims description 41
- 239000002243 precursor Substances 0.000 claims description 41
- 241000238703 Ixodes scapularis Species 0.000 claims description 39
- 206010041896 St. Louis Encephalitis Diseases 0.000 claims description 39
- 241000894007 species Species 0.000 claims description 39
- 230000008033 biological extinction Effects 0.000 claims description 24
- 230000003595 spectral effect Effects 0.000 claims description 24
- 239000007787 solid Substances 0.000 claims description 23
- 239000003153 chemical reaction reagent Substances 0.000 claims description 21
- 150000001413 amino acids Chemical class 0.000 claims description 19
- 239000000020 Nitrocellulose Substances 0.000 claims description 18
- 239000010432 diamond Substances 0.000 claims description 18
- 229920001220 nitrocellulos Polymers 0.000 claims description 18
- 238000003556 assay Methods 0.000 claims description 15
- 229910003460 diamond Inorganic materials 0.000 claims description 15
- 238000013507 mapping Methods 0.000 claims description 15
- 108010058683 Immobilized Proteins Proteins 0.000 claims description 12
- 238000000295 emission spectrum Methods 0.000 claims description 12
- 101710198474 Spike protein Proteins 0.000 claims description 11
- 238000006243 chemical reaction Methods 0.000 claims description 10
- 108090001074 Nucleocapsid Proteins Proteins 0.000 claims description 8
- 229940096437 Protein S Drugs 0.000 claims description 8
- 230000001268 conjugating effect Effects 0.000 claims description 7
- 238000012800 visualization Methods 0.000 claims description 6
- 206010014599 encephalitis Diseases 0.000 claims description 4
- 241000494545 Cordyline virus 2 Species 0.000 claims description 3
- 208000011448 Omsk hemorrhagic fever Diseases 0.000 claims description 3
- 101710120037 Toxin CcdB Proteins 0.000 claims description 3
- 239000012634 fragment Substances 0.000 claims description 3
- 108010026228 mRNA guanylyltransferase Proteins 0.000 claims description 3
- 229920005989 resin Polymers 0.000 claims description 3
- 239000011347 resin Substances 0.000 claims description 3
- 208000025370 Middle East respiratory syndrome Diseases 0.000 claims 2
- 238000003317 immunochromatography Methods 0.000 abstract description 9
- 230000037029 cross reaction Effects 0.000 abstract description 4
- 108010067390 Viral Proteins Proteins 0.000 abstract description 2
- 235000018102 proteins Nutrition 0.000 description 157
- 235000001014 amino acid Nutrition 0.000 description 21
- 238000001514 detection method Methods 0.000 description 18
- 208000001490 Dengue Diseases 0.000 description 15
- 206010012310 Dengue fever Diseases 0.000 description 15
- 210000004027 cell Anatomy 0.000 description 15
- 208000025729 dengue disease Diseases 0.000 description 15
- 229920001184 polypeptide Polymers 0.000 description 15
- 210000004408 hybridoma Anatomy 0.000 description 14
- 101500010375 Zika virus Non-structural protein 1 Proteins 0.000 description 13
- 239000011159 matrix material Substances 0.000 description 10
- 238000012216 screening Methods 0.000 description 10
- 208000020329 Zika virus infectious disease Diseases 0.000 description 8
- 102100031673 Corneodesmosin Human genes 0.000 description 7
- 101710139375 Corneodesmosin Proteins 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 7
- 241000282412 Homo Species 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- 125000003275 alpha amino acid group Chemical group 0.000 description 5
- 210000000234 capsid Anatomy 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 108010032595 Antibody Binding Sites Proteins 0.000 description 4
- 206010014596 Encephalitis Japanese B Diseases 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 201000005807 Japanese encephalitis Diseases 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 101001024637 Severe acute respiratory syndrome coronavirus 2 Nucleoprotein Proteins 0.000 description 4
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 4
- 239000010931 gold Substances 0.000 description 4
- 229910052737 gold Inorganic materials 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 210000001165 lymph node Anatomy 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 210000002845 virion Anatomy 0.000 description 4
- 108700004715 Flavivirus NS1 Proteins 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 230000000241 respiratory effect Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 230000000007 visual effect Effects 0.000 description 3
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 2
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 2
- 241000271566 Aves Species 0.000 description 2
- 241000288673 Chiroptera Species 0.000 description 2
- 108700002099 Coronavirus Nucleocapsid Proteins Proteins 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 101710204837 Envelope small membrane protein Proteins 0.000 description 2
- 101710145006 Lysis protein Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 208000004756 Respiratory Insufficiency Diseases 0.000 description 2
- 206010057190 Respiratory tract infections Diseases 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- 206010046306 Upper respiratory tract infection Diseases 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000008382 alveolar damage Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 238000012203 high throughput assay Methods 0.000 description 2
- 201000009240 nasopharyngitis Diseases 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 201000004193 respiratory failure Diseases 0.000 description 2
- 208000020029 respiratory tract infectious disease Diseases 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- 241000256111 Aedes <genus> Species 0.000 description 1
- 208000006820 Arthralgia Diseases 0.000 description 1
- 208000025721 COVID-19 Diseases 0.000 description 1
- 101100366043 Caenorhabditis elegans sms-2 gene Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 102100029158 Consortin Human genes 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 208000000059 Dyspnea Diseases 0.000 description 1
- 206010013975 Dyspnoeas Diseases 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- LLQPHQFNMLZJMP-UHFFFAOYSA-N Fentrazamide Chemical compound N1=NN(C=2C(=CC=CC=2)Cl)C(=O)N1C(=O)N(CC)C1CCCCC1 LLQPHQFNMLZJMP-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 101000771062 Homo sapiens Consortin Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 208000000112 Myalgia Diseases 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- -1 NS2B Proteins 0.000 description 1
- 101800001030 Non-structural protein 2A Proteins 0.000 description 1
- 101710144111 Non-structural protein 3 Proteins 0.000 description 1
- 101800001020 Non-structural protein 4A Proteins 0.000 description 1
- 101800001019 Non-structural protein 4B Proteins 0.000 description 1
- 101710144121 Non-structural protein 5 Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 108010076039 Polyproteins Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 208000004006 Tick-borne encephalitis Diseases 0.000 description 1
- 108091005906 Type I transmembrane proteins Proteins 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108010065667 Viral Matrix Proteins Proteins 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 208000001455 Zika Virus Infection Diseases 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 238000013100 final test Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 208000031169 hemorrhagic disease Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000010820 immunofluorescence microscopy Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 210000004777 protein coat Anatomy 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 238000012129 rapid antigen test Methods 0.000 description 1
- 238000012124 rapid diagnostic test Methods 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 208000013220 shortness of breath Diseases 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 230000003393 splenic effect Effects 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 201000004059 subependymal giant cell astrocytoma Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 230000010464 virion assembly Effects 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1081—Togaviridae, e.g. flavivirus, rubella virus, hog cholera virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1002—Coronaviridae
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1002—Coronaviridae
- C07K16/1003—Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2 or Covid-19]
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B30/00—Methods of screening libraries
- C40B30/04—Methods of screening libraries by measuring the ability to specifically bind a target molecule, e.g. antibody-antigen binding, receptor-ligand binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54313—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
- G01N33/54346—Nanoparticles
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54366—Apparatus specially adapted for solid-phase testing
- G01N33/54386—Analytical elements
- G01N33/54387—Immunochromatographic test strips
- G01N33/54388—Immunochromatographic test strips based on lateral flow
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/18—Togaviridae; Flaviviridae
- G01N2333/183—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus) or border disease virus
- G01N2333/185—Flaviviruses or Group B arboviruses, e.g. yellow fever virus, japanese encephalitis, tick-borne encephalitis, dengue
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/04—Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
Definitions
- a viral infection is the proliferation of a harmful virus inside a subject’s body. Viruses depend on host cells for their reproduction. Coronavirus (CoV) disease COVID-19 is a fast spreading worldwide pandemic caused by a coronavirus strain. Symptoms can appear 2-14 days after exposure and include fever, cough, and shortness of breath. Flavivirus strains cause widespread morbidity and mortality throughout the world. They are transmitted by ticks and are responsible of encephalitis and hemorrhagic diseases.
- the invention provides an immunoassay for testing the suitability of a monoclonal antibody pair for use in a lateral flow assay to detect a target protein, wherein the monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody, wherein the first and the second monoclonal antibodies are capable of specifically binding the target protein.
- the first and the second monoclonal antibodies have been purified with protein L or protein G resins.
- the first monoclonal antibody is immobilized on a solid support, and the second monoclonal antibody is conjugated to a visualizing agent.
- the visualizing agent-conjugated second monoclonal antibody and the target protein are allowed to bind to the immobilized first monoclonal antibody at the same time.
- the solid support is a nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the first monoclonal antibody is different from the second monoclonal antibody. In some embodiments, the first monoclonal antibody is the same as the second monoclonal antibody.
- the target protein is a viral antigen.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- a high throughput immunoassay includes a multitude of immunoassays as described above, wherein the multitude of immunoassays are conducted at the same time and in the same device.
- the first monoclonal antibodies of more than one immunoassays are immobilized on the same solid support.
- the high throughput assay is conducted for selecting a suitable monoclonal antibody pair for use in a lateral flow assay to detect a target protein, and the selection is from a collection of monoclonal antibodies capable of specifically binding the target protein, wherein the selected monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody.
- a multitude of combinations of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein are tested in the same high throughput immunoassay as the first and the second monoclonal antibody.
- the first monoclonal antibody is the same as the second monoclonal antibody.
- every combination of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein as the first and the second antibody, respectively, is tested in the same high throughput immunoassay.
- the first monoclonal antibody is the same as the second monoclonal antibody.
- a high throughput immunoassay device includes a commercially available multi-well plate, multiple test trips, a holder for the test strips, wherein the distal end of each test strip is immersed in one well of the multiple-well plate, and wherein each test strip comprises a solid support for immobilized proteins or peptides.
- each test strip comprises a proximal wick portion and a distal dipstick portion, wherein the end of each dipstick portion is immersed in one well of the multi-well plate.
- the dipstick portion comprises a test area, wherein the test area can provide support for one immobilized protein or peptide.
- the dipstick portion comprises multiple test areas, wherein each test area can provide support for one immobilized protein or peptide. In some embodiments, the multiple test areas of the dipstick portion are arranged in a single vertical row along the vertical axis of the dipstick. In some embodiments, the dipstick is shaped as a string of overlapping diamonds, wherein each diamond shape provides one test area. In some embodiments, the dipstick comprises three overlapping diamond shapes.
- the dipstick has one or more flow splitters, wherein the flow splitters are gaps in the test strips parallel to the vertical axis of the dipstick, wherein each flow splitter divides the dipstick into two half-strip dipstick sections at the level of the flow splitter, and wherein the two half-strip dipstick sections are to the left and to the right of the flow splitter.
- each half-strip dipstick section provides one test area.
- at least some of the diamond shapes encompass a flow splitter and are divided into two half-diamond dipstick sections at the level of the flow splitter.
- each half-diamond dipstick section provides one test area.
- the wick portion of the test strip comprises a T-shaped handle of the test strip.
- the holder for the test strips comprises a plate-shaped aligner with a multitude of slots, wherein the aligner is placed above the multi-well plate, wherein each slot can accommodate one test strip, and wherein the positions of the slots correspond to the positions of the wells in the multi-well plate so that the distal end of the test strip vertically extending through a slot can be localized in a well.
- the aligner slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle.
- the width of the aligner slots is similar to the thickness of the test strips, and wherein the width of the aligner slots is sufficient to accommodate the test strip extending through the slot.
- the aligner slots are diagonally oriented to the aligner.
- the holder for the test strips further comprises a top plate with a multitude of top plate slots, wherein the top plate is placed above the aligner, wherein each top plate slot can accommodate one test strip, and wherein the positions of the top plate slots align with the positions of the aligner slots below in diagonal orientations so that a test strip vertically extending through a top plate slot can also extend through an aligner slot below.
- the top plate slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle.
- the width of the top plate slots is similar to the thickness of the test strips, and wherein the width of the top plate slots is sufficient to accommodate the test strip extending through the slot.
- the high throughput immunoassay device further includes an outer housing container, wherein the multi-well plate, the test strips, the aligner, and the top plate are all placed in the housing container.
- the multi-well plate is a 96-well plate.
- the multi-well plate is a flat-bottom 96-well plate.
- the multi-well plate is a round-bottom 96-well plate.
- the snap tabs can snap-fit to the multi-well plates.
- the device can accommodate multiple commercially available multi-well plates and multiple holders for the test strips.
- the invention provides an immunoassay for testing the binding capacity between a monoclonal antibody and a protein or peptide, wherein the protein or peptide is immobilized on a solid support, and wherein the monoclonal antibody is conjugated to a visualizing agent.
- the visualizing agent -conjugated monoclonal antibody is allowed to bind to the immobilized protein or peptide.
- the solid support is a nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the protein or peptide is a viral antigen.
- the protein or peptide is a portion of a viral antigen.
- the portion of a viral antigen has a length of 9-15 amino acid.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is SARS- CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the invention provides a high throughput immunoassay which includes a multitude of immunoassays previously described, wherein the multitude of the immunoassays are conducted at the same time and in the same device.
- the proteins or peptides of more than one immunoassays are immobilized on the same solid support.
- the high throughput immunoassay is conducted to map the peptide recognized by a monoclonal antibody, wherein the peptide is localized within a target protein recognized by the monoclonal antibody.
- a multitude of peptides from the target protein are tested in the same high throughput immunoassay against the same monoclonal antibody, wherein the protein is known to bind to the antibody.
- the target protein is a viral antigen.
- the target protein is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the invention provides a high throughput screening method for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, the method comprising: obtaining a collection of candidate monoclonal antibodies that specifically bind to the target protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate monoclonal antibody on at least one of the test areas of the at least one test strip, except the uppermost test area of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to at least one candidate monoclonal antibody; applying the target protein and the at least one visualizing agent conjugated candidate monoclonal antibody in the multi-well plate, wherein each well is provided with the target protein and one conjugated candidate monoclo
- control antibody is an antibody that specifically binds the candidate monoclonal antibodies. In some embodiments, the control antibody is an antibody that specifically binds the Fc portion of the candidate monoclonal antibodies.
- each candidate monoclonal antibody is conjugated with a visualization agent and tested against each candidate monoclonal antibody immobilized on the test strip.
- each candidate monoclonal antibody is immobilized on at least one test strip and tested against each candidate monoclonal antibody conjugated with a visualization agent.
- each candidate monoclonal antibody is conjugated with a visualizing agent and tested against the same candidate monoclonal antibody on a test strip.
- the portion of the test strip that contacts the immobilized antibodies is nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the target protein is a viral antigen.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
- the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the invention provides a high throughput selection platform for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, wherein detecting the target protein comprises distinguishing the target protein from non-target proteins that are similar to the target protein, the method including: conducting the high throughput screening method previously described with the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; conducting the high throughput screening method previously described with each of the non-target proteins that are similar to the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; comparing the signal intensity of the tested antibody pairings for the target protein and for each of the non-target proteins that are similar to the target protein; selecting the antibody parings that are capable of recognizing the target protein and distinguishing between the target protein and the non-target proteins that are similar to the
- the high throughput screening with the non-target proteins similar to the target protein and the high throughput screening with the target protein are conducted in the same device and at the same time.
- the target protein is a viral antigen.
- the target protein viral antigen is a coronavirus (CoV) antigen.
- the target protein coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the target protein coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV- 2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the target protein coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the target protein coronavirus (CoV) antigen is a portion of SARS-CoV- 2 Spike Protein (SARS-CoV-2S). In some embodiments, the target protein coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the non-target proteins that are similar to the target protein are viral antigens.
- the non-target protein viral antigens are coronavirus (CoV) antigens.
- at least some of the non-target protein coronavirus (CoV) antigens are proteins from coronavirus (CoV) strains selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- at least some of the non-target protein coronavirus (CoV) antigens are proteins from SARS-CoV-2.
- At least some of the non target protein coronavirus (CoV) antigens are not proteins from SARS-CoV-2. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- S Spike Protein
- At least some of the coronavirus (CoV) antigens are Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU 1.
- At least some of the non-target protein coronavirus (CoV) antigens are portions of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- at least some of the non-target protein coronavirus (CoV) antigens are portions of proteins from SARS-CoV-2.
- at least some of the non target protein coronavirus (CoV) antigens are not portions of proteins from SARS-CoV-2.
- At least some of the non-target protein coronavirus (CoV) antigens are portions from Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- at least some of the non-target protein coronavirus (CoV) antigens are portions from Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the target protein viral antigen is a flavivirus antigen.
- the target protein flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the target protein flavivirus antigen is flavivirus non- structural protein 1 (NS1).
- the target protein flavivirus antigen is flavivirus precursor membrane (PrM) protein
- the target protein flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the target protein flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1).
- the target protein flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the non-target protein viral antigens are flavivirus antigens.
- at least some of the non-target protein flavivirus antigens are proteins from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- DV1 Dengue virus serotype 1
- DV2 Dengue virus serotype 2
- DV3 Dengue virus serotype 3
- Dengue virus serotype 4 DV4
- ZIKV
- At least some of the non-target protein flavivirus antigens are flavivirus non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivirus antigens are flavivirus precursor membrane (PrM) protein.
- the non-target protein flavivirus antigens are portions of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV
- non-target protein flavivirus antigens are portions of flavivirus non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivirus antigens are portions of flavivirus precursor membrane (PrM) protein.
- PrM flavivirus precursor membrane
- the invention provides a high throughput screening method for mapping the peptide that is recognized by a monoclonal antibody within a target protein recognized by the monoclonal antibody, the method including: obtaining a collection of overlapping candidate peptides that are fragments of the protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate peptide on at least one of the test areas of the at least one test strip, except the uppermost test areas of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to the monoclonal antibody; applying the visualizing agent conjugated monoclonal antibody in wells of the multi-well plate corresponding the positions of the at least one test strips; immersing the distal end of the at least one test strips into the corresponding wells with the visualizing agent conjugated monoclo
- control antibody is an antibody that specifically binds the monoclonal antibody. In some embodiments, the control antibody is an antibody against the Fc portion of the monoclonal antibody. In some embodiments, each of the candidate peptides is immobilized on at least one test strip and tested against the visualizing agent conjugated monoclonal antibody.
- the portion of the test strip that contacts the immobilized candidate peptides is nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the target protein is a viral antigen.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of protein from SARS-CoV-2
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
- the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the invention provides a method to utilize the high throughput immunoassay device as described above, wherein one group of test strips are utilized to conduct the high throughput screening for antibody paring as described above, and another group of test strips are utilized to conduct the high throughput mapping as described above.
- the tests utilizing the two groups of test strips are started and interpreted at the same time. In some embodiments, the tests utilizing the two groups of test strips are started or interpreted at different times.
- Figure 1 shows a schematic diagram of some embodiments of individual components of a high throughout immunoassay device.
- Figure 2 shows a photo of one embodiment of a high-throughput immunoassay device.
- Figure 3 shows detailed technical specification of one embodiment of Test Strip Assembly, Dipstick, and Wick of the high-throughput immunoassay device.
- Figure 4 shows detailed technical specification of one embodiment of the Top Plate high-throughput immunoassay device.
- Figure 5 shows detailed technical specification of one embodiment of the Divider/ Aligner high-throughput immunoassay device.
- Figure 6 shows detailed technical specification of embodiments of Holders of the high-throughput immunoassay device for 96-well round bottom and flat bottom plates, respectively.
- Figure 7 shows a high throughput screen test to identify monoclonal antibody pairing to detect specific viral targets.
- the test areas are loaded with the immobilized antibodies a-mouse Fc (control antibody), a-SARS-CoV-2 S, and a-SARS- CoV-2 N.
- the antibodies a-SARS-CoV-2 S and a-SARS-CoV-2 S are also conjugated to nanoparticles.
- the peptides SARS-CoV-2 S and N are introduced to the reactions as well.
- test areas are (left to the splitters): a-human Fc (control antibody), a- DENV-2 NS1, and a-SARS-CoV-2 S
- the test areas right to the splitters are a-mouse Fc (control antibody), a-DENV-3 NS1, and a-SARS-CoV-2 N.
- the conjugated antibodies are a-DENV-2 NS1, a-DENV-3 NS1, a-SARS-CoV-2 S, and a-SARS-CoV-2 N.
- the antigens introduced to the reactions are DENV-2 NS1, SARS-CoV-2 S, and SARS-CoV-2 N.
- Figure 8 shows a high throughput screen that identifies monoclonal antibody pairs that detect SARS-Coronaviruses with varying levels of specificity and strength.
- Figure 9 shows a high throughput screen to map protein peptides recognized by monoclonal antibodies.
- Four peptides corresponding to different portions ofDEV S-1 were immobilized on the dipstick test areas.
- the upper right rest area was loaded with a control antibody a-mouse Fc.
- Conjugated antibody a-DENV NS 1 was allowed to bind to the immobilized peptides and control antibody.
- Figure 10 shows Leinco antibody grid from a high throughput screening.
- Figure 11 shows stepwise strategy for identifying mAbs that differentiate the closely related NS1 proteins of DENV1-4 and ZIKV.
- Step 1 mouse hybridomas are generated by immunizing mice with viral NS1 protein antigen, and the resulting hybridomas are screened using ELISA against multiple recombinant NS1 proteins.
- Step 2 hybridoma cell supernatants containing monoclonal antibodies are screened using flow cytometry for recognition of native NS1 proteins released by Yero cells infected with DENV serotypes or ZIKV.
- Step 3 purified monoclonal antibodies are tested in pairs for specific recognition of DENV or ZIKV NS1 proteins in immunochromatography rapid tests that run in about 30 minutes.
- Step 4 linear epitope mapping is performed to identify NS1 sites recognized by monoclonal antibodies used in the rapid tests.
- Step 5 patient serum from DENV- or ZIKV- infected patients is tested using the immunochromatography dipsticks.
- Step 6 images of test results are captured using image recognition on a mobile phone camera, and analyzed objectively to quantify signals.
- Figure 12 shows Repertoire of antigen-specific antibodies among DENV and ZIKV mAbs.
- the pie charts show the percentages of dengue serotype-specific or Zika virus- specific monoclonal antibodies as defined during screening. The values were determined by screening the hybridomas against the antigens labeled on the figures.
- the ZIKA virus monoclonal antibody preparation was done by two methods (splenic B cells and lymph node tissue).
- Figure 13 shows Matrix of mAb pair trials.
- one antibody was conjugated to gold nanoparticles, and one antibody was adsorbed to nitrocellulose membrane.
- the resulting nanoparticle conjugates-membrane pairs were tested using the specific serotype recombinant NS 1 protein (on the left axis: mock, DENV1, DENV2, DENV3, DENV 4, ZIKV, or a DV 1-4 mix of all four NS 1 proteins; highlighted in blue color). These proteins were present at a concentration of 1.6 ug/ml in the testing. Because of the large number of tests performed, the strips were analyzed and normalized in groups corresponding to nanoparticle lots and antibody dilutions.
- the signal for each test strip was quantified using Image! Background signal intensity was subtracted and the signal of greatest intensity was set at a value of “1”. For remaining strips, background was subtracted from signal intensity to yield a corrected intensity value. The corrected intensity value was then divided by the maximal signal value to yield a value between 0 and 1 that was plotted above to generate a relative binding affinity map. Dark green color: strong visual signal in the rapid test; light green color: weak visual signal in the rapid test; gray color: no signal in the rapid test. These tests were performed using lab-made gold nanoparticles, which perform equivalently in comparison to commercial Innova particles. The antibody pairs were tested at a sample concentration of 3 rg/ml of recombinant NS 1 protein. Left panel: dengue virus antibodies; Right panel: Zika virus antibodies, with the exception of 136, a dengue NS1 antibody that binds Zika virus NS1 with high affinity.
- Figure 14 shows NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype-specific NS1 rapid tests, pan-DENVNSl test, and ZIKVNS1 test.
- A Table listing mAb names, mAb immunochromatography applications, mAb linear epitope sequences and starting amino acid positions, and NS1 domain positions.
- ZD V and DENV are related flaviviruses
- their homologous proteins and nucleic acids can cause cross-reactions and false-positive results in molecular, antigenic, and serologic diagnostics.
- Such cross-reactions and false-positive results can also occur for related coronaviruses.
- the invention provides an immunoassay for testing the suitability of a monoclonal antibody pair for use in a lateral flow assay to detect a target protein, wherein the monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody, wherein the first and the second monoclonal antibodies are capable of specifically binding the target protein.
- the first and the second monoclonal antibodies have been purified with protein L or protein G resins.
- the first monoclonal antibody is immobilized on a solid support, and the second monoclonal antibody is conjugated to a visualizing agent.
- the visualizing agent-conjugated second monoclonal antibody and the target protein are allowed to bind to the immobilized first monoclonal antibody at the same time.
- the solid support is a nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the first monoclonal antibody is different from the second monoclonal antibody. In some embodiments, the first monoclonal antibody is the same as the second monoclonal antibody.
- the target protein is a viral antigen.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKUE
- the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S) In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- a high throughput immunoassay includes a multitude of immunoassays as described above, wherein the multitude of immunoassays are conducted at the same time and in the same device.
- the first monoclonal antibodies of more than one immunoassays are immobilized on the same solid support.
- the high throughput assay is conducted for selecting a suitable monoclonal antibody pair for use in a lateral flow assay to detect a target protein, and the selection is from a collection of monoclonal antibodies capable of specifically binding the target protein, wherein the selected monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody.
- a multitude of combinations of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein are tested in the same high throughput immunoassay as the first and the second monoclonal antibody.
- the first monoclonal antibody is the same as the second monoclonal antibody.
- every combination of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein as the first and the second antibody, respectively, is tested in the same high throughput immunoassay.
- the first monoclonal antibody is the same as the second monoclonal antibody.
- a high throughput immunoassay device includes a commercially available multi-well plate, multiple test trips, a holder for the test strips, wherein the distal end of each test strip is immersed in one well of the multiple-well plate, and wherein each test strip comprises a solid support for immobilized proteins or peptides.
- each test strip comprises a proximal wick portion and a distal dipstick portion, wherein the end of each dipstick portion is immersed in one well of the multi-well plate.
- the dipstick portion comprises a test area, wherein the test area can provide support for one immobilized protein or peptide.
- the dipstick portion comprises multiple test areas, wherein each test area can provide support for one immobilized protein or peptide. In some embodiments, the multiple test areas of the dipstick portion are arranged in a single vertical row along the vertical axis of the dipstick. In some embodiments, the dipstick is shaped as a string of overlapping diamonds, wherein each diamond shape provides one test area. In some embodiments, the dipstick comprises three overlapping diamond shapes.
- the dipstick has one or more flow splitters, wherein the flow splitters are gaps in the test strips parallel to the vertical axis of the dipstick, wherein each flow splitter divides the dipstick into two half-strip dipstick sections at the level of the flow splitter, and wherein the two half-strip dipstick sections are to the left and to the right of the flow splitter.
- each half-strip dipstick section provides one test area.
- at least some of the diamond shapes encompass a flow splitter and are divided into two half-diamond dipstick sections at the level of the flow splitter.
- each half-diamond dipstick section provides one test area.
- the wick portion of the test strip comprises a T-shaped handle of the test strip.
- the holder for the test strips comprises a plate-shaped aligner with a multitude of slots, wherein the aligner is placed above the multi-well plate, wherein each slot can accommodate one test strip, and wherein the positions of the slots correspond to the positions of the wells in the multi-well plate so that the distal end of the test strip vertically extending through a slot can be localized in a well.
- the aligner slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle.
- the width of the aligner slots is similar to the thickness of the test strips, and wherein the width of the aligner slots is sufficient to accommodate the test strip extending through the slot.
- the aligner slots are diagonally oriented to the aligner.
- the holder for the test strips further comprises a top plate with a multitude of top plate slots, wherein the top plate is placed above the aligner, wherein each top plate slot can accommodate one test strip, and wherein the positions of the top plate slots align with the positions of the aligner slots below in diagonal orientations so that a test strip vertically extending through a top plate slot can also extend through an aligner slot below.
- the top plate slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle.
- the width of the top plate slots is similar to the thickness of the test strips, and wherein the width of the top plate slots is sufficient to accommodate the test strip extending through the slot.
- the high throughput immunoassay device further includes an outer housing container, wherein the multi-well plate, the test strips, the aligner, and the top plate are all placed in the housing container.
- the multi-well plate is a 96-well plate.
- the multi-well plate is a flat-bottom 96-well plate.
- the multi-well plate is a round-bottom 96-well plate.
- the snap tabs can snap-fit to the multi-well plates.
- the device can accommodate multiple commercially available multi-well plates and multiple holders for the test strips.
- the invention provides an immunoassay for testing the binding capacity between a monoclonal antibody and a protein or peptide, wherein the protein or peptide is immobilized on a solid support, and wherein the monoclonal antibody is conjugated to a visualizing agent.
- the visualizing agent -conjugated monoclonal antibody is allowed to bind to the immobilized protein or peptide.
- the solid support is a nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the protein or peptide is a viral antigen. In some embodiments, the protein or peptide is a portion of a viral antigen. In some embodiments, the portion of a viral antigen has a length of 9-15 amino acid.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is SARS- CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the invention provides a high throughput immunoassay which includes a multitude of immunoassays previously described, wherein the multitude of the immunoassays are conducted at the same time and in the same device.
- the proteins or peptides of more than one immunoassays are immobilized on the same solid support.
- the high throughput immunoassay is conducted to map the peptide recognized by a monoclonal antibody, wherein the peptide is localized within a target protein recognized by the monoclonal antibody.
- a multitude of peptides from the target protein are tested in the same high throughput immunoassay against the same monoclonal antibody, wherein the protein is known to bind to the antibody.
- the target protein is a viral antigen.
- the target protein is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
- the flavivirus antigen is a portion of flavivirus non-stmctural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the invention provides a high throughput screening method for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, the method comprising: obtaining a collection of candidate monoclonal antibodies that specifically bind to the target protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate monoclonal antibody on at least one of the test areas of the at least one test strip, except the uppermost test area of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to at least one candidate monoclonal antibody; applying the target protein and the at least one visualizing agent conjugated candidate monoclonal antibody in the multi-well plate, wherein each well is provided with the target protein and one conjugated candidate monoclo
- control antibody is an antibody that specifically binds the candidate monoclonal antibodies. In some embodiments, the control antibody is an antibody that specifically binds the Fc portion of the candidate monoclonal antibodies.
- each candidate monoclonal antibody is conjugated with a visualization agent and tested against each candidate monoclonal antibody immobilized on the test strip.
- each candidate monoclonal antibody is immobilized on at least one test strip and tested against each candidate monoclonal antibody conjugated with a visualization agent.
- each candidate monoclonal antibody is conjugated with a visualizing agent and tested against the same candidate monoclonal antibody on a test strip.
- the portion of the test strip that contacts the immobilized antibodies is nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the target protein is a viral antigen.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- DV1 Dengue virus serotype 1
- DV2 Dengue virus serotype 2
- DV3 Dengue virus serotype 3
- Dengue virus serotype 4 DV4
- ZIKV Zika virus
- YFV Yellow F
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein. [0116] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non- structural
- the invention provides a high throughput selection platform for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, wherein detecting the target protein comprises distinguishing the target protein from non-target proteins that are similar to the target protein, the method including: conducting the high throughput screening method previously described with the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; conducting the high throughput screening method previously described with each of the non-target proteins that are similar to the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; comparing the signal intensity of the tested antibody pairings for the target protein and for each of the non-target proteins that are similar to the target protein; selecting the antibody parings that are capable of recognizing the target protein and distinguishing between the target protein and the non-target proteins that are similar to the target protein.
- the high throughput screening with the non-target proteins similar to the target protein and the high throughput screening with the target protein are conducted in the same device and at the same time.
- the target protein is a viral antigen.
- the target protein viral antigen is a coronavirus (CoV) antigen.
- the target protein coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the target protein coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV- 2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the target protein coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
- the target protein coronavirus (CoV) antigen is a portion of SARS-CoV- 2 Spike Protein (SARS-CoV-2S). In some embodiments, the target protein coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the non-target proteins that are similar to the target protein are viral antigens.
- the non-target protein viral antigens are coronavirus (CoV) antigens.
- at least some of the non-target protein coronavirus (CoV) antigens are proteins from coronavirus (CoV) strains selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- at least some of the non-target protein coronavirus (CoV) antigens are proteins from SARS-CoV-2.
- At least some of the non target protein coronavirus (CoV) antigens are not proteins from SARS-CoV-2. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- S Spike Protein
- At least some of the coronavirus (CoV) antigens are Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU 1.
- At least some of the non-target protein coronavirus (CoV) antigens are portions of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- at least some of the non-target protein coronavirus (CoV) antigens are portions of proteins from SARS-CoV-2.
- at least some of the non target protein coronavirus (CoV) antigens are not portions of proteins from SARS-CoV-2.
- At least some of the non-target protein coronavirus (CoV) antigens are portions from Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- at least some of the non-target protein coronavirus (CoV) antigens are portions from Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the target protein viral antigen is a flavivirus antigen.
- the target protein flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the target protein flavivirus antigen is flavivirus non- structural protein 1 (NS1).
- the target protein flavivirus antigen is flavivirus precursor membrane (PrM) protein
- the target protein flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the target protein flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1).
- the target protein flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the non-target protein viral antigens are flavivirus antigens.
- at least some of the non-target protein flavivirus antigens are proteins from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- DV1 Dengue virus serotype 1
- DV2 Dengue virus serotype 2
- DV3 Dengue virus serotype 3
- Dengue virus serotype 4 DV4
- ZIKV
- At least some of the non-target protein flavivirus antigens are flavivirus non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivirus antigens are flavivirus precursor membrane (PrM) protein.
- the non-target protein flavivirus antigens are portions of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue vims serotype 4 (DV4), Zika vims (ZIKV), Yellow Fever (YFV), Ilheus Vims (ILHV), Powassan (POWA), Japanese encephalitis (JE) vims, West Nile vims (WNV), Deer tick (DTV) tick-bome encephalitis vims (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever vims (OHFV).
- DV1 Dengue virus serotype 1
- DV2 Dengue virus serotype 2
- DV3 Dengue virus serotype 3
- Dengue vims serotype 4 DV4
- ZIKV Zika vims
- non-target protein flavivirus antigens are portions of flavivims non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivims antigens are portions of flavivims precursor membrane (PrM) protein.
- the invention provides a high throughput screening method for mapping the peptide that is recognized by a monoclonal antibody within a target protein recognized by the monoclonal antibody, the method including: obtaining a collection of overlapping candidate peptides that are fragments of the protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate peptide on at least one of the test areas of the at least one test strip, except the uppermost test areas of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to the monoclonal antibody; applying the visualizing agent conjugated monoclonal antibody in wells of the multi-well plate corresponding the positions of the at least one test strips; immersing the distal end of the at least one test strips into the corresponding wells with the visualizing agent conjugated monoclo
- control antibody is an antibody that specifically binds the monoclonal antibody. In some embodiments, the control antibody is an antibody against the Fc portion of the monoclonal antibody. In some embodiments, each of the candidate peptides is immobilized on at least one test strip and tested against the visualizing agent conjugated monoclonal antibody.
- the portion of the test strip that contacts the immobilized candidate peptides is nitrocellulose membrane.
- the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
- the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
- the target protein is a viral antigen.
- the viral antigen is a coronavirus (CoV) antigen.
- the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV- 2S).
- the coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
- the coronavirus (CoV) antigen is a portion of protein from SARS-CoV-2.
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
- the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
- the viral antigen is a flavivirus antigen.
- the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
- the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
- the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
- the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
- the flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
- the invention provides a method to utilize the high throughput immunoassay device as described above, wherein one group of test strips are utilized to conduct the high throughput screening for antibody paring as described above, and another group of test strips are utilized to conduct the high throughput mapping as described above.
- the tests utilizing the two groups of test strips are started and interpreted at the same time. In some embodiments, the tests utilizing the two groups of test strips are started or interpreted at different times.
- Lateral flow immunoassays are a cost-effective methodology for detecting a target protein in a biological sample. Tests based on this methodology can be used at a point-of- care center by medical professionals or for at home testing by individuals without any medical or technical training.
- the technology takes advantage of the capillary properties of materials such as nitrocellulose, which have the capacity to transport fluids spontaneously. Liquids display capillary action, which is their ability to flow through narrow spaces even in opposition to external forces. Capillary action can be observed in the drawing up of liquids into materials such as fibers or cellulose. It occurs due to intermolecular forces between the liquid and surrounding solid surfaces. If the diameter of the space is sufficiently small, then the combination of surface tension of the liquid and the adhesive forces between the liquid and the surrounding solid surface act to propel the liquid into the narrow space.
- lateral flow immunoassays There are two main types of lateral flow immunoassays: a “sandwich assay” and a “competitive assay”.
- the subject matter disclosed herein relates to “sandwich assays.”
- a migrating sample can first come into contact with a detection reagent, which can specifically bind to a target protein or viral antigen.
- the detection reagent is conjugated to a visualizing reagent. If the target protein is present in the sample, the conjugated detection reagent can bind to it and subsequently flow laterally a test line (area).
- the test line (area) may also contain a capture reagent such as proteins or antibodies specific to the target protein.
- a visual signal or readout is produced when the target protein reaches the test line (area).
- the target protein is “sandwiched” between two proteins such as antibodies.
- the detection reagent is not directly labeled and both the capture reagent and the detection reagent are antibodies, then these antibodies must be from different species (i.e., if the capture antibody is a rabbit antibody, the detection antibody can be from goat, chicken, etc., but not rabbit). This will allow the use of a secondary antibody directed to the species heavy chain of the detection antibody. If the detection antibody is directly labeled, then the capture and detection antibodies can be from the same species.
- an immunoassay sensitivity usually is the protein or antibody binding affinity for the target antigen. As the target antigen concentration increases, the amount of detection reagent accumulated in the test line (area) increases, leading to a higher measured response or readout.
- Monoclonal antibodies are generated by identical immune cells that are all clones of a unique parent cell. Monoclonal antibodies can have monovalent affinity - they all bind to the same part of an antigen, called epitope. In contrast, polyclonal antibodies bind to multiple epitopes and are usually made by several different plasma cell lineages. Polyclonal antibodies often contain multiple epitopes and the same affinity purified polyclonal can be used as the capture and labeled detection antibody.
- a paratope is an antigen-binding site found on an antibody which recognizes and binds to an antigen.
- a paratope usually includes a small region of 5 to 10 amino acids of the antibody's Fc region.
- the paratope can contain parts of the antibody's heavy and light chains.
- Each arm of the Y shape of an antibody monomer is tipped with a paratope, which is a set of 6 complementarity-determining regions - 3 of each light chain and heavy chain extending from the fold of antiparallel beta sheets.
- a viral antigen is a protein or a polypeptide encoded by a viral genome.
- viral antigens protrude from the virus envelope or capsid and often fulfill important functions, which ensure the survival and propagation of the viral genetic material such as docking to the host cell, fusion, and injection of viral DNA/RNA into a host cell.
- Recombinant viral antigens can contain part of viral sequence, which encodes a region which can be recognized by antibodies. This reduces the risk of false negatives which can occur with synthetic peptides, which contain only a small portion of the entire protein.
- Coronaviruses are a large family of enveloped, positive-sense, single- stranded RNA viruses that infect a broad range of vertebrates. They are extensive in bats but can be found in many other birds and mammals including humans. In humans, CoVs tend to cause mild to moderate upper respiratory tract infections such as the common cold.
- Viruses are small parasites that cannot reproduce on their own. Once a virus infects a cell, however, a vims can direct the cell machinery to produce more vimses. Most viruses utilize either RNA or DNA as their genetic material.
- the nucleic acid may be single- or double-stranded.
- the infectious vims particle or a virion includes a nucleic acid and an outer shell of protein.
- the simplest vimses contain only enough RNA or DNA to encode four proteins. On the other hand, the most complex ones can encode up to 200 proteins.
- the nucleic acid of a virion is enclosed within a protein coat called a capsid.
- the capsid id composed of multiple copies of one protein or a few different proteins, each of which is encoded by a single viral gene. Because of this structure, a vims is able to encode all the information for making a relatively large capsid in a small number of genes.
- Coronavimses are a large family of enveloped, positive-sense, single- stranded RNA vimses that infect a broad range of vertebrates. They are extensive in bats but can be found in many other birds and mammals including humans. In humans, CoVs tend to cause mild to moderate upper respiratory tract infections such as the common cold.
- the coronavims entry into a cell is mediated by the viral Spike (S) glycoprotein.
- the Spike protein is a large type I transmembrane protein ranging from 1,160 amino acids to up to 1,400 amino acids. Spike proteins are highly glycosylated with 21 to 35 N- glycosylation sites. Spike proteins assemble into trimers on the virion surface to form the distinctive "corona", or crown-like appearance, of a coronavirus.
- the ectodomain of all CoV Spike proteins is organized into an N-terminal domain named SI, responsible for receptor binding, and a C-terminal S2 domain, responsible for viral fusion.
- Coronaviruses can infect the respiratory epithelial cells through interaction with the ACE2 receptor on the cell surface
- Recombinant Spike protein can bind with recombinant ACE2 proteins.
- the coronavirus Nucleocapsid is a structural protein capable of forming complexes with genomic RNA. Nucleocapsid proteins also interact with the viral membrane protein(s) during virion assembly and play a critical role in enhancing the efficiency of virus transcription and assembly.
- DENV exists as four antigenic serotypes, DENV1 to DENV4. These viruses have a wide geographic distribution, with approximately 390 million infections annually and more than a quarter of the world’s population at risk.
- ZIKV Prior to 2015, ZIKV was considered obscure and was known to circulate in Africa and Southeast Asia as two separate viral lineages, African and Asian. While most are asymptomatic, the clinical presentation of ZIKV infection resembles that of dengue, including fever, rash, conjunctivitis, arthralgia, and myalgia.
- DENV contains a positive-sense, single-stranded RNA genome of about 10.6 kilobases.
- the single open reading frame of the DENV encodes a polyprotein precursor, which is cleaved by cellular and viral protease into three structural proteins, the capsid (C), precursor membrane (PrM), and envelope (E), as well as seven nonstructural proteins NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5.
- the E protein a glycoprotein of approximately 55 kDa, contains 12 strictly conserved cysteine residues forming six disulfide bridges and is present as a heterodimer with PrM protein before the maturation of the virion. E protein participates in virus entry and is the major target of both neutralizing and enhancing antibodies.
- the PrM protein is a glycoprotein of about 19 kDa. It contains six highly conserved cysteine residues forming three disulfide bridges.
- the NS1 protein is also a glycoprotein of about 40 kDa. It contains 12 highly conserved cysteine residues forming six disulfide bridges. NS1 is present intracellularly, on the cell surface, and outside of the cells.
- SEQ ID NO: 1 is the polypeptide sequence of the coronavirus SARS-CoV-2 Spike protein per gene bank accession NC_045512 and including polymorphisms already reported MT077125 and ancestor QHR63300 RaTG13.
- SEQ ID NO: 2 is the polypeptide sequence of the coronavirus Nucleocapsid protein (NCBI Reference Sequence: YP_009724397.2)
- SEQ ID NO: 3 is the polypeptide sequence of the Dengue vims 1 NS1 protein
- VVVDEHCGNRGP SLRTTTVT GKTIHEWCCRSCTLPPLRFKGEDGCW Y GMEIRP VKE
- SEQ ID NO: 4 is the polypeptide sequence of the Dengue vims 2 NS1 protein
- SEQ ID NO: 5 is the polypeptide sequence of the Dengue vims 3 NS1 protein
- SEQ ID NO: 6 is the polypeptide sequence of the Dengue vims 4 NS1 protein (NCBI Reference Sequence: NP_740318.1)
- SEQ ID NO: 7 is the polypeptide sequence of the Asian strain of Zika vims NS1 protein (NCBI Reference Sequence: YP_009430301.1).
- SEQ ID NO: 8 is the polypeptide sequence of the African strain of Zika vims NS1 protein (NCBI Reference Sequence: YP_009227199.1).
- SEQ ID NO: 11 is the polypeptide sequence of the Dengue vims 3 PrM protein
- SEQ ID NO: 12 is the polypeptide sequence of the Dengue vims 4 PrM protein
- SEQ ID NO: 13 is the polypeptide sequence of the Asian strain of the Zika vims
- PrM protein (NCBI Reference Sequence: YP_009430297.1)
- SEQ ID NO: 14 is the polypeptide sequence of the African strain of the Zika vims PrM protein (NCBI Reference Sequence: YP_009227197.1)
- Example 1 Approach for developing a rapid diagnostic platform to detect viral antigens
- B cells from the spleen or lymph nodes were fused with mouse myeloma cells to generate hybridomas.
- Initial hybridoma screening (209 DENV hybridomas and 104 ZIKV hybridomas) was performed by enzyme-linked immunosorbent assay (ELISA) using individual rNSl protein as antigen (step 1; Table 1).
- ELISA enzyme-linked immunosorbent assay
- Table 1 Stepwise description of the approaches used to define antibodies that detect and distinguish DENV1-4 NS1 and the ZIKV NS1 proteins.
- Step 3 an 11 X 11 matrix was used to test all combinations of 11 anti-DENV NS1 pairs using each of the four DENVNS1 proteins.
- a 10 X 10 matrix was used to test all combinations of 10 anti-ZIKVNSl pairs using ZIKVNS1 protein as well as each of the four DENV serotype NS1 proteins.
- the matrix-based screening identified optimal monoclonal antibody pairs that detected NS1 without crossover interference.
- DENV dengue virus
- ZIKV Zika virus.
- AMINO ACID HOMOLOGY [0176] Table 2. Amino acid homology and identity among DENV NS1 and ZIKY NS1 proteins. The matrix shows comparisons of percentage amino acid identity (exact positional amino acid matches in the amino acid sequences) and percentage amino acid homology (positional amino acid substitutions by amino acids with similar physicochemical properties) for the DENV and ZIKV NS1 proteins. Dengue virus and Zika virus NS1 sequences were extracted from deposited data (Zika: KX702400.1; DENV1 : GUI 31834.1; DENV2: GQ868641.1; DENV3 : KF955487.1; DENV4: GQ868645.1. These sequences represent viruses that were isolated from the same geographic area in years 2001-2016 for a representative sampling. The BLAST algorithm from the National Center for Biotechnology Information, U.S. National Library of Medicine was used to generate the identity and similarity scores among the NS1 proteins.
- step 2 hybridoma supernatants were used to stain permeabilized Vero cells that had been infected with known ZIKV or DENV viral serotypes.
- Flow cytometric analysis demonstrated that the mAbs recognized native NS1 protein expressed by virus-infected cells and provided a quantitative analysis of cross-reactive binding when ZIKV antibodies were used to stain DENV-infected cells and vice versa.
- the 11 DENV mAbs and 10 ZIKV mAbs recognized NS1 protein present in the virus-infected cells; therefore, the hybridomas were expanded, and the mAb isotypes were defined in preparation for affinity chromatography purification.
- the purified antibodies were tested in immunochromatography pairs (step 3; Figure 11 and Table 1), with one antibody conjugated to gold nanoparticles and one antibody adsorbed to nitrocellulose membrane.
- the 11 DENV hybridomas were tested in a matrix for interactions with DENV NS1 serotypes 1 to 4, ZIKV NS1, or without added antigen as a control.
- the 10 ZIKV mAbs were also tested in a matrix using ZIKV NS1, a mixture of the four DENV serotype NS1 proteins, or no antigen as a control.
- Testing throughput was increased by using the half-strip dipstick format, where dipsticks are run in rapid format (about 20 min, depending on humidity conditions) by placing them in microcentrifuge tubes containing small-volume suspensions of conjugated nanoparticles and sample without need for sample paper pads and conjugate paper pads that are characteristic of lateral flow chromatography.
- the DENV and ZIKV matrices and the immunochromatography results are shown in Figure 13.
- Eight DENY mAbs and two ZIKV mAbs were ultimately incorporated into the rapid tests used to analyze patient samples.
- the 10 mAb names, their relative NS1 recognition values in initial screening, and the final application in the rapid tests are shown in Fig. 11 and Table 3.
- Table 3 List of mAbs used in the rapid tests, relative binding values, and summary of final use in the DENV and ZIKV immunochromatography tests.
- the antibody name is shown at the left column with the antigen (ag) that was used to inject the mice to generate the antibody.
- the immunochromatography application of each antibody is in the right column.
- the center columns show “fold over background” (FOB) ELISA values for each of the antigens used as bait on the ELISA plates (DENV 1-4 NS1; upper, or ZIKVNS1 or pooled flavivirus NS1 panel; lower).
- These numbers define differential recognition of each of the four dengue NS1 antigens during initial screening ( Figure 11, step 1). This differential recognition formed the initial selection of the antibodies for use in the final test
- Example 2 Linear peptide epitope mapping: Mechanisms of specific mAb- NS1 interactions
- step 4 To begin to define mechanisms of specific mAb-NSl interactions, we performed linear peptide epitope mapping (step 4; Figure 11 and Table 1). Libraries of tiled DENV NS1 peptides were spotted onto nitrocellulose membranes and incubated with antibody. After washing, positive signals were detected using an anti-mouse IgG antibody coupled to horseradish peroxidase for signal development. In a second approach, tiled peptides were synthesized on glass slides and incubated with each of the antibodies. Positive signals were detected by immunofluorescence microscopy and were scored. The epitope mapping data are summarized in Fig. 14.
- mAb 7724.323 (“323”) fits the definition of a pan-DENV NS1 antibody because it recognizes all four serotype NS1 proteins in the epitopes 109 to 124 amino acid region.
- Six antibodies used in the rapid tests (using suffix nomenclature only: 55, 323, 1, 130, 110, and 271) recognize the amino acids 109 to 124 epitope of the “wing” domain (amino acids 30 to 180).
- these six antibodies do not recognize the ZIKV NS1 protein ( Figure 14 B and 13). The epitope mapping helped to explain the observed antibody specificity in the rapid tests.
- the shared DENV1-4 NS1 region D/ELKYSWKTWG (amino acids 110 to 119) is not conserved in ZIKVNSl; rather, the comparable ZIKVNS1 region has a distinct amino acid sequence ( Figure 14 B), explaining how DENV NS1 mAbs, represented by the members of the 1/55/110/130/271/323 mAb group, do not cross-react with the ZIKV NS1 protein.
- mAb 243 which showed high specificity for DENV2 (tables S3 and S4), recognized peptides 313 to 330 in DENV2 NS1 ( Figure 14 B).
- the screening approaches, combined with the epitope mapping contributed to selecting antibodies representing positional epitope diversity; that is, epitopes in both the wing/wing connector/finger and b-ladder domains ( Figure 14).
- the mAb 323 recognized DENV1-4, however, we found that when used as a 323/323 homo-pair, the detection of DENV4 NS1 in the pan-DENV test was not optimal. Therefore, by conjugating a mixture of mAb on the pan antibody nanoparticles (271, 243, 411, and 626), we achieved improved limit of detection results in the pan-DENV dipstick test.
- the linear peptide epitope mapping data provide an important framework for understanding the mechanisms of serotype-specific DENV detection and differential detection of DENV and ZIKV.
- Example 3 Detection of native virus (SARS-CoV-2) Nucleocapsid and spike antigens
- Figure 7 shows a high throughput screen that identifies monoclonal antibody pairing to detect specific viral targets.
- the test areas are loaded with the immobilized antibodies a-mouse Fc (control antibody), a-SARS-CoV-2 S, and a-SARS- CoV-2 N.
- the antibodies a-SARS-CoV-2 S and a-SARS-CoV-2 S are also conjugated to nanoparticles.
- the peptides SARS-CoV-2 S and N are also introduced to the reactions.
- the test areas are (left to the splitters): a-human Fc (control antibody), a-DENV-2 NS1, and a-SARS-CoV-2 S.
- the test areas right to the splitters are a-mouse Fc (control antibody), a-DENV-3 NS1, and a-SARS-CoV-2 N.
- the conjugated antibodies are a-DENV- 2 NS1, a-DENV-3 NS1, a-SARS-CoV-2 S, and a-SARS-CoV-2 N.
- the antigens introduced to the reactions are DENV-2 NS1, SARS-CoV-2 S, and SARS-CoV-2 N.
- Example 4 Monoclonal antibody pairs that detect SARS-Coronaviruses
- Figure 8 shows a high throughput screen that identifies monoclonal antibody pairs that detect SARS-Coronaviruses with varying levels of specificity and strength.
- Figure 9 shows a high throughput screen to map protein peptides recognized by monoclonal antibodies.
- Four peptides corresponding to different portions ofDEV S-1 were immobilized on the dipstick test areas.
- the upper right rest area was loaded with a control antibody a-mouse Fc.
- Conjugated antibody a-DENV NS 1 was allowed to bind to the immobilized peptides and control antibody.
- Example 6 Matrix of mAb pair trials for S protein [0190] To define functional antibody pairs, one antibody was conjugated to gold nanoparticles, and one antibody was adsorbed to nitrocellulose membrane. The resulting nanoparticle conjugates-membrane pairs were tested using the specific serotype recombinant S protein and S protein domains (S protein, Receptor-binding Domain of the S protein (RBD), N-terminal domain of the S protein (NTD)).
- S protein Receptor-binding Domain of the S protein
- NTD N-terminal domain of the S protein
- Figure 10 shows an antibody grid from a high throughput screening.
Abstract
The subject matter disclosed herein relates to high throughput screening for monoclonal antibodies pairs that can be translated into rapid immunochromatography tests to specifically detect the viral protein antigens and distinguish between the closely related viruses and serotypes without cross-reaction.
Description
HIGH THROUGHPUT SCREENING FOR MONOCLONAL ANTIBODY PAIRS
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U S C § 119(e) to United States Provisional Patent Application Number 63/049,178 entitled HIGH THROUGHPUT SCREENING FOR MONOCLONAL ANTIBODY PAIRS, filed July 8, 2020, the contents of which is hereby incorporated by reference in its entirety.
INCORPORATION BY REFERENCE
[0002] All patents, patent applications and publications cited herein are hereby incorporated by reference in their entirety. The disclosures of these publications in their entireties are hereby incorporated by reference into this application.
[0003] This patent disclosure contains material that is subject to copyright protection.
The copyright owner has no objection to the facsimile reproduction by anyone of the patent document or the patent disclosure as it appears in the U.S. Patent and Trademark Office patent file or records, but otherwise reserves any and all copyright rights.
BACKGROUND OF THE INVENTION
[0004] A viral infection is the proliferation of a harmful virus inside a subject’s body. Viruses depend on host cells for their reproduction. Coronavirus (CoV) disease COVID-19 is a fast spreading worldwide pandemic caused by a coronavirus strain. Symptoms can appear 2-14 days after exposure and include fever, cough, and shortness of breath. Flavivirus strains cause widespread morbidity and mortality throughout the world. They are transmitted by ticks and are responsible of encephalitis and hemorrhagic diseases.
SUMMARY OF THE INVENTION
[0005] In certain aspects, the invention provides an immunoassay for testing the suitability of a monoclonal antibody pair for use in a lateral flow assay to detect a target protein, wherein the monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody, wherein the first and the second monoclonal antibodies are capable of specifically binding the target protein.
[0006] In some embodiments, the first and the second monoclonal antibodies have been purified with protein L or protein G resins. In some embodiments, the first monoclonal antibody is immobilized on a solid support, and the second monoclonal antibody is conjugated to a visualizing agent. In some embodiments, the visualizing agent-conjugated second monoclonal antibody and the target protein are allowed to bind to the immobilized first monoclonal antibody at the same time. In some embodiments, the solid support is a nitrocellulose membrane.
[0007] In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0008] In some embodiments, the first monoclonal antibody is different from the second monoclonal antibody. In some embodiments, the first monoclonal antibody is the same as the second monoclonal antibody.
[0009] In some embodiments, the target protein is a viral antigen. In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0010] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0011] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue
virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0012] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0013] In certain aspects, a high throughput immunoassay includes a multitude of immunoassays as described above, wherein the multitude of immunoassays are conducted at the same time and in the same device.
[0014] In some embodiments, the first monoclonal antibodies of more than one immunoassays are immobilized on the same solid support. In some embodiments, the high throughput assay is conducted for selecting a suitable monoclonal antibody pair for use in a lateral flow assay to detect a target protein, and the selection is from a collection of monoclonal antibodies capable of specifically binding the target protein, wherein the selected monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody.
[0015] In some embodiments, a multitude of combinations of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein are tested in the same high throughput immunoassay as the first and the second monoclonal antibody. In some embodiments, in some of the multitude of combinations the first monoclonal antibody is the same as the second monoclonal antibody.
[0016] In some embodiments, every combination of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein as the first and the second antibody, respectively, is tested in the same high throughput
immunoassay. In some embodiments, in some of the combinations the first monoclonal antibody is the same as the second monoclonal antibody.
[0017] In certain aspects, a high throughput immunoassay device includes a commercially available multi-well plate, multiple test trips, a holder for the test strips, wherein the distal end of each test strip is immersed in one well of the multiple-well plate, and wherein each test strip comprises a solid support for immobilized proteins or peptides. [0018] In some embodiments, each test strip comprises a proximal wick portion and a distal dipstick portion, wherein the end of each dipstick portion is immersed in one well of the multi-well plate. In some embodiments, the dipstick portion comprises a test area, wherein the test area can provide support for one immobilized protein or peptide. In some embodiments, the dipstick portion comprises multiple test areas, wherein each test area can provide support for one immobilized protein or peptide. In some embodiments, the multiple test areas of the dipstick portion are arranged in a single vertical row along the vertical axis of the dipstick. In some embodiments, the dipstick is shaped as a string of overlapping diamonds, wherein each diamond shape provides one test area. In some embodiments, the dipstick comprises three overlapping diamond shapes.
[0019] In some embodiments, the dipstick has one or more flow splitters, wherein the flow splitters are gaps in the test strips parallel to the vertical axis of the dipstick, wherein each flow splitter divides the dipstick into two half-strip dipstick sections at the level of the flow splitter, and wherein the two half-strip dipstick sections are to the left and to the right of the flow splitter. In some embodiments, each half-strip dipstick section provides one test area. In some embodiments, at least some of the diamond shapes encompass a flow splitter and are divided into two half-diamond dipstick sections at the level of the flow splitter. In some embodiments, each half-diamond dipstick section provides one test area. In some embodiments, the wick portion of the test strip comprises a T-shaped handle of the test strip. [0020] In some embodiments, the holder for the test strips comprises a plate-shaped aligner with a multitude of slots, wherein the aligner is placed above the multi-well plate, wherein each slot can accommodate one test strip, and wherein the positions of the slots correspond to the positions of the wells in the multi-well plate so that the distal end of the test strip vertically extending through a slot can be localized in a well. In some embodiments, the aligner slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle. In some embodiments, the width of the aligner slots is similar to the thickness of the test strips, and wherein the width of the
aligner slots is sufficient to accommodate the test strip extending through the slot. In some embodiments, the aligner slots are diagonally oriented to the aligner.
[0021] In some embodiments, the holder for the test strips further comprises a top plate with a multitude of top plate slots, wherein the top plate is placed above the aligner, wherein each top plate slot can accommodate one test strip, and wherein the positions of the top plate slots align with the positions of the aligner slots below in diagonal orientations so that a test strip vertically extending through a top plate slot can also extend through an aligner slot below. In some embodiments, the top plate slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle. In some embodiments, the width of the top plate slots is similar to the thickness of the test strips, and wherein the width of the top plate slots is sufficient to accommodate the test strip extending through the slot. In some embodiments, there is one top plate slot and one aligner slot that corresponds to every well in the multi-well plate.
[0022] In some embodiments, the high throughput immunoassay device further includes an outer housing container, wherein the multi-well plate, the test strips, the aligner, and the top plate are all placed in the housing container. In some embodiments, the multi-well plate is a 96-well plate. In some embodiments, the multi-well plate is a flat-bottom 96-well plate. In some embodiments, the multi-well plate is a round-bottom 96-well plate.
[0023] In some embodiments, there are snap tabs on the inner walls of the housing container. In some embodiments, the snap tabs can snap-fit to the multi-well plates. In some embodiments, the device can accommodate multiple commercially available multi-well plates and multiple holders for the test strips.
[0024] In certain aspects, the invention provides an immunoassay for testing the binding capacity between a monoclonal antibody and a protein or peptide, wherein the protein or peptide is immobilized on a solid support, and wherein the monoclonal antibody is conjugated to a visualizing agent.
[0025] In some embodiments, the visualizing agent -conjugated monoclonal antibody is allowed to bind to the immobilized protein or peptide. In some embodiments, the solid support is a nitrocellulose membrane. In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0026] In some embodiments, the protein or peptide is a viral antigen. In some embodiments, the protein or peptide is a portion of a viral antigen. In some embodiments, the portion of a viral antigen has a length of 9-15 amino acid.
[0027] In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is SARS- CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0028] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0029] In certain aspects, the invention provides a high throughput immunoassay which includes a multitude of immunoassays previously described, wherein the multitude of the immunoassays are conducted at the same time and in the same device.
[0030] In some embodiments, the proteins or peptides of more than one immunoassays are immobilized on the same solid support. In some embodiments, the high throughput immunoassay is conducted to map the peptide recognized by a monoclonal antibody, wherein the peptide is localized within a target protein recognized by the monoclonal antibody. In some embodiments, a multitude of peptides from the target protein are tested in the same high throughput immunoassay against the same monoclonal antibody, wherein the protein is known to bind to the antibody.
[0031] In some embodiments, the target protein is a viral antigen. In some embodiments, the target protein is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some
embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0032] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0033] In some embodiments the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0034] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0035] In certain aspects, the invention provides a high throughput screening method for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, the method comprising:
obtaining a collection of candidate monoclonal antibodies that specifically bind to the target protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate monoclonal antibody on at least one of the test areas of the at least one test strip, except the uppermost test area of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to at least one candidate monoclonal antibody; applying the target protein and the at least one visualizing agent conjugated candidate monoclonal antibody in the multi-well plate, wherein each well is provided with the target protein and one conjugated candidate monoclonal antibody, and wherein the positions of the wells correspond to the positions of the at least one test strips; immersing the distal end of the at least one test strips to the corresponding wells with the target protein and the at least one visualizing agent conjugated-candidate monoclonal antibody; allowing the target protein and the at least one visualizing agent-conjugated candidate monoclonal antibody to vertically defuse through the test strip and contact the immobilized monoclonal antibodies and the control antibody; incubating the reaction for at least 15-30 minutes; and recoding the signal of each test area on the at least one test strip.
[0036] In some embodiments, the control antibody is an antibody that specifically binds the candidate monoclonal antibodies. In some embodiments, the control antibody is an antibody that specifically binds the Fc portion of the candidate monoclonal antibodies.
[0037] In some embodiments, each candidate monoclonal antibody is conjugated with a visualization agent and tested against each candidate monoclonal antibody immobilized on the test strip. In some embodiments, each candidate monoclonal antibody is immobilized on at least one test strip and tested against each candidate monoclonal antibody conjugated with a visualization agent. In some embodiments, each candidate monoclonal antibody is conjugated with a visualizing agent and tested against the same candidate monoclonal antibody on a test strip.
[0038] In some embodiments, the portion of the test strip that contacts the immobilized antibodies is nitrocellulose membrane. In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0039] In some embodiments, the target protein is a viral antigen. In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0040] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0041] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0042] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0043] In certain aspects, the invention provides a high throughput selection platform for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, wherein detecting the target protein comprises distinguishing the target protein from non-target proteins that are similar to the target protein, the method including: conducting the high throughput screening method previously described with the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; conducting the high throughput screening method previously described with each of the non-target proteins that are similar to the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; comparing the signal intensity of the tested antibody pairings for the target protein and for each of the non-target proteins that are similar to the target protein; selecting the antibody parings that are capable of recognizing the target protein and distinguishing between the target protein and the non-target proteins that are similar to the target protein.
[0044] In some embodiments, the high throughput screening with the non-target proteins similar to the target protein and the high throughput screening with the target protein are conducted in the same device and at the same time.
[0045] In some embodiments, the target protein is a viral antigen. In some embodiments, the target protein viral antigen is a coronavirus (CoV) antigen. In some embodiments, the target protein coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N). [0046] In some embodiments, the target protein coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV- 2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the target protein coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the target protein coronavirus (CoV) antigen is a portion of SARS-CoV- 2 Spike Protein (SARS-CoV-2S). In some embodiments, the target protein coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0047] In some embodiments, the non-target proteins that are similar to the target protein are viral antigens. In some embodiments, the non-target protein viral antigens are
coronavirus (CoV) antigens. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are proteins from coronavirus (CoV) strains selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are proteins from SARS-CoV-2. In some embodiments, at least some of the non target protein coronavirus (CoV) antigens are not proteins from SARS-CoV-2. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the coronavirus (CoV) antigens are Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU 1.
[0048] In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions of proteins from SARS-CoV-2. In some embodiments, at least some of the non target protein coronavirus (CoV) antigens are not portions of proteins from SARS-CoV-2. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions from Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions from Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
[0049] In some embodiments, the target protein viral antigen is a flavivirus antigen. In some embodiments, the target protein flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the target protein flavivirus antigen is flavivirus
non- structural protein 1 (NS1). In some embodiments, the target protein flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0050] In some embodiments, the target protein flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the target protein flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1). In some embodiments, the target protein flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0051] In some embodiments, the non-target protein viral antigens are flavivirus antigens. In some embodiments, at least some of the non-target protein flavivirus antigens are proteins from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, at least some of the non-target protein flavivirus antigens are flavivirus non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivirus antigens are flavivirus precursor membrane (PrM) protein.
[0052] In some embodiments, at least some of the non-target protein flavivirus antigens are portions of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, at least some of the non-target protein flavivirus antigens are portions of flavivirus non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivirus antigens are portions of flavivirus precursor membrane (PrM) protein.
[0053] In certain aspects, the invention provides a high throughput screening method for mapping the peptide that is recognized by a monoclonal antibody within a target protein recognized by the monoclonal antibody, the method including: obtaining a collection of overlapping candidate peptides that are fragments of the protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate peptide on at least one of the test areas of the at least one test strip, except the uppermost test areas of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to the monoclonal antibody; applying the visualizing agent conjugated monoclonal antibody in wells of the multi-well plate corresponding the positions of the at least one test strips; immersing the distal end of the at least one test strips into the corresponding wells with the visualizing agent conjugated monoclonal antibody; allowing the visualizing agent conjugated monoclonal antibody to vertically defuse through the test strips and contact the immobilized peptides and the control antibody; incubating the reaction for at least 15-30 minutes; recoding the signal of each test area on the at least one test strip.
[0054] In some embodiments, the control antibody is an antibody that specifically binds the monoclonal antibody. In some embodiments, the control antibody is an antibody against the Fc portion of the monoclonal antibody. In some embodiments, each of the candidate peptides is immobilized on at least one test strip and tested against the visualizing agent conjugated monoclonal antibody.
[0055] In some embodiments, the portion of the test strip that contacts the immobilized candidate peptides is nitrocellulose membrane. In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0056] In some embodiments, the target protein is a viral antigen. In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-
2S). In some embodiments, the coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0057] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of protein from SARS-CoV-2 In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0058] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0059] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0060] In some embodiments, the invention provides a method to utilize the high throughput immunoassay device as described above, wherein one group of test strips are utilized to conduct the high throughput screening for antibody paring as described above, and another group of test strips are utilized to conduct the high throughput mapping as described above.
[0061] In some embodiments, the tests utilizing the two groups of test strips are started and interpreted at the same time. In some embodiments, the tests utilizing the two groups of test strips are started or interpreted at different times.
BRIEF DESCRIPTION OF FIGURES
[0062] The patent or application fde contains at least one drawing originally in color. [0063] Figure 1 shows a schematic diagram of some embodiments of individual components of a high throughout immunoassay device.
[0064] Figure 2 shows a photo of one embodiment of a high-throughput immunoassay device.
[0065] Figure 3 shows detailed technical specification of one embodiment of Test Strip Assembly, Dipstick, and Wick of the high-throughput immunoassay device.
[0066] Figure 4 shows detailed technical specification of one embodiment of the Top Plate high-throughput immunoassay device.
[0067] Figure 5 shows detailed technical specification of one embodiment of the Divider/ Aligner high-throughput immunoassay device.
[0068] Figure 6 shows detailed technical specification of embodiments of Holders of the high-throughput immunoassay device for 96-well round bottom and flat bottom plates, respectively.
[0069] Figure 7 shows a high throughput screen test to identify monoclonal antibody pairing to detect specific viral targets. In the left panel, the test areas are loaded with the immobilized antibodies a-mouse Fc (control antibody), a-SARS-CoV-2 S, and a-SARS- CoV-2 N. The antibodies a-SARS-CoV-2 S and a-SARS-CoV-2 S are also conjugated to nanoparticles. The peptides SARS-CoV-2 S and N are introduced to the reactions as well. In the right panel, the test areas are (left to the splitters): a-human Fc (control antibody), a- DENV-2 NS1, and a-SARS-CoV-2 S The test areas right to the splitters are a-mouse Fc (control antibody), a-DENV-3 NS1, and a-SARS-CoV-2 N. The conjugated antibodies are a-DENV-2 NS1, a-DENV-3 NS1, a-SARS-CoV-2 S, and a-SARS-CoV-2 N. The antigens introduced to the reactions are DENV-2 NS1, SARS-CoV-2 S, and SARS-CoV-2 N.
[0070] Figure 8 shows a high throughput screen that identifies monoclonal antibody pairs that detect SARS-Coronaviruses with varying levels of specificity and strength.
[0071] Figure 9 shows a high throughput screen to map protein peptides recognized by monoclonal antibodies. Four peptides corresponding to different portions ofDEV S-1 were
immobilized on the dipstick test areas. The upper right rest area was loaded with a control antibody a-mouse Fc. Conjugated antibody a-DENV NS 1 was allowed to bind to the immobilized peptides and control antibody.
[0072] Figure 10 shows Leinco antibody grid from a high throughput screening.
[0073] Figure 11 shows stepwise strategy for identifying mAbs that differentiate the closely related NS1 proteins of DENV1-4 and ZIKV. Step 1 : mouse hybridomas are generated by immunizing mice with viral NS1 protein antigen, and the resulting hybridomas are screened using ELISA against multiple recombinant NS1 proteins. Step 2: hybridoma cell supernatants containing monoclonal antibodies are screened using flow cytometry for recognition of native NS1 proteins released by Yero cells infected with DENV serotypes or ZIKV. Step 3 : purified monoclonal antibodies are tested in pairs for specific recognition of DENV or ZIKV NS1 proteins in immunochromatography rapid tests that run in about 30 minutes. Step 4: linear epitope mapping is performed to identify NS1 sites recognized by monoclonal antibodies used in the rapid tests. Step 5: patient serum from DENV- or ZIKV- infected patients is tested using the immunochromatography dipsticks. Step 6: images of test results are captured using image recognition on a mobile phone camera, and analyzed objectively to quantify signals.
[0074] Figure 12 shows Repertoire of antigen-specific antibodies among DENV and ZIKV mAbs. The pie charts show the percentages of dengue serotype-specific or Zika virus- specific monoclonal antibodies as defined during screening. The values were determined by screening the hybridomas against the antigens labeled on the figures. The ZIKA virus monoclonal antibody preparation was done by two methods (splenic B cells and lymph node tissue).
[0075] Figure 13 shows Matrix of mAb pair trials. To define functional antibody pairs, one antibody was conjugated to gold nanoparticles, and one antibody was adsorbed to nitrocellulose membrane. The resulting nanoparticle conjugates-membrane pairs were tested using the specific serotype recombinant NS 1 protein (on the left axis: mock, DENV1, DENV2, DENV3, DENV 4, ZIKV, or a DV 1-4 mix of all four NS 1 proteins; highlighted in blue color). These proteins were present at a concentration of 1.6 ug/ml in the testing. Because of the large number of tests performed, the strips were analyzed and normalized in groups corresponding to nanoparticle lots and antibody dilutions. The signal for each test strip was quantified using Image! Background signal intensity was subtracted and the signal of greatest intensity was set at a value of “1”. For remaining strips, background was
subtracted from signal intensity to yield a corrected intensity value. The corrected intensity value was then divided by the maximal signal value to yield a value between 0 and 1 that was plotted above to generate a relative binding affinity map. Dark green color: strong visual signal in the rapid test; light green color: weak visual signal in the rapid test; gray color: no signal in the rapid test. These tests were performed using lab-made gold nanoparticles, which perform equivalently in comparison to commercial Innova particles. The antibody pairs were tested at a sample concentration of 3 rg/ml of recombinant NS 1 protein. Left panel: dengue virus antibodies; Right panel: Zika virus antibodies, with the exception of 136, a dengue NS1 antibody that binds Zika virus NS1 with high affinity.
[0076] Figure 14 shows NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype-specific NS1 rapid tests, pan-DENVNSl test, and ZIKVNS1 test. (A) Table listing mAb names, mAb immunochromatography applications, mAb linear epitope sequences and starting amino acid positions, and NS1 domain positions. (B) Comparison of amino acid similarity based on analysis ofNSl protein sequences from the following viruses: DENV1 (strain Singapore/S275/1990), accession number P33478; DENV2 (strain New Guinea C), accession number AAA42941; DENV3 (strain Philippines/H87/1956), accession number AAA99437; DENV4 (strain Singapore/8976/1995), accession number AAV31422; ZIKV, accession number KU497555.1. Amino acid sequences were compared using Color Align Conservation www.bioinformatics.org/sms2/color_align_cons.html to enhance the output of sequence alignment program. Residues that are identical among the sequences are boxed. Linear peptide epitopes (B) are italicized and indicated in color in the figure, with the key to the right of the figure.
DETAILED DESCRIPTION OF THE INVENTION
[0077] Because ZD V and DENV are related flaviviruses, their homologous proteins and nucleic acids can cause cross-reactions and false-positive results in molecular, antigenic, and serologic diagnostics. Such cross-reactions and false-positive results can also occur for related coronaviruses. There is a need for characterization of monoclonal antibody pairs that can be translated into rapid immunochromatography tests to specifically detect the viral protein antigens and distinguish between the closely related viruses and serotypes without
cross-reaction, to enable a rapid and reliable test for viral infections such as the coronavirus strain SARS-CoV-2.
[0078] Non-Limiting Embodiments of the Subject Matter [0079] In certain aspects, the invention provides an immunoassay for testing the suitability of a monoclonal antibody pair for use in a lateral flow assay to detect a target protein, wherein the monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody, wherein the first and the second monoclonal antibodies are capable of specifically binding the target protein.
[0080] In some embodiments, the first and the second monoclonal antibodies have been purified with protein L or protein G resins. In some embodiments, the first monoclonal antibody is immobilized on a solid support, and the second monoclonal antibody is conjugated to a visualizing agent. In some embodiments, the visualizing agent-conjugated second monoclonal antibody and the target protein are allowed to bind to the immobilized first monoclonal antibody at the same time. In some embodiments, the solid support is a nitrocellulose membrane.
[0081] In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0082] In some embodiments, the first monoclonal antibody is different from the second monoclonal antibody. In some embodiments, the first monoclonal antibody is the same as the second monoclonal antibody.
[0083] In some embodiments, the target protein is a viral antigen. In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0084] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-
CoV, MERS-CoV, 229E, NL63, OC43, and HKUE In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S) In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0085] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0086] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0087] In certain aspects, a high throughput immunoassay includes a multitude of immunoassays as described above, wherein the multitude of immunoassays are conducted at the same time and in the same device.
[0088] In some embodiments, the first monoclonal antibodies of more than one immunoassays are immobilized on the same solid support. In some embodiments, the high throughput assay is conducted for selecting a suitable monoclonal antibody pair for use in a lateral flow assay to detect a target protein, and the selection is from a collection of monoclonal antibodies capable of specifically binding the target protein, wherein the selected monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody.
[0089] In some embodiments, a multitude of combinations of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein are tested in the same high throughput immunoassay as the first and the second monoclonal antibody. In some embodiments, in some of the multitude of combinations the first monoclonal antibody is the same as the second monoclonal antibody.
[0090] In some embodiments, every combination of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein as the first and the second antibody, respectively, is tested in the same high throughput immunoassay. In some embodiments, in some of the combinations the first monoclonal antibody is the same as the second monoclonal antibody.
[0091] In certain aspects, a high throughput immunoassay device includes a commercially available multi-well plate, multiple test trips, a holder for the test strips, wherein the distal end of each test strip is immersed in one well of the multiple-well plate, and wherein each test strip comprises a solid support for immobilized proteins or peptides. [0092] In some embodiments, each test strip comprises a proximal wick portion and a distal dipstick portion, wherein the end of each dipstick portion is immersed in one well of the multi-well plate. In some embodiments, the dipstick portion comprises a test area, wherein the test area can provide support for one immobilized protein or peptide. In some embodiments, the dipstick portion comprises multiple test areas, wherein each test area can provide support for one immobilized protein or peptide. In some embodiments, the multiple test areas of the dipstick portion are arranged in a single vertical row along the vertical axis of the dipstick. In some embodiments, the dipstick is shaped as a string of overlapping diamonds, wherein each diamond shape provides one test area. In some embodiments, the dipstick comprises three overlapping diamond shapes.
[0093] In some embodiments, the dipstick has one or more flow splitters, wherein the flow splitters are gaps in the test strips parallel to the vertical axis of the dipstick, wherein each flow splitter divides the dipstick into two half-strip dipstick sections at the level of the flow splitter, and wherein the two half-strip dipstick sections are to the left and to the right of the flow splitter. In some embodiments, each half-strip dipstick section provides one test area. In some embodiments, at least some of the diamond shapes encompass a flow splitter and are divided into two half-diamond dipstick sections at the level of the flow splitter. In some embodiments, each half-diamond dipstick section provides one test area. In some embodiments, the wick portion of the test strip comprises a T-shaped handle of the test strip.
[0094] In some embodiments, the holder for the test strips comprises a plate-shaped aligner with a multitude of slots, wherein the aligner is placed above the multi-well plate, wherein each slot can accommodate one test strip, and wherein the positions of the slots correspond to the positions of the wells in the multi-well plate so that the distal end of the test strip vertically extending through a slot can be localized in a well. In some embodiments, the aligner slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle. In some embodiments, the width of the aligner slots is similar to the thickness of the test strips, and wherein the width of the aligner slots is sufficient to accommodate the test strip extending through the slot. In some embodiments, the aligner slots are diagonally oriented to the aligner.
[0095] In some embodiments, the holder for the test strips further comprises a top plate with a multitude of top plate slots, wherein the top plate is placed above the aligner, wherein each top plate slot can accommodate one test strip, and wherein the positions of the top plate slots align with the positions of the aligner slots below in diagonal orientations so that a test strip vertically extending through a top plate slot can also extend through an aligner slot below. In some embodiments, the top plate slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle. In some embodiments, the width of the top plate slots is similar to the thickness of the test strips, and wherein the width of the top plate slots is sufficient to accommodate the test strip extending through the slot. In some embodiments, there is one top plate slot and one aligner slot that corresponds to every well in the multi-well plate.
[0096] In some embodiments, the high throughput immunoassay device further includes an outer housing container, wherein the multi-well plate, the test strips, the aligner, and the top plate are all placed in the housing container. In some embodiments, the multi-well plate is a 96-well plate. In some embodiments, the multi-well plate is a flat-bottom 96-well plate. In some embodiments, the multi-well plate is a round-bottom 96-well plate.
[0097] In some embodiments, there are snap tabs on the inner walls of the housing container. In some embodiments, the snap tabs can snap-fit to the multi-well plates. In some embodiments, the device can accommodate multiple commercially available multi-well plates and multiple holders for the test strips.
[0098] In certain aspects, the invention provides an immunoassay for testing the binding capacity between a monoclonal antibody and a protein or peptide, wherein the protein or
peptide is immobilized on a solid support, and wherein the monoclonal antibody is conjugated to a visualizing agent.
[0099] In some embodiments, the visualizing agent -conjugated monoclonal antibody is allowed to bind to the immobilized protein or peptide. In some embodiments, the solid support is a nitrocellulose membrane. In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0100] In some embodiments, the protein or peptide is a viral antigen. In some embodiments, the protein or peptide is a portion of a viral antigen. In some embodiments, the portion of a viral antigen has a length of 9-15 amino acid.
[0101] In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is SARS- CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0102] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0103] In certain aspects, the invention provides a high throughput immunoassay which includes a multitude of immunoassays previously described, wherein the multitude of the immunoassays are conducted at the same time and in the same device.
[0104] In some embodiments, the proteins or peptides of more than one immunoassays are immobilized on the same solid support. In some embodiments, the high throughput
immunoassay is conducted to map the peptide recognized by a monoclonal antibody, wherein the peptide is localized within a target protein recognized by the monoclonal antibody. In some embodiments, a multitude of peptides from the target protein are tested in the same high throughput immunoassay against the same monoclonal antibody, wherein the protein is known to bind to the antibody.
[0105] In some embodiments, the target protein is a viral antigen. In some embodiments, the target protein is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0106] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0107] In some embodiments the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0108] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA),
Japanese encephalitis (JE) vims, West Nile vims (WNV), Deer tick (DTV) tick-borne encephalitis vims (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever vims (OE1FV). In some embodiments, the flavivirus antigen is a portion of flavivirus non-stmctural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0109] In certain aspects, the invention provides a high throughput screening method for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, the method comprising: obtaining a collection of candidate monoclonal antibodies that specifically bind to the target protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate monoclonal antibody on at least one of the test areas of the at least one test strip, except the uppermost test area of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to at least one candidate monoclonal antibody; applying the target protein and the at least one visualizing agent conjugated candidate monoclonal antibody in the multi-well plate, wherein each well is provided with the target protein and one conjugated candidate monoclonal antibody, and wherein the positions of the wells correspond to the positions of the at least one test strips; immersing the distal end of the at least one test strips to the corresponding wells with the target protein and the at least one visualizing agent conjugated-candidate monoclonal antibody; allowing the target protein and the at least one visualizing agent-conjugated candidate monoclonal antibody to vertically defuse through the test strip and contact the immobilized monoclonal antibodies and the control antibody; incubating the reaction for at least 15-30 minutes; and recoding the signal of each test area on the at least one test strip.
[0110] In some embodiments, the control antibody is an antibody that specifically binds the candidate monoclonal antibodies. In some embodiments, the control antibody is an antibody that specifically binds the Fc portion of the candidate monoclonal antibodies.
[0111] In some embodiments, each candidate monoclonal antibody is conjugated with a visualization agent and tested against each candidate monoclonal antibody immobilized on the test strip. In some embodiments, each candidate monoclonal antibody is immobilized on at least one test strip and tested against each candidate monoclonal antibody conjugated with a visualization agent. In some embodiments, each candidate monoclonal antibody is
conjugated with a visualizing agent and tested against the same candidate monoclonal antibody on a test strip.
[0112] In some embodiments, the portion of the test strip that contacts the immobilized antibodies is nitrocellulose membrane. In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0113] In some embodiments, the target protein is a viral antigen. In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0114] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0115] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0116] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0117] In certain aspects, the invention provides a high throughput selection platform for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, wherein detecting the target protein comprises distinguishing the target protein from non-target proteins that are similar to the target protein, the method including: conducting the high throughput screening method previously described with the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; conducting the high throughput screening method previously described with each of the non-target proteins that are similar to the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; comparing the signal intensity of the tested antibody pairings for the target protein and for each of the non-target proteins that are similar to the target protein; selecting the antibody parings that are capable of recognizing the target protein and distinguishing between the target protein and the non-target proteins that are similar to the target protein.
[0118] In some embodiments, the high throughput screening with the non-target proteins similar to the target protein and the high throughput screening with the target protein are conducted in the same device and at the same time.
[0119] In some embodiments, the target protein is a viral antigen. In some embodiments, the target protein viral antigen is a coronavirus (CoV) antigen. In some embodiments, the target protein coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0120] In some embodiments, the target protein coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV- 2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the target protein coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2. In some embodiments, the target protein coronavirus (CoV) antigen is a portion of SARS-CoV- 2 Spike Protein (SARS-CoV-2S). In some embodiments, the target protein coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0121] In some embodiments, the non-target proteins that are similar to the target protein are viral antigens. In some embodiments, the non-target protein viral antigens are coronavirus (CoV) antigens. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are proteins from coronavirus (CoV) strains selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are proteins from SARS-CoV-2. In some embodiments, at least some of the non target protein coronavirus (CoV) antigens are not proteins from SARS-CoV-2. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the coronavirus (CoV) antigens are Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU 1.
[0122] In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions of proteins from SARS-CoV-2. In some embodiments, at least some of the non target protein coronavirus (CoV) antigens are not portions of proteins from SARS-CoV-2. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions from Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, at least some of the non-target protein coronavirus (CoV) antigens are portions from Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
[0123] In some embodiments, the target protein viral antigen is a flavivirus antigen. In some embodiments, the target protein flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the target protein flavivirus antigen is flavivirus non- structural protein 1 (NS1). In some embodiments, the target protein flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0124] In some embodiments, the target protein flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the target protein flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1). In some embodiments, the target protein flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0125] In some embodiments, the non-target protein viral antigens are flavivirus antigens. In some embodiments, at least some of the non-target protein flavivirus antigens are proteins from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, at least some of the non-target protein flavivirus antigens are flavivirus non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivirus antigens are flavivirus precursor membrane (PrM) protein.
[0126] In some embodiments, at least some of the non-target protein flavivirus antigens are portions of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3),
Dengue vims serotype 4 (DV4), Zika vims (ZIKV), Yellow Fever (YFV), Ilheus Vims (ILHV), Powassan (POWA), Japanese encephalitis (JE) vims, West Nile vims (WNV), Deer tick (DTV) tick-bome encephalitis vims (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever vims (OHFV). In some embodiments, at least some of the non-target protein flavivirus antigens are portions of flavivims non- structural protein 1 (NS1). In some embodiments, at least some of the non-target protein flavivims antigens are portions of flavivims precursor membrane (PrM) protein.
[0127] In certain aspects, the invention provides a high throughput screening method for mapping the peptide that is recognized by a monoclonal antibody within a target protein recognized by the monoclonal antibody, the method including: obtaining a collection of overlapping candidate peptides that are fragments of the protein; providing a high throughput immunoassay device of any one of the claims 35-58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate peptide on at least one of the test areas of the at least one test strip, except the uppermost test areas of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to the monoclonal antibody; applying the visualizing agent conjugated monoclonal antibody in wells of the multi-well plate corresponding the positions of the at least one test strips; immersing the distal end of the at least one test strips into the corresponding wells with the visualizing agent conjugated monoclonal antibody; allowing the visualizing agent conjugated monoclonal antibody to vertically defuse through the test strips and contact the immobilized peptides and the control antibody; incubating the reaction for at least 15-30 minutes; recoding the signal of each test area on the at least one test strip.
[0128] In some embodiments, the control antibody is an antibody that specifically binds the monoclonal antibody. In some embodiments, the control antibody is an antibody against the Fc portion of the monoclonal antibody. In some embodiments, each of the candidate peptides is immobilized on at least one test strip and tested against the visualizing agent conjugated monoclonal antibody.
[0129] In some embodiments, the portion of the test strip that contacts the immobilized candidate peptides is nitrocellulose membrane. In some embodiments, the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction
spectral peak at around 600-700 nm. In some embodiments, the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
[0130] In some embodiments, the target protein is a viral antigen. In some embodiments, the viral antigen is a coronavirus (CoV) antigen. In some embodiments, the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV- 2S). In some embodiments, the coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0131] In some embodiments, the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1. In some embodiments, the coronavirus (CoV) antigen is a portion of protein from SARS-CoV-2. In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S). In some embodiments, the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
[0132] In some embodiments, the viral antigen is a flavivirus antigen. In some embodiments, the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is flavivirus non-structural protein 1 (NS1). In some embodiments, the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
[0133] In some embodiments, the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1),
Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV). In some embodiments, the flavivirus antigen is a portion
of flavivirus non- structural protein 1 (NS1). In some embodiments, the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
[0134] In some embodiments, the invention provides a method to utilize the high throughput immunoassay device as described above, wherein one group of test strips are utilized to conduct the high throughput screening for antibody paring as described above, and another group of test strips are utilized to conduct the high throughput mapping as described above.
[0135] In some embodiments, the tests utilizing the two groups of test strips are started and interpreted at the same time. In some embodiments, the tests utilizing the two groups of test strips are started or interpreted at different times.
[0136] Lateral Flow Immunoassay
[0137] Lateral flow immunoassays are a cost-effective methodology for detecting a target protein in a biological sample. Tests based on this methodology can be used at a point-of- care center by medical professionals or for at home testing by individuals without any medical or technical training. The technology takes advantage of the capillary properties of materials such as nitrocellulose, which have the capacity to transport fluids spontaneously. Liquids display capillary action, which is their ability to flow through narrow spaces even in opposition to external forces. Capillary action can be observed in the drawing up of liquids into materials such as fibers or cellulose. It occurs due to intermolecular forces between the liquid and surrounding solid surfaces. If the diameter of the space is sufficiently small, then the combination of surface tension of the liquid and the adhesive forces between the liquid and the surrounding solid surface act to propel the liquid into the narrow space.
[0138] There are two main types of lateral flow immunoassays: a “sandwich assay” and a “competitive assay”. The subject matter disclosed herein relates to “sandwich assays.” In a “sandwich assay”, a migrating sample can first come into contact with a detection reagent, which can specifically bind to a target protein or viral antigen. In some embodiments, the detection reagent is conjugated to a visualizing reagent. If the target protein is present in the sample, the conjugated detection reagent can bind to it and subsequently flow laterally a test line (area). The test line (area) may also contain a capture reagent such as proteins or antibodies specific to the target protein. A visual signal or readout is produced when the target protein reaches the test line (area). Thus, the target protein is “sandwiched” between two proteins such as antibodies.
[0139] If the detection reagent is not directly labeled and both the capture reagent and the detection reagent are antibodies, then these antibodies must be from different species (i.e., if the capture antibody is a rabbit antibody, the detection antibody can be from goat, chicken, etc., but not rabbit). This will allow the use of a secondary antibody directed to the species heavy chain of the detection antibody. If the detection antibody is directly labeled, then the capture and detection antibodies can be from the same species.
[0140] Usually the main determination of an immunoassay sensitivity is the protein or antibody binding affinity for the target antigen. As the target antigen concentration increases, the amount of detection reagent accumulated in the test line (area) increases, leading to a higher measured response or readout.
[0141] Antibodies
[0142] Monoclonal antibodies (mAb) are generated by identical immune cells that are all clones of a unique parent cell. Monoclonal antibodies can have monovalent affinity - they all bind to the same part of an antigen, called epitope. In contrast, polyclonal antibodies bind to multiple epitopes and are usually made by several different plasma cell lineages. Polyclonal antibodies often contain multiple epitopes and the same affinity purified polyclonal can be used as the capture and labeled detection antibody.
[0143] A paratope is an antigen-binding site found on an antibody which recognizes and binds to an antigen. A paratope usually includes a small region of 5 to 10 amino acids of the antibody's Fc region. The paratope can contain parts of the antibody's heavy and light chains. Each arm of the Y shape of an antibody monomer is tipped with a paratope, which is a set of 6 complementarity-determining regions - 3 of each light chain and heavy chain extending from the fold of antiparallel beta sheets.
[0144] Viral Antieens
[0145] A viral antigen is a protein or a polypeptide encoded by a viral genome. In some embodiments, viral antigens protrude from the virus envelope or capsid and often fulfill important functions, which ensure the survival and propagation of the viral genetic material such as docking to the host cell, fusion, and injection of viral DNA/RNA into a host cell. Recombinant viral antigens can contain part of viral sequence, which encodes a region which can be recognized by antibodies. This reduces the risk of false negatives which can occur with synthetic peptides, which contain only a small portion of the entire protein.
[0146] Coronaviruses (CoVs) are a large family of enveloped, positive-sense, single- stranded RNA viruses that infect a broad range of vertebrates. They are extensive in bats but
can be found in many other birds and mammals including humans. In humans, CoVs tend to cause mild to moderate upper respiratory tract infections such as the common cold.
However, in the past couple of decades, there have been outbreaks of severe, and sometimes fatal, respiratory illnesses that were later found to be caused by novel, human pathogenic CoVs. These strains exhibited stronger virulence and quickly passed from human to human. While infection with these CoVs typically produced mild symptoms, for certain individuals, responses were more severe. In extreme cases, death occurred due to gradual respiratory failure as the result of alveolar damage. The seven strain of CoVs found in humans include SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
[0147] Virus Families
[0148] Viruses are small parasites that cannot reproduce on their own. Once a virus infects a cell, however, a vims can direct the cell machinery to produce more vimses. Most viruses utilize either RNA or DNA as their genetic material. The nucleic acid may be single- or double-stranded. The infectious vims particle or a virion includes a nucleic acid and an outer shell of protein. The simplest vimses contain only enough RNA or DNA to encode four proteins. On the other hand, the most complex ones can encode up to 200 proteins.
[0149] The nucleic acid of a virion is enclosed within a protein coat called a capsid. The capsid id composed of multiple copies of one protein or a few different proteins, each of which is encoded by a single viral gene. Because of this structure, a vims is able to encode all the information for making a relatively large capsid in a small number of genes.
[0150] Coronavimses (CoVs) are a large family of enveloped, positive-sense, single- stranded RNA vimses that infect a broad range of vertebrates. They are extensive in bats but can be found in many other birds and mammals including humans. In humans, CoVs tend to cause mild to moderate upper respiratory tract infections such as the common cold.
However, in the past couple of decades, there have been outbreaks of severe, and sometimes fatal, respiratory illnesses that were later found to be caused by novel, human pathogenic CoVs. These strains exhibited stronger vimlence and quickly passed from human to human. While infection with these CoVs typically produced mild symptoms, for certain individuals, responses were more severe. In extreme cases, death occurred due to gradual respiratory failure as the result of alveolar damage. The seven strain of CoVs found in humans include SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
[0151] The coronavims entry into a cell is mediated by the viral Spike (S) glycoprotein. The Spike protein is a large type I transmembrane protein ranging from 1,160 amino acids to
up to 1,400 amino acids. Spike proteins are highly glycosylated with 21 to 35 N- glycosylation sites. Spike proteins assemble into trimers on the virion surface to form the distinctive "corona", or crown-like appearance, of a coronavirus. The ectodomain of all CoV Spike proteins is organized into an N-terminal domain named SI, responsible for receptor binding, and a C-terminal S2 domain, responsible for viral fusion. Coronaviruses can infect the respiratory epithelial cells through interaction with the ACE2 receptor on the cell surface Recombinant Spike protein can bind with recombinant ACE2 proteins.
[0152] The coronavirus Nucleocapsid (N) is a structural protein capable of forming complexes with genomic RNA. Nucleocapsid proteins also interact with the viral membrane protein(s) during virion assembly and play a critical role in enhancing the efficiency of virus transcription and assembly.
[0153] Aedes mosquitoes transmit globally relevant flaviviruses, including dengue virus (DENV) and Zika virus (ZIKV). DENV exists as four antigenic serotypes, DENV1 to DENV4. These viruses have a wide geographic distribution, with approximately 390 million infections annually and more than a quarter of the world’s population at risk.
Prior to 2015, ZIKV was considered obscure and was known to circulate in Africa and Southeast Asia as two separate viral lineages, African and Asian. While most are asymptomatic, the clinical presentation of ZIKV infection resembles that of dengue, including fever, rash, conjunctivitis, arthralgia, and myalgia.
[0154] DENV contains a positive-sense, single-stranded RNA genome of about 10.6 kilobases. The single open reading frame of the DENV encodes a polyprotein precursor, which is cleaved by cellular and viral protease into three structural proteins, the capsid (C), precursor membrane (PrM), and envelope (E), as well as seven nonstructural proteins NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5. The E protein, a glycoprotein of approximately 55 kDa, contains 12 strictly conserved cysteine residues forming six disulfide bridges and is present as a heterodimer with PrM protein before the maturation of the virion. E protein participates in virus entry and is the major target of both neutralizing and enhancing antibodies.
[0155] The PrM protein is a glycoprotein of about 19 kDa. It contains six highly conserved cysteine residues forming three disulfide bridges. The NS1 protein is also a glycoprotein of about 40 kDa. It contains 12 highly conserved cysteine residues forming six disulfide bridges. NS1 is present intracellularly, on the cell surface, and outside of the cells. [0156] Sequences
[0157] SEQ ID NO: 1 is the polypeptide sequence of the coronavirus SARS-CoV-2 Spike protein per gene bank accession NC_045512 and including polymorphisms already reported MT077125 and ancestor QHR63300 RaTG13.
MF VFLVLLPLV S SQC VNLTTRT QLPP AYTN SFTRGVYYPDK VFRS S VLHSTQDLFLPF
FSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQS
LLI VNNATNVVIK V CEF QF CNDPFLGVY YHKNNK S WME SEFRVY S S ANN CTFEYV S
QPFLMDLEGKQGNFKNLREF VFKNIDGYFKIY SKHTPINL VRDLPQGF S ALEPL VDLP
IGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDA
VDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEWNATRF
ASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRG
DEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSN
LKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL
HAPATVCGPKKSTNLVKNICCVNFNFNGLTGTGVLTESNfCKFLPFQQFGRDIADTTD
AVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPT
WRVY ST GSNVF QTRAGCLIGAEHVNNS YECDIPIGAGIC AS YQTQTN SPRRARS VAS
QSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTEC
SNLLLQ Y GSFC T QLNRALTGIA VEQDKNT QE VF AQ VKQI YKTPPIKDF GGFNF SQILP
DPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLT
DEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLI
AN QFN S AIGKIQD SL S S T AS ALGKLQD VVN QNAQ ALNTLVKQLS SNF GAI S S VLNDIL
SRLDKVEAEVQIDRLITGRLQ SLQT YVTQQLIRAAEIRAS ANL AATKMSEC VLGQ SK
RVDFCGKGYHLMSFPQSAPHGVYFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGV
F VSN GTHWF VT QRNF YEPQIITTDNTF V S GN CD VVIGI VNNT VYDPLQPELD SFKEEL
DKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYI
KWPWYIWLGFIAGLIAIYMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKG
YKLHYT
[0158] SEQ ID NO: 2 is the polypeptide sequence of the coronavirus Nucleocapsid protein (NCBI Reference Sequence: YP_009724397.2)
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTAL TQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYY LGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPK GFYAEGSRGGSQAS SRS SSRSRNS SRNSTPGS SRGTSPARMAGNGGDAALALLLLDR LNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQ
TQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAD
LDDKDPNFKDQV
ILLNKFQDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQL
QQSMSSADSTQA
[0159] SEQ ID NO: 3 is the polypeptide sequence of the Dengue vims 1 NS1 protein
(NCBI Reference Sequence: NP_722461.1)
DSGCVINWKGRELKCGSGIFVTNEVHTWTEQYKFQADSPKRLSAAIGKAWEEGVCG
IRSATRLENIMWKQISNELNHILLENDMKFTVVVGDVSGILAQGKKMIRPQPMEHKY
SWKSWGKAKIIGADVQNTTFIIDGPNTPECPDNQRAWNIWEVEDYGFGIFTTNIWLK
LRDSYTQVCDHRLMSAAIKDSKAVHADMGYWIESEKNETWKLARASFIEVKTCIWP
KSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTT
VVVDEHCGNRGP SLRTTTVT GKTIHEWCCRSCTLPPLRFKGEDGCW Y GMEIRP VKE
KEENLVKSMVSADSGCVINWKGRELKCGSGIFVTNEVHTWTEQYKFQADSPKRLSA
AIGK AWEEGV C GIRS ATRLENIMWKQI SNELNHILLENDMKF TV VV GD V S GIL AQGK
KMIRPQPMEHKYSWKSWGKAKIIGADVQNTTFIIDGPNTPECPDNQRAWNIWEVED
YGFGIFTTNIWLKLRDSYTQVCDHRLMSAAIKDSKAVHADMGYWIESEKNETWKLA
RASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFFQFAGPWHLG
KLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKTIHEWCCRSCTLPPLRFKGEDG
C WY GMEIRP VKEKEENLVK SM V S A
[0160] SEQ ID NO: 4 is the polypeptide sequence of the Dengue vims 2 NS1 protein
(NCBI Reference Sequence: NP_739584.2)
DSGCVVSWKNKELKCGSGIFITDNVHTWTEQYKFQPESPSKLASAIQKAHEEGICGIR SVTRLENLMWKQIFPELNHILSENEVKLTIMTGDIKGIMQAGKRSLRPQPFELKYSW KTW GKAKML STESHNQTFLIDGPET AECPNTNRAWN SLEVEDY GF GVFTTNIWLKL KEKQD VF CD SKLM S AAIKDNRA YHADMGYWIES ALND TWKIEK ASFIEVKN CHWP KSHTLWSNGVLESEMIIPKNLAGPVSQHNYRPGYHFQIFGPWHLGKLEMDFDFCDG TTVVVTED CGNRGP SLRTTT AS GKLITEWCCRS C TLPPLRYRGEDGC W Y GMEIRPLK EKEENLVNSLVTA
[0161] SEQ ID NO: 5 is the polypeptide sequence of the Dengue vims 3 NS1 protein
(NCBI Reference Sequence: YP_001531169.2)
DMGCVINWKGKELKCGSGIFVTNEVHTWTEQYfCFQADSPKRLATAIAGAWENGVC GIRSFTRMENLLWKQIANELNYILWENNIKLTVVVGDFLGVLEQGKRFLFPQPMELK Y S WKTWGK AKIVT AET QN S SFIIDGPNTPECP S ASRAWNVWEVED Y GF GVFTTNIWL
KLRE VYT QLCDHRLM S AA VKDERA VHADMGYWIES QKN GS WKLEK ASLIEVKTCT WPK SHTL WTN GVLE SDMIIPK SL AGPI S QHNYRPGYHTQT AGP WHLGKLELDFNY C EGTT VVITESCGTRGP SLRTTT V S GKLIHEW C CRS C TLPPLRYMGED GC W Y GMEIRPI SEKEENMVK SL VS A
[0162] SEQ ID NO: 6 is the polypeptide sequence of the Dengue vims 4 NS1 protein (NCBI Reference Sequence: NP_740318.1)
DMGCVASWSGKELKCGSGIFVVDNVHTWTEQYKFQPESPARLASAILNAHKDGVC GIRSTTRLENVMWKQITNELNYVLWEGGHDLTVVAGDVKGVLTKGKRALTPPVSD LKY SWKTW GKAKIFTPEARNSTFLIDGPDTSECPNERRAWN SLEVEDY GFGMFTTNI WMKFREGS SEYCDHRLMSAAIKDQKA VHADMGYWIES SKNQTWQIEKASLIEVKT CL WPKTHTL W SN GVLES QMLIPK S YAGPF S QHNYRQGY ATQT V GP WHLGKLEIDF G ECPGTTVTIQEDCDHRGPSLRTTTASGKLVTQWCCRSCTMPPLRFLGEDGCWYGMEI RPLSEKEENMVKSQVTA
[0163] SEQ ID NO: 7 is the polypeptide sequence of the Asian strain of Zika vims NS1 protein (NCBI Reference Sequence: YP_009430301.1).
DVGC SVDF SKKETRCGT GVF VYND VEAWRDRYKYHPD SPRRLAAAVKQAWEDGIC
GISSVSRMENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNEL
PHGWKAW GKS YF VRAAKTNN SF VVDGDTLKECPLEHRAWN SFLVEDHGF GVFHTS
VWLKVREDYSLECDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMK
TCEWPKSHTLWADGIEESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEE
CPGTK VHVEET C GTRGP SLRSTTAS GRVIEEWCCRECTMPPL SFRAKDGC W Y GMEIR
PRKEPESNLVRSVVTA
[0164] SEQ ID NO: 8 is the polypeptide sequence of the African strain of Zika vims NS1 protein (NCBI Reference Sequence: YP_009227199.1).
DVGC SVDF SKKETRCGTGVFIYND VEAWRDRYKYHPD SPRRL AAAVKQAWEEGIC
GISSVSRMENIMWKSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNEL
PHGWKAW GKS YF VRAAKTNN SF VVDGDTLKECPLEHRAWN SFLVEDHGF GVFHTS
VWLKVREDYSLECDPAVIGTAVKGREAAHSDLGYWIESEKNDTWRLKRAHLIEMKT
CEWPK SHTLWTDGVEE SDLIIPK SL AGPL SHHNTREGYRT Q VKGP WHSEELEIRFEEC
PGTKVYVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRP
RKEPESNLVRSMVTA
[0165] SEQ ID NO: 9 is the polypeptide sequence of the Dengue vims 1 PrM protein (NCBI Reference Sequence: NP_733807.2)
FHLTTRGGEPHMIV SKQERGK SLLFKT S AGVNMCTLIAMDLGELCEDTMT YKCPRIT ETEPDDVDCWCNATETWVTYGTCSQTGEHRRDKRSVALAPHVGLGLETRTETWMS SEGA WKOTOK VF.TW AT RHPGFTVT AT FT , AHATGTSTTQKGTTFTT 1 MT VTPSM A [0166] SEQ ID NO: TO is the polypeptide sequence of the Dengue vims 2 PrM protein
(NCBI Reference Sequence: NP_739582.2).
FHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTITYKCPLL RQNEPEDIDC W CNST STWVT Y GTCTTMGEHRREKRS YAL VPHVGMGLETRTETWM SSEGAWKHVQRIETWILRHPGFTMMAAILAYTIGTTHFQRALIFILLTAVTPSMT [0167] SEQ ID NO: 11 is the polypeptide sequence of the Dengue vims 3 PrM protein
(NCBI Reference Sequence: YP_001531166.1)
FHLTSRDGEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHIT EVEPEDIDCWCNLTSTWVTYGTCNQAGEHRRDKRSVALAPHVGMGLDTRTQTWMS AEGAWRQVEKVETWALRHPGFTILALFLAHYIGTSLTQKVVIFILLMLVTPSMT [0168] SEQ ID NO: 12 is the polypeptide sequence of the Dengue vims 4 PrM protein
(NCBI Reference Sequence: NP_740315.1)
FSLSTRDGEPLMIVAKHERGRPLLFKTTEGINKCTLIAMDLGEMCEDTVTYfCCPLLV NFEPEDIDCWCNLTSTWVMYGTCTQSGERRREKRSVALTPHSGMGLETRAETWMSS EGAWKHAQRVESWILRNPGFALLAGFMAYMIGQTGIQRTWFVLMMLVAPSYG [0169] SEQ ID NO: 13 is the polypeptide sequence of the Asian strain of the Zika vims
PrM protein (NCBI Reference Sequence: YP_009430297.1)
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPM LDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQ TWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYS [0170] SEQ ID NO: 14 is the polypeptide sequence of the African strain of the Zika vims PrM protein (NCBI Reference Sequence: YP_009227197.1)
AEITRRGS A YYMYLDRSD AGKAISF ATTLGVNKCHV QIMDLGHMCDATMS YECPM LDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQ T WLE SRE YTKHLIK VENWIFRNP GF AL V A V AI AWLLGS STS QK VI YL VMILLI AP A Y S
[0171] References
[0172] Bosch I, de Puig H, Hiley M, Carre-Camps M, Perdomo-Celis F, Narvaez CF, Salgado DM, Senthoor D, O'Grady M, Phillips E, Durbin A, Fandos D, Miyazaki H, Yen CW, Gelvez-Ramirez M, Warke RV, Ribeiro LS, Teixeira MM, Almeida RP, Munoz-Medina
JE, Ludert JE, Nogueira ML, Colombo TE, Terzian ACB, Bozza PT, Calheiros AS, Vieira YR, Barbosa-Lima G, Vizzoni A, Cerbino-Neto J, Bozza FA, Souza TML, Trugilho MRO, de Filippis AMB, de Sequeira PC, Marques ETA, Magalhaes T, Diaz FJ, Restrepo BN, Marin K, Mattar S, Olson D, Asturias EJ, Lucera M, Singla M, Medigeshi GR, de Bosch N, Tam J, Gomez-Marquez J, Clavet C, Villar L, Hamad- Schifferli K, Gehrke L. 2017. Rapid antigen tests for dengue virus serotypes and Zika virus in patient serum. Sci. Transl. Med. 9, eaanl589.
EXAMPLES
[0173] Example 1 - Approach for developing a rapid diagnostic platform to detect viral antigens
[0174] The stepwise approaches used to develop antigen-based rapid diagnostics are shown in Figure 11 and Table 1. The percentages of amino acid homology and identity among flavivirus NS1 proteins are high (Table 2); therefore, we reasoned that extensive and strategic screening would be required to identify mAbs that detect and distinguish the viruses in a rapid diagnostic test. We tested several commercial anti-dengue NS1 antibodies available from different vendors but found that native NS 1 protein was not recognized or that there was clearly identifiable cross-reactive binding among the DENV serotype NS1 proteins. We therefore generated and characterized anti-NSl antibodies (Figure 11 and Table 1). Groups of mice were injected separately with DENV1-4 recombinant NS1 (rNSl) protein or with ZIKV rNSl protein. B cells from the spleen or lymph nodes were fused with mouse myeloma cells to generate hybridomas. Initial hybridoma screening (209 DENV hybridomas and 104 ZIKV hybridomas) was performed by enzyme-linked immunosorbent assay (ELISA) using individual rNSl protein as antigen (step 1; Table 1). By screening the hybridoma supernatants against individual DENV1-4 NS1 or ZIKV NS1 proteins, the relative ELISA values provided an initial evaluation of differential binding properties for each antibody.
[0175] Table 1. Stepwise description of the approaches used to define antibodies that detect and distinguish DENV1-4 NS1 and the ZIKV NS1 proteins. In Step 3, an 11 X 11 matrix was used to test all combinations of 11 anti-DENV NS1 pairs using each of the four DENVNS1 proteins. In addition, a 10 X 10 matrix was used to test all combinations of 10 anti-ZIKVNSl pairs using ZIKVNS1 protein as well as each of the four DENV serotype NS1 proteins. The matrix-based screening identified optimal monoclonal antibody pairs that detected NS1 without crossover interference. DENV: dengue virus; ZIKV: Zika virus.
AMINO ACID HOMOLOGY
[0176] Table 2. Amino acid homology and identity among DENV NS1 and ZIKY NS1 proteins. The matrix shows comparisons of percentage amino acid identity (exact positional amino acid matches in the amino acid sequences) and percentage amino acid homology (positional amino acid substitutions by amino acids with similar physicochemical properties) for the DENV and ZIKV NS1 proteins. Dengue virus and Zika virus NS1 sequences were extracted from deposited data (Zika: KX702400.1; DENV1 : GUI 31834.1; DENV2: GQ868641.1; DENV3 : KF955487.1; DENV4: GQ868645.1. These sequences represent viruses that were isolated from the same geographic area in years 2001-2016 for a representative sampling. The BLAST algorithm from the National Center for Biotechnology Information, U.S. National Library of Medicine was used to generate the identity and similarity scores among the NS1 proteins.
[0177] Because of the similarities among the DENV NS1 and ZIKV NS1 proteins (Table 2), each group of mice immunized with a single purified rNSl protein yielded a pool of antibodies, showing both selective binding to a single DENV serotype or ZIKV NS1 and cross-reactive DENV and ZIKV antibodies (Figure 12). ZIKVNS1 hybridomas produced from lymph node tissue represented a higher proportion of clones, showing minimal cross reactivity with dengue NS1 or other flavivirus NS1 proteins, as compared to spleen cell hybridomas (Figure 12). Using the relative ELISA values, 11 DENV mAbs and 10 ZIKV mAbs were selected for further analysis. In step 2 (Figure 11 and Table 1), hybridoma supernatants were used to stain permeabilized Vero cells that had been infected with known ZIKV or DENV viral serotypes. Flow cytometric analysis demonstrated that the mAbs recognized native NS1 protein expressed by virus-infected cells and provided a quantitative analysis of cross-reactive binding when ZIKV antibodies were used to stain DENV-infected cells and vice versa. The 11 DENV mAbs and 10 ZIKV mAbs recognized NS1 protein present in the virus-infected cells; therefore, the hybridomas were expanded, and the mAb isotypes were defined in preparation for affinity chromatography purification.
[0178] The purified antibodies were tested in immunochromatography pairs (step 3; Figure 11 and Table 1), with one antibody conjugated to gold nanoparticles and one antibody adsorbed to nitrocellulose membrane. The 11 DENV hybridomas were tested in a matrix for interactions with DENV NS1 serotypes 1 to 4, ZIKV NS1, or without added antigen as a control. The 10 ZIKV mAbs were also tested in a matrix using ZIKV NS1, a mixture of the four DENV serotype NS1 proteins, or no antigen as a control. We tested 726 DENV combinations (11 x 11 x 6 = 726) and 300 ZIKV combinations (10 x 10 x 3 = 300). Testing
throughput was increased by using the half-strip dipstick format, where dipsticks are run in rapid format (about 20 min, depending on humidity conditions) by placing them in microcentrifuge tubes containing small-volume suspensions of conjugated nanoparticles and sample without need for sample paper pads and conjugate paper pads that are characteristic of lateral flow chromatography. The DENV and ZIKV matrices and the immunochromatography results are shown in Figure 13. Eight DENY mAbs and two ZIKV mAbs were ultimately incorporated into the rapid tests used to analyze patient samples. The 10 mAb names, their relative NS1 recognition values in initial screening, and the final application in the rapid tests are shown in Fig. 11 and Table 3.
[0179] Table 3. List of mAbs used in the rapid tests, relative binding values, and summary of final use in the DENV and ZIKV immunochromatography tests. The antibody name is shown at the left column with the antigen (ag) that was used to inject the mice to generate the antibody. The immunochromatography application of each antibody (conjugated to nanoparticle or adsorbed to nitrocellulose membrane) is in the right column. The center columns show “fold over background” (FOB) ELISA values for each of the antigens used as bait on the ELISA plates (DENV 1-4 NS1; upper, or ZIKVNS1 or pooled flavivirus NS1
panel; lower). These numbers define differential recognition of each of the four dengue NS1 antigens during initial screening (Figure 11, step 1). This differential recognition formed the initial selection of the antibodies for use in the final test
[0180] Example 2 - Linear peptide epitope mapping: Mechanisms of specific mAb- NS1 interactions
[0181] To begin to define mechanisms of specific mAb-NSl interactions, we performed linear peptide epitope mapping (step 4; Figure 11 and Table 1). Libraries of tiled DENV NS1 peptides were spotted onto nitrocellulose membranes and incubated with antibody. After washing, positive signals were detected using an anti-mouse IgG antibody coupled to horseradish peroxidase for signal development. In a second approach, tiled peptides were synthesized on glass slides and incubated with each of the antibodies. Positive signals were detected by immunofluorescence microscopy and were scored. The epitope mapping data are summarized in Fig. 14. mAb 7724.323 (“323”) fits the definition of a pan-DENV NS1 antibody because it recognizes all four serotype NS1 proteins in the epitopes 109 to 124 amino acid region. Six antibodies used in the rapid tests (using suffix nomenclature only: 55, 323, 1, 130, 110, and 271) recognize the amino acids 109 to 124 epitope of the “wing” domain (amino acids 30 to 180). However, with the exception of a few pairs with mAb 243, these six antibodies do not recognize the ZIKV NS1 protein (Figure 14 B and 13). The epitope mapping helped to explain the observed antibody specificity in the rapid tests. The shared DENV1-4 NS1 region D/ELKYSWKTWG (amino acids 110 to 119) is not conserved in ZIKVNSl; rather, the comparable ZIKVNS1 region has a distinct amino acid sequence (Figure 14 B), explaining how DENV NS1 mAbs, represented by the members of the 1/55/110/130/271/323 mAb group, do not cross-react with the ZIKV NS1 protein. mAb 243, which showed high specificity for DENV2 (tables S3 and S4), recognized peptides 313 to 330 in DENV2 NS1 (Figure 14 B). The screening approaches, combined with the epitope mapping, contributed to selecting antibodies representing positional epitope diversity; that is, epitopes in both the wing/wing connector/finger and b-ladder domains (Figure 14).
[0182] Matrix-based screening (Figure 13) revealed that the following pairs (nanoparticle/membrane) had optimal rapid test specificity: DENV1, 912/271; DENV2, 243/1; DENV3, 411/55; DENV4, 626/55. In addition, the 912 and 243 antibodies displayed excellent single serotype specificity for the DENV1 and DENV2 proteins, respectively.
These antibodies might be predicted to work as 912/912 and 243/243 homo-pairs in detecting DENV1 and DENV2 NS1 dimers. However, experimental results showed that the limits of
NS1 detection were improved by using hetero-pairs without sacrificing specificity; therefore, 912 was paired with 271, and 243 was paired with 1. For ZIKV NS1 detection, we used the 130/110 mAh pair, where both antibodies arose from the lymph node tissue approach (Figure 12). The 411, 55, and 626 antibodies did not display the single serotype specificity observed with 912 and 243 (Table 3); however, when used as pairs in the rapid tests, 411/55 (DENV3) and 626/55 (DENV4) showed excellent specificity. The mAb 323 recognized DENV1-4, however, we found that when used as a 323/323 homo-pair, the detection of DENV4 NS1 in the pan-DENV test was not optimal. Therefore, by conjugating a mixture of mAb on the pan antibody nanoparticles (271, 243, 411, and 626), we achieved improved limit of detection results in the pan-DENV dipstick test. The linear peptide epitope mapping data provide an important framework for understanding the mechanisms of serotype-specific DENV detection and differential detection of DENV and ZIKV.
[0183] Example 3 - Detection of native virus (SARS-CoV-2) Nucleocapsid and spike antigens
[0184] Figure 7 shows a high throughput screen that identifies monoclonal antibody pairing to detect specific viral targets. In the left panel, the test areas are loaded with the immobilized antibodies a-mouse Fc (control antibody), a-SARS-CoV-2 S, and a-SARS- CoV-2 N. The antibodies a-SARS-CoV-2 S and a-SARS-CoV-2 S are also conjugated to nanoparticles. The peptides SARS-CoV-2 S and N are also introduced to the reactions. In the right panel, the test areas are (left to the splitters): a-human Fc (control antibody), a-DENV-2 NS1, and a-SARS-CoV-2 S. The test areas right to the splitters are a-mouse Fc (control antibody), a-DENV-3 NS1, and a-SARS-CoV-2 N. The conjugated antibodies are a-DENV- 2 NS1, a-DENV-3 NS1, a-SARS-CoV-2 S, and a-SARS-CoV-2 N. The antigens introduced to the reactions are DENV-2 NS1, SARS-CoV-2 S, and SARS-CoV-2 N.
[0185] Example 4 - Monoclonal antibody pairs that detect SARS-Coronaviruses [0186] Figure 8 shows a high throughput screen that identifies monoclonal antibody pairs that detect SARS-Coronaviruses with varying levels of specificity and strength.
[0187] Example 5 - Matrix of mAb pair trials for S protein
[0188] Figure 9 shows a high throughput screen to map protein peptides recognized by monoclonal antibodies. Four peptides corresponding to different portions ofDEV S-1 were immobilized on the dipstick test areas. The upper right rest area was loaded with a control
antibody a-mouse Fc. Conjugated antibody a-DENV NS 1 was allowed to bind to the immobilized peptides and control antibody.
[0189] Example 6 - Matrix of mAb pair trials for S protein [0190] To define functional antibody pairs, one antibody was conjugated to gold nanoparticles, and one antibody was adsorbed to nitrocellulose membrane. The resulting nanoparticle conjugates-membrane pairs were tested using the specific serotype recombinant S protein and S protein domains (S protein, Receptor-binding Domain of the S protein (RBD), N-terminal domain of the S protein (NTD)).
[0191] Figure 10 shows an antibody grid from a high throughput screening.
Claims
1. An immunoassay for testing the suitability of a monoclonal antibody pair for use in a lateral flow assay to detect a target protein, wherein the monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody, wherein the first and the second monoclonal antibodies are capable of specifically binding the target protein.
2. The immunoassay of claim 1, wherein the first and the second monoclonal antibodies have been purified with protein L or protein G resins.
3. The immunoassay of claim 1 or 2, wherein the first monoclonal antibody is immobilized on a solid support, and wherein the second monoclonal antibody is conjugated to a visualizing agent.
4. The immunoassay of claim 3, wherein the visualizing agent-conjugated second monoclonal antibody and the target protein are allowed to bind to the immobilized first monoclonal antibody at the same time.
5. The immunoassay of claim 3 or 4, wherein the solid support is a nitrocellulose membrane.
6. The immunoassay of any one of claims 3-5, wherein the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
7. The immunoassay of claim 6, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
8. The immunoassay of claim 6, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
9. The immunoassay of any one of claims 1-8, wherein the first monoclonal antibody is different from the second monoclonal antibody.
10. The immunoassay of any one of claims 1-8, wherein the first monoclonal antibody is the same as the second monoclonal antibody.
11. The immunoassay of any one of claims 1-10, wherein the target protein is a viral antigen.
12. The immunoassay of claim 11, wherein the viral antigen is a coronavirus (CoV) antigen.
13. The immunoassay of claim 12, wherein the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
14. The immunoassay of claim 13, wherein the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
15. The immunoassay of claim 14, wherein the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S).
16. The immunoassay of claim 14, wherein the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
17. The immunoassay of claim 12, wherein the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS- CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKUl.
18. The immunoassay of claim 15, wherein the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
19. The immunoassay of claim 18, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
20. The immunoassay of claim 18, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
21. The immunoassay of claim 11, wherein the viral antigen is a flavivirus antigen.
22. The immunoassay of claim 21, wherein the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
23. The immunoassay of claim 21 or 22, wherein the flavivirus antigen is flavivirus non- structural protein 1 (NS1).
24. The immunoassay of claim 21 or 22, wherein the flavivirus antigen is flavivirus precursor membrane (PrM) protein
25. The immunoassay of claim 21, wherein the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus
serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILFIV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
26. The immunoassay of claim 21 or 25, wherein the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
27. The immunoassay of claim 21 or 25, wherein the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
28. A high throughput immunoassay, comprising a multitude of immunoassays of any one of claims 1-27, wherein the multitude of immunoassays are conducted at the same time and in the same device.
29. The high throughput immunoassay of claim 28, wherein the first monoclonal antibodies of more than one immunoassays are immobilized on the same solid support.
30. The high throughput immunoassay of claim 28 or 29, for selecting a suitable monoclonal antibody pair for use in a lateral flow assay to detect a target protein, wherein the selection is from a collection of monoclonal antibodies capable of specifically binding the target protein, wherein the selected monoclonal antibody pair consists of a first monoclonal antibody and a second monoclonal antibody.
31. The high throughput immunoassay of claim 30, wherein a multitude of combinations of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein are tested in the same high throughput immunoassay as the first and the second monoclonal antibody.
32. The high throughput immunoassay of claim 31, wherein in some of the multitude of combinations the first monoclonal antibody is the same as the second monoclonal antibody.
33. The high throughput immunoassay of claim 31, wherein every combination of two monoclonal antibodies from the collection of monoclonal antibodies capable of specifically binding the target protein as the first and the second antibody, respectively, is tested in the same high throughput immunoassay.
34. The high throughput immunoassay of claim 33, wherein in some of the combinations the first monoclonal antibody is the same as the second monoclonal antibody.
35. A high throughput immunoassay device comprising: a commercially available multi-well plate,
multiple test trips, a holder for the test strips, wherein the distal end of each test strip is immersed in one well of the multiple-well plate, and wherein each test strip comprises a solid support for immobilized proteins or peptides.
36. The high throughput immunoassay device of claim 35, wherein each test strip comprises a proximal wick portion and a distal dipstick portion, wherein the end of each dipstick portion is immersed in one well of the multi-well plate.
37. The high throughput immunoassay device of claim 36, wherein the dipstick portion comprises a test area, wherein the test area can provide support for one immobilized protein or peptide.
38. The high throughput immunoassay device of claim 36, wherein the dipstick portion comprises multiple test areas, wherein each test area can provide support for one immobilized protein or peptide.
39. The high throughput immunoassay device of claim 38, wherein the multiple test areas of the dipstick portion are arranged in a single vertical row along the vertical axis of the dipstick.
40. The high throughput immunoassay device of any one of claims 36-39, wherein the dipstick is shaped as a string of overlapping diamonds, wherein each diamond shape provides one test area.
41. The high throughput immunoassay device of claim 40, wherein the dipstick comprises three overlapping diamond shapes.
42. The high throughput immunoassay device of claim 36-41, wherein the dipstick has one or more flow splitters, wherein the flow splitters are gaps in the test strips parallel to the vertical axis of the dipstick, wherein each flow splitter divides the dipstick into two half-strip dipstick sections at the level of the flow splitter, and wherein the two half strip dipstick sections are to the left and to the right of the flow splitter.
43. The high throughput immunoassay device of claim 42, wherein each half-strip dipstick section provides one test area.
44. The high throughput immunoassay device of claim 40 or 41, wherein at least some of the diamond shapes encompass a flow splitter and are divided into two half-diamond dipstick sections at the level of the flow splitter.
45. The high throughput immunoassay device of claim 44, wherein each half-diamond dipstick section provides one test area.
46. The high throughput immunoassay device of any one of claims 36-45, wherein the wick portion of the test strip comprises a T-shaped handle of the test strip.
47. The high throughput immunoassay device of any one of claims 35-46, wherein the holder for the test strips comprises a plate-shaped aligner with a multitude of slots, wherein the aligner is placed above the multi-well plate, wherein each slot can accommodate one test strip, and wherein the positions of the slots correspond to the positions of the wells in the multi-well plate so that the distal end of the test strip vertically extending through a slot can be localized in a well.
48. The high throughput immunoassay device of claim 47, wherein the aligner slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle.
49. The high throughput immunoassay device of claim 48, wherein the width of the aligner slots is similar to the thickness of the test strips, and wherein the width of the aligner slots is sufficient to accommodate the test strip extending through the slot.
50. The high throughput immunoassay device of claim 47-49, wherein the aligner slots are diagonally oriented to the aligner.
51. The high throughput immunoassay device of any one of claims 47-50, wherein the holder for the test strips further comprises a top plate with a multitude of top plate slots, wherein the top plate is placed above the aligner, wherein each top plate slot can accommodate one test strip, and wherein the positions of the top plate slots align with the positions of the aligner slots below in diagonal orientations so that a test strip vertically extending through a top plate slot can also extend through an aligner slot below.
52. The high throughput immunoassay device of claim 51, wherein the top plate slots are longer than the width of the dipstick portion of the test strip but shorter than the width of the top of the T-shaped wick portion handle.
53. The high throughput immunoassay device of claim 51 -52, wherein the width of the top plate slots is similar to the thickness of the test strips, and wherein the width of the top plate slots is sufficient to accommodate the test strip extending through the slot.
54. The high throughput immunoassay device of any one of claims 51-53, wherein there is one top plate slot and one aligner slot that corresponds to every well in the multi-well plate.
55. The high throughput immunoassay device of any one of claims 51-54, further comprising an outer housing container, wherein the multi-well plate, the test strips, the aligner, and the top plate are all placed in the housing container.
56. The high throughput immunoassay device of any one of claims 35-55, wherein the multi-well plate is a 96-well plate.
57. The high throughput immunoassay device of claim 56, wherein the multi-well plate is a flat-bottom 96-well plate.
58. The high throughput immunoassay device of claim 56, wherein the multi-well plate is a round-bottom 96-well plate.
59. The high throughput immunoassay device of claim 55, wherein there are snap tabs on the inner walls of the housing container.
60. The high throughput immunoassay device of claim 59, wherein the snap tabs can snap- fit to the multi-well plates.
61. The high throughput immunoassay device of any one of claims 35-60, wherein the device can accommodate multiple commercially available multi-well plates and multiple holders for the test strips.
62. An immunoassay for testing the binding capacity between a monoclonal antibody and a protein or peptide, wherein the protein or peptide is immobilized on a solid support, and wherein the monoclonal antibody is conjugated to a visualizing agent.
63. The immunoassay of claim 62, wherein the visualizing agent -conjugated monoclonal antibody is allowed to bind to the immobilized protein or peptide.
64. The immunoassay of claim 62 or 63, wherein the solid support is a nitrocellulose membrane.
65. The immunoassay of any one of claims 62-64, wherein the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
66. The immunoassay of claim 65, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600-700 nm.
67. The immunoassay of claim 65, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
68. The immunoassay of any one of claims 61-67, wherein the protein or peptide is a viral antigen.
69. The immunoassay of any one of claims 61-67, wherein the protein or peptide is a portion of a viral antigen.
70. The immunoassay of claim 69, wherein the portion of a viral antigen has a length of 9- 15 amino acid.
71. The immunoassay of any one of claim 68-70, wherein the viral antigen is a coronavirus (CoV) antigen.
72. The immunoassay of claim 71, wherein the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS- CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
73. The immunoassay of claim 72, wherein the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
74. The immunoassay of claim 73, wherein the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S).
75. The immunoassay of claim 73, wherein the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
76. The immunoassay of anyone of claims 68-70, wherein the viral antigen is a flavivirus antigen.
77. The immunoassay of claim 76, wherein the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
78. The immunoassay of claim 76 or 77, wherein the flavivirus antigen is flavivirus non- structural protein 1 (NS1).
79. The immunoassay of claim 76 or 77, wherein the flavivirus antigen is flavivirus precursor membrane (PrM) protein
80. A high throughput immunoassay, comprising a multitude of immunoassays of any one of claims 62-79, wherein the multitude of the immunoassays are conducted at the same time and in the same device.
81. The high throughput immunoassay of claim 80, wherein the proteins or peptides of more than one immunoassays are immobilized on the same solid support.
82. The high throughput immunoassay of claim 80 or 81, for mapping the peptide recognized by a monoclonal antibody, wherein the peptide is localized within a target protein recognized by the monoclonal antibody.
83. The high throughput immunoassay of claim 82, wherein a multitude of peptides from the target protein are tested in the same high throughput immunoassay against the same monoclonal antibody, wherein the protein is known to bind to the antibody.
84. The high throughput immunoassay of claim 82 or 83, wherein the target protein is a viral antigen.
85. The high throughput immunoassay of claim 84, wherein the target protein is a coronavirus (CoV) antigen.
86. The high throughput immunoassay of claim 85, wherein the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
87. The high throughput immunoassay of claim 86, wherein the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
88. The high throughput immunoassay of claim 87, wherein the coronavirus (CoV) antigen is SARS-CoV-2 Spike Protein (SARS-CoV-2S).
89. The high throughput immunoassay of claim 87, wherein the coronavirus (CoV) antigen is SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
90. The high throughput immunoassay of claim 85, wherein the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
91. The high throughput immunoassay of claim 90, wherein the coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
92. The high throughput immunoassay of claim 91, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
93. The high throughput immunoassay of claim 91, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
94. The high throughput immunoassay of claim 84, wherein the viral antigen is a flavivirus antigen.
95. The high throughput immunoassay of claim 94, wherein the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZDCV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
96. The high throughput immunoassay of claim 94 or 95, wherein the flavivirus antigen is flavivirus non-structural protein 1 (NS1).
97. The high throughput immunoassay of claim 94 or 95, wherein the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
98. The high throughput immunoassay of claim 94, wherein the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV),
Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV)
99. The high throughput immunoassay of claim 94 or 98, wherein the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
100. The high throughput immunoassay of claim 94 or 98, wherein the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
101. A high throughput screening method for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, the method comprising: obtaining a collection of candidate monoclonal antibodies that specifically bind to the target protein; providing a high throughput immunoassay device of any one of the claims 35- 58; providing at least one immunoassay test strip secured within the high throughput immunoassay device;
applying at least one candidate monoclonal antibody on at least one of the test areas of the at least one test strip, except the uppermost test area of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to at least one candidate monoclonal antibody; applying the target protein and the at least one visualizing agent conjugated candidate monoclonal antibody in the multi-well plate, wherein each well is provided with the target protein and one conjugated candidate monoclonal antibody, and wherein the positions of the wells correspond to the positions of the at least one test strips; immersing the distal end of the at least one test strips to the corresponding wells with the target protein and the at least one visualizing agent conjugated-candidate monoclonal antibody; allowing the target protein and the at least one visualizing agent-conjugated candidate monoclonal antibody to vertically defuse through the test strip and contact the immobilized monoclonal antibodies and the control antibody; incubating the reaction for at least 15-30 minutes; recoding the signal of each test area on the at least one test strip.
102. A high throughput screening method of claim 101, wherein the control antibody is an antibody that specifically binds the candidate monoclonal antibodies.
103. A high throughput screening method of claim 102, wherein the control antibody is an antibody that specifically binds the Fc portion of the candidate monoclonal antibodies.
104. A high throughput screening method of any one of claims 101-103, wherein each candidate monoclonal antibody is conjugated with a visualization agent and tested against each candidate monoclonal antibody immobilized on the test strip.
105. A high throughput screening method of any one of claims 101-103, wherein each candidate monoclonal antibody is immobilized on at least one test strip and tested against each candidate monoclonal antibody conjugated with a visualization agent.
106. A high throughput screening method of any one of claim 101-105, where each candidate monoclonal antibody is conjugated with a visualizing agent and tested against the same candidate monoclonal antibody on a test strip.
107. The high throughput screening method of any one of claim 101-106, wherein the portion of the test strip that contacts the immobilized antibodies is nitrocellulose membrane.
108. The high throughput screening method of any one of claims 101-107, wherein the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
109. The high throughput screening method of claim 108, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600- 700 nm.
110. The high throughput screening method of claim 108, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
111. The high throughput screening method of claim 101-110, wherein the target protein is a viral antigen.
112. The high throughput screening method of claim 111, wherein the viral antigen is a coronavirus (CoV) antigen.
113. The high throughput screening method of claim 112, wherein the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
114. The high throughput screening method of claim 113, wherein the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
115. The high throughput screening method of claim 114, wherein the coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S).
116. The high throughput screening method of claim 114, wherein the coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
117. The high throughput screening method of claim 112, wherein the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
118. The high throughput screening method of claim 117, wherein the coronavirus (CoV) antigen is a portion of protein from SARS-CoV-2.
119. The high throughput screening method of claim 118, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
120. The high throughput screening method of claim 118, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
121. The high throughput screening method of claim 111, wherein the viral antigen is a flavivirus antigen.
122. The high throughput screening method of claim 121, wherein the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
123. The high throughput screening method of claim 121 or 122, wherein the flavivirus antigen is flavivirus non- structural protein 1 (NS1).
124. The high throughput screening method of claim 121 or 122, wherein the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
125. The high throughput screening method of claim 121, wherein the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV),
Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV)
126. The high throughput screening method of claim 121 or 125, wherein the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
127. The high throughput screening method of claim 121 or 125, wherein the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
128. A high throughput selection platform for selecting a suitable monoclonal antibody pair consisting of a first and a second monoclonal antibody for use in a lateral flow assay to detect a target protein, wherein detecting the target protein comprises distinguishing the target protein from non-target proteins that are similar to the target protein, the method comprising:
conducting the high throughput screening method of any one of claims 98-124 with the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; conducting the high throughput screening method of any one of claims 98-124 with each of the non-target proteins that are similar to the target protein and the collection of candidate monoclonal antibodies capable of binding the target protein; comparing the signal intensity of the tested antibody pairings for the target protein and for each of the non-target proteins that are similar to the target protein; selecting the antibody parings that are capable of recognizing the target protein and distinguishing between the target protein and the non-target proteins that are similar to the target protein.
129. The high throughput selection platform of claim 128, wherein the high throughput screening with the non-target proteins similar to the target protein and the high throughput screening with the target protein are conducted in the same device and at the same time.
130. The high throughput selection platform of claim 128 or 129, wherein the target protein is a viral antigen.
131. The high throughput selection platform of claim 130, wherein the target protein viral antigen is a coronavirus (CoV) antigen.
132. The high throughput selection platform of claim 131, wherein the target protein coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU 1.
133. The high throughput selection platform of claim 132, wherein the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
134. The high throughput selection platform of claim 133, wherein the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S).
135. The high throughput selection platform of claim 133, wherein the target protein coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
136. The high throughput selection platform of claim 131, wherein the target protein coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU 1.
137. The high throughput selection platform of claim 136, wherein the target protein coronavirus (CoV) antigen is a portion of a protein from SARS-CoV-2.
138. The high throughput selection platform of claim 137, wherein the target protein coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
139. The high throughput selection platform of claim 137, wherein the target protein coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS- CoV-2N).
140. The high throughput selection platform of any one of claims 128-139, wherein the non target proteins that are similar to the target protein are viral antigens.
141. The high throughput selection platform of claim 140, wherein the non-target protein viral antigens are coronavirus (CoV) antigens.
142. The high throughput selection platform of claim 141, wherein at least some of the non target protein coronavirus (CoV) antigens are proteins from coronavirus (CoV) strains selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKUl.
143. The high throughput selection platform of claim 142, wherein at least some of the non target protein coronavirus (CoV) antigens are proteins from SARS-CoV-2.
144. The high throughput selection platform of claim 143, wherein at least some of the non target protein coronavirus (CoV) antigens are not proteins from SARS-CoV-2.
145. The high throughput selection platform of claim 144, wherein at least some of the non target protein coronavirus (CoV) antigens are Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKUl.
146. The high throughput selection platform of claim 144, wherein at least some of the coronavirus (CoV) antigens are Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKUl.
147. The high throughput selection platform of claim 141, wherein at least some of the non target protein coronavirus (CoV) antigens are portions of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS- CoV, 229E, NL63, OC43, and HKU1.
148. The high throughput selection platform of claim 147, wherein at least some of the non target protein coronavirus (CoV) antigens are portions of proteins from SARS-CoV-2.
149. The high throughput selection platform of claim 147, wherein at least some of the non target protein coronavirus (CoV) antigens are not portions of proteins from SARS-CoV- 2
150. The high throughput selection platform of claim 149, wherein at least some of the non target protein coronavirus (CoV) antigens are portions from Spike Protein (S) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS- CoV, 229E, NL63, OC43, and HKU1.
151. The high throughput selection platform of claim 149, wherein at least some of the non target protein coronavirus (CoV) antigens are portions from Nucleocapsid protein (N) from a coronavirus (CoV) strains selected from the group consisting of SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
152. The high throughput selection platform of claim 130, wherein the target protein viral antigen is a flavivirus antigen.
153. The high throughput selection platform of claim 152, wherein the target protein flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
154. The high throughput selection platform of claim 152 or 153, wherein the target protein flavivirus antigen is flavivirus non-structural protein 1 (NS1).
155. The high throughput selection platform of claim 152 or 153, wherein the target protein flavivirus antigen is flavivirus precursor membrane (PrM) protein.
156. The high throughput selection platform of claim 152, wherein the target protein flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV)
157. The high throughput selection platform of claim 152 or 156, wherein the target protein flavivirus antigen is a portion of flavivirus non- structural protein 1 (NS1).
158. The high throughput selection platform of claim 152 or 156, wherein the target protein flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
159. The high throughput selection platform of any one of claims 140 and 152-158, wherein the non-target protein viral antigens are flavivirus antigens.
160. The high throughput selection platform of claim 159, wherein at least some of the non target protein flavivirus antigens are proteins from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKY), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-bome encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
161. The high throughput selection platform of claim 159 or 160, wherein at least some of the non-target protein flavivirus antigens are flavivirus non- structural protein 1 (NS1).
162. The high throughput selection platform of claim 159 or 160, wherein at least some of the non-target protein flavivirus antigens are flavivirus precursor membrane (PrM) protein.
163. The high throughput selection platform of claim 159, wherein at least some of the non target protein flavivirus antigens are portions of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-bome encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever vims (OHFV)
164. The high throughput selection platform of claim 159 or 163, wherein at least some of the non-target protein flavivirus antigens are portions of flavivirus non-structural protein 1 (NS1).
165. The high throughput selection platform of claim 152 or 156, wherein at least some of the non-target protein flavivirus antigens are portions of flavivirus precursor membrane (PrM) protein.
166. A high throughput screening method for mapping the peptide that is recognized by a monoclonal antibody within a target protein recognized by the monoclonal antibody, the method comprising: obtaining a collection of overlapping candidate peptides that are fragments of the protein; providing a high throughput immunoassay device of any one of the claims 35- 58; providing at least one immunoassay test strip secured within the high throughput immunoassay device; applying at least one candidate peptide on at least one of the test areas of the at least one test strip, except the uppermost test areas of each of the at least one test strips; applying a control antibody in the uppermost test area of each of the at least one test strip; conjugating a visualizing agent to the monoclonal antibody; applying the visualizing agent conjugated monoclonal antibody in wells of the multi-well plate corresponding the positions of the at least one test strips; immersing the distal end of the at least one test strips into the corresponding wells with the visualizing agent conjugated monoclonal antibody; allowing the visualizing agent conjugated monoclonal antibody to vertically defuse through the test strips and contact the immobilized peptides and the control antibody; incubating the reaction for at least 15-30 minutes; recoding the signal of each test area on the at least one test strip.
167. A high throughput screening method of claim 166, wherein the control antibody is an antibody that specifically binds the monoclonal antibody.
168. A high throughput screening method of claim 167, wherein the control antibody is an antibody against the Fc portion of the monoclonal antibody.
169. A high throughput screening method of any one of claims 166-168, wherein each of the candidate peptides is immobilized on at least one test strip and tested against the visualizing agent conjugated monoclonal antibody.
170. The high throughput screening method of claim 166-169, wherein the portion of the test strip that contacts the immobilized candidate peptides is nitrocellulose membrane.
171. The high throughput screening method of any one of claims 166-170, wherein the visualizing reagent comprises a species of nanoparticles with a structure and an emission spectrum.
172. The high throughput screening method of claim 171, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 600- 700 nm.
173. The high throughput screening method of claim 171, wherein the species of nanoparticles comprise nanoparticles with an extinction spectral peak at around 500 nm.
174. The high throughput screening method of any one of claims 166-173, wherein the target protein is a viral antigen.
175. The high throughput screening method of claim 174, wherein the viral antigen is a coronavirus (CoV) antigen.
176. The high throughput screening method of claim 175, wherein the coronavirus (CoV) antigen is a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
177. The high throughput screening method of claim 176, wherein the coronavirus (CoV) antigen is a protein from SARS-CoV-2.
178. The high throughput screening method of claim 177, wherein the coronavirus (CoV) antigen is the SARS-CoV-2 Spike Protein (SARS-CoV-2S).
179. The high throughput screening method of claim 177, wherein the coronavirus (CoV) antigen is the SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
180. The high throughput screening method of claim 175, wherein the coronavirus (CoV) antigen is a portion of a protein from a coronavirus (CoV) strain selected from the group consisting of SARS-CoV-2, SARS-CoV, MERS-CoV, 229E, NL63, OC43, and HKU1.
181. The high throughput screening method of claim 180, wherein the coronavirus (CoV) antigen is a portion of protein from SARS-CoV-2.
182. The high throughput screening method of claim 181, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Spike Protein (SARS-CoV-2S).
183. The high throughput screening method of claim 182, wherein the coronavirus (CoV) antigen is a portion of SARS-CoV-2 Nucleocapsid Protein (SARS-CoV-2N).
184. The high throughput screening method of claim 174, wherein the viral antigen is a flavivirus antigen.
185. The high throughput screening method of claim 184, wherein the flavivirus antigen is a protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZD V), Yellow Fever (YFV), Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV).
186. The high throughput screening method of claim 184 or 185, wherein the flavivirus antigen is flavivirus non- structural protein 1 (NS1).
187. The high throughput screening method of claim 184 or 185, wherein the flavivirus antigen is flavivirus precursor membrane (PrM) protein.
188. The high throughput screening method of claim 184, wherein the flavivirus antigen is a portion of protein from a flavivirus strain selected from the group consisting of Dengue virus serotype 1 (DV1), Dengue virus serotype 2 (DV2), Dengue virus serotype 3 (DV3), Dengue virus serotype 4 (DV4), Zika virus (ZIKV), Yellow Fever (YFV),
Ilheus Virus (ILHV), Powassan (POWA), Japanese encephalitis (JE) virus, West Nile virus (WNV), Deer tick (DTV) tick-borne encephalitis virus (TBEV), Usuto (USTV), Saint Louis Encephalitis (SLEV), and Omsk hemorrhagic fever virus (OHFV)
189. The high throughput screening method of claim 184 or 188, wherein the flavivirus antigen is a portion of flavivirus non-structural protein 1 (NS1).
190. The high throughput screening method of claim 184 or 188, wherein the flavivirus antigen is a portion of flavivirus precursor membrane (PrM) protein.
191. A method to utilize the device in any one of the claims 35-61, wherein one group of test strips are utilized to conduct the high throughput screening for antibody paring of any of the claims 101-165, and another group of test strips are utilized to conduct the high throughput mapping in any of the claims 166-190.
192. The method of claim 191, wherein the tests utilizing the two groups of test strips are started and interpreted at the same time.
193. The method of claim 192, wherein the tests utilizing the two groups of test strips are started or interpreted at different times.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063049178P | 2020-07-08 | 2020-07-08 | |
US63/049,178 | 2020-07-08 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022010736A1 true WO2022010736A1 (en) | 2022-01-13 |
Family
ID=79552007
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2021/040106 WO2022010736A1 (en) | 2020-07-08 | 2021-07-01 | High throughput screening for monoclonal antibody pairs |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2022010736A1 (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7932099B2 (en) * | 2006-02-21 | 2011-04-26 | Nexus Dx, Inc. | Methods and compositions for analyte detection |
US20170233460A1 (en) * | 2016-02-11 | 2017-08-17 | Massachusetts Institute Of Technology | Anti-Dengue Virus NS1 Protein Monoclonal Antibodies |
-
2021
- 2021-07-01 WO PCT/US2021/040106 patent/WO2022010736A1/en active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7932099B2 (en) * | 2006-02-21 | 2011-04-26 | Nexus Dx, Inc. | Methods and compositions for analyte detection |
US20170233460A1 (en) * | 2016-02-11 | 2017-08-17 | Massachusetts Institute Of Technology | Anti-Dengue Virus NS1 Protein Monoclonal Antibodies |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Chang et al. | Systematic analysis of protein identity between Zika virus and other arthropod-borne viruses | |
Hunt et al. | A recombinant particulate antigen of Japanese encephalitis virus produced in stably-transformed cells is an effective noninfectious antigen and subunit immunogen | |
Jiang et al. | Selection and identification of B-cell epitope on NS1 protein of dengue virus type 2 | |
Chan et al. | Serological cross-reactivity among common flaviviruses | |
EP3119801B1 (en) | Distinguishing flavivirus infection using a recombinant mutant envelope protein | |
Adam et al. | Multiplexed fluorospot for the analysis of dengue virus–and Zika virus–specific and cross-reactive memory B cells | |
Li et al. | Identification of a new broadly cross-reactive epitope within domain III of the duck tembusu virus E protein | |
Merbah et al. | A high-throughput multiplex assay to characterize flavivirus-specific immunoglobulins | |
Prommool et al. | High performance dengue virus antigen-based serotyping-NS1-ELISA (plus): A simple alternative approach to identify dengue virus serotypes in acute dengue specimens | |
CN113447651A (en) | Method and kit for screening inhibitor of SARS-CoV virus and its application | |
Falconi-Agapito et al. | Dynamics of the magnitude, breadth and depth of the antibody response at epitope level following dengue infection | |
Lee et al. | Identification of peptide based B-cell epitopes in Zika virus NS1 | |
Hansen et al. | Diagnosing Zika virus infection against a background of other flaviviruses: Studies in high resolution serological analysis | |
Whitbeck et al. | Antigenicity, stability, and reproducibility of Zika reporter virus particles for long-term applications | |
Arrieta et al. | Evaluation of serological test of Zika in an endemic area of flavivirus in the Colombian Caribbean | |
Chen et al. | The identification of a B-cell epitope in bovine viral diarrhea virus (BVDV) core protein based on a mimotope obtained from a phage-displayed peptide library | |
Purdy et al. | Noninfectious recombinant antigen for detection of St. Louis encephalitis virus-specific antibodies in serum by enzyme-linked immunosorbent assay | |
Rai et al. | Design and synthesis of multiple antigenic peptides and their application for dengue diagnosis | |
da Silva et al. | Identification of continuous human B-cell epitopes in the envelope glycoprotein of dengue virus type 3 (DENV-3) | |
WO2022010736A1 (en) | High throughput screening for monoclonal antibody pairs | |
AU8735798A (en) | Use of recombinant envelope proteins for diagnosing the dengue virus | |
EP3465206B1 (en) | Method for the detection of an igm antibody specific for a flavivius in a sample | |
Henriques et al. | Evaluation of immunoglobulin M-specific capture enzyme-linked immunosorbent assays and commercial tests for flaviviruses diagnosis by a National Reference Laboratory | |
WO2021222597A2 (en) | Rapid diagnostic immunoassay for presence of antibodies | |
US20200325183A1 (en) | Ns2b as marker for zika virus infections |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21838913 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 21838913 Country of ref document: EP Kind code of ref document: A1 |