WO2022010652A1 - Compositions for increasing half-life of a therapeutic agent in felines and methods of use - Google Patents

Compositions for increasing half-life of a therapeutic agent in felines and methods of use Download PDF

Info

Publication number
WO2022010652A1
WO2022010652A1 PCT/US2021/038714 US2021038714W WO2022010652A1 WO 2022010652 A1 WO2022010652 A1 WO 2022010652A1 US 2021038714 W US2021038714 W US 2021038714W WO 2022010652 A1 WO2022010652 A1 WO 2022010652A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
polypeptide
feline
wild type
acid substitution
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/038714
Other languages
English (en)
French (fr)
Inventor
William Brondyk
Brett Chevalier
Juergen Horn
Madhusudan NATARAJAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Invetx Inc
Original Assignee
Invetx Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Invetx Inc filed Critical Invetx Inc
Priority to MX2023000500A priority Critical patent/MX2023000500A/es
Priority to CN202411349658.3A priority patent/CN119899259A/zh
Priority to KR1020237004652A priority patent/KR20230038522A/ko
Priority to CN202180056036.XA priority patent/CN116096741B/zh
Priority to AU2021306179A priority patent/AU2021306179A1/en
Priority to EP21745871.0A priority patent/EP4178977A1/en
Priority to CA3188448A priority patent/CA3188448A1/en
Priority to JP2023501003A priority patent/JP2023534636A/ja
Priority to BR112022027028A priority patent/BR112022027028A2/pt
Publication of WO2022010652A1 publication Critical patent/WO2022010652A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • This disclosure relates generally to polypeptides (e.g., fusion polypeptides such as polypeptide-Fc region fusions; or binding molecules such as antibodies or ligand-binding portions of receptor-Fc fusions) that have increased half-life in felines compared to their wild type counterparts.
  • polypeptides e.g., fusion polypeptides such as polypeptide-Fc region fusions; or binding molecules such as antibodies or ligand-binding portions of receptor-Fc fusions
  • the Fc region of antibodies plays a number of functional roles, including, but not limited to, protecting the antibody from degradation through the lysosomal pathway and mediating antibody effector functions.
  • feline antibodies As therapeutic agents, there has been an enhanced focus on not just selecting an optimal Fab, but also combining it with an appropriate Fc for desired half-life and effector functions.
  • polypeptide therapeutics e.g., antibodies
  • This disclosure remedies that failing by providing Fc region variants that improve the serum persistence of polypeptides (e.g., antibodies) in felines.
  • feline Fc e.g., feline IgG Fc region variant
  • feline FcRn binding fragments thereof that are useful in therapeutic polypeptides.
  • This disclosure features polypeptides that have increased binding to feline FcRn than control polypeptides (e.g., the wild type counterpart IgG feline Fc regions). In some instances, these polypeptides have increased binding to feline FcRn than control polypeptides at pH 5.5, pH 6.0 and/or pH 6.5.
  • these polypeptides can, e.g., bind to feline FcRn at a higher level at acidic pH (e.g., pH 5.5, pH 6.0 or pH 6.5) than at a neutral pH (e.g., pH 7.0, 7.1, 7.2, 7.3, 7.4, or 7.5). In some instances, these polypeptides bind to feline FcRn at a higher level at pH 5.5 and/or 6.0 than at pH 7.4. This disclosure relates, in part, to polypeptides that have increased half-life in felines than their wild type counterparts.
  • binding molecules e.g., antibodies or ligand-binding portions of receptors
  • binding molecules e.g., antibodies or ligand-binding portions of receptors
  • enzyme- Fc region fusions, ligand-Fc region fusions, nanobody-Fc fusions, and peptide-Fc region fusions are also provided.
  • the Fc regions in addition to having a substitution or substitutions (relative to the wild type feline Fc region) that increase half-life may also include other substitutions that, e.g., increase effector function, decrease effector function, increase binding to Protein A and/or decrease heterogeneity of the polypeptide (e.g., by removing one or more post-translational modifications in the Fc region).
  • the feline Fc region sequences can be from any feline antibody. In some instances, the feline Fc region sequences are from a feline IgG (e.g., IgGla, IgGlb, IgG2).
  • the disclosure features a recombinant protein comprising (1) a binding domain, or a fragment thereof, that specifically binds to a ligand, or an epitope of a protein, wherein the binding domain is attached to (2) a domain comprising an Fc region (CH2+ CH3 region) or a feline FcRn binding region thereof, as disclosed herein.
  • the binding domain comprises (i) the six complementarity determining regions (CDRs), for example, of a feline or human/humanized antibody; (ii) a nanobody; (iii] a soluble receptor-binding domain that binds a ligand, or a ligand-binding fragment thereof and (iv) an extracellular domain of a feline receptor protein.
  • CDRs complementarity determining regions
  • the disclosure also provides a composition
  • a composition comprising: (1) a first polypeptide comprising a first Fc region (e.g., a CH2 region, a CH3 region, a CH2+ CH3 region) comprising a feline IgG Fc region variant described herein; and (2) a second polypeptide comprising a second Fc region comprising a feline IgG Fc region variant described herein.
  • the first and second polypeptide can be associated through the first and second Fc regions.
  • the amino acid sequences of the first and second Fc regions are the same.
  • the amino acid sequences of the first and second Fc regions are different (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids).
  • the Fc region variant is a variant of a feline IgGla antibody Fc region.
  • the Fc region variant is a variant of a feline IgGlb antibody Fc region.
  • the Fc region variant is a variant of a feline IgG2 antibody Fc region.
  • a fusion molecule comprising a feline IgG Fc region variant disclosed herein and a polypeptide.
  • the feline IgGFc region variant is covalently attached to the polypeptide (e.g., through a hinge region or a linker).
  • the polypeptide is a ligand binding domain of a feline receptor protein, an extracellular domain of a feline receptor protein, or an antigen binding domain.
  • the polypeptide is selected from the ligand binding domain or extracellular domain of feline IL-13Ral, or IL-13Ra2, feline EPO, feline CTLA4, feline LFA3, feline VEGFR1/VEGFR3, feline IL-1R, feline GLP-1 receptor agonist, and feline Thrombopoietin binding peptide.
  • the polypeptide is an scFv, a nanobody, or single domain antibody.
  • the IgG Fc region variant is a variant of a feline IgGla antibody Fc region. In some instances, the IgG Fc region variant is a variant of a feline IgGlb antibody Fc region. In some instances, the IgG Fc region variant is a variant of a feline IgG2 antibody Fc region.
  • the disclosure provides a polypeptide comprising a feline IgG Fc region variant, or a feline FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 252 of a wild type feline IgG.
  • the amino acid substitution at position 252 of the wild type feline IgG is S252W.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 254 of a wild type feline IgG.
  • the amino acid substitution at position 254 of the wild type feline IgG is S254R.
  • the amino acid substitution at position 254 of the wild type feline IgG is S254K.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 309 of a wild type feline IgG.
  • the amino acid substitution at position 309 of the wild type feline IgG is L309V.
  • the amino acid substitution at position 309 of the wild type feline IgG is L309Y.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 311 of a wild type feline IgG.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311R.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q31 IV.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311K.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311L.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 428 of a wild type feline IgG.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428M.
  • the polypeptide comprises at least the amino acid substitution S428Y.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428Y.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428R.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428H.
  • the polypeptide comprises an amino acid substitution at one or more positions that correspond to amino acid positions selected from the group consisting of 262, 286, 289, 290, 293, 301, 312, 326, 334, 347, 355, 377, 380, 383, 389c, 392, 426 and 437 of a wild type feline IgG.
  • the amino acid substitution is selected from the group consisting of L262Q, L262E, T286E, T286D, T289K, S290V, S290Y, E293D, E293H, E293K, R301L, D312T, K326D, R334D, Q347L, Q355L, I377V, I377Y, E380D, E380V,E380T, I383L, N389c-R, R392E, S426L, S426H and T437L, and conservative amino acid substitutions of any of the foregoing.
  • the amino acid substitution is selected from the group consisting of L262Q, L262E, T286E, T286D, T289K, S290V, S290Y, E293D, E293H, E293K, R301L, D312T, K326D, R334D, Q347L, Q355L, I377V, I377Y, E380D, E380V, E380T, I383L, N389c-R, R392E, S426L, S426H and T437L.
  • the disclosure provides a polypeptide comprising a feline IgG Fc region variant, or a feline FcRn-binding region thereof, wherein the polypeptide comprises two or more amino acid substitutions, wherein the two or more amino acid substitutions are selected from the group consisting of:
  • amino acid substitution at a position that corresponds to amino acid position 252 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S252W, S252Y, S252F and S252R;
  • amino acid substitution at a position that corresponds to amino acid position 254 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S254R and S254K;
  • amino acid substitution at a position that corresponds to amino acid position 309 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of L309V, L309Y and L309E;
  • amino acid substitution at a position that corresponds to amino acid position 311 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of Q311R, Q31 IV, Q311L and Q311K;
  • amino acid substitution at a position that corresponds to amino acid position 428 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S428L, S428M, S428Y, S428H and S428R;
  • an amino acid substitution at a position that corresponds to amino acid position 434 of a wild type feline IgG wherein the amino acid substitution is selected from the group consisting of S434F, S434W, S434H, S434R, and S434Y; wherein the amino acid positions are based on EU numbering, wherein the two or more amino acid substitutions are at different positions, and wherein the polypeptide has increased binding affinity to feline FcRn when compared to (a) an Fc domain of the wild type feline IgG, and (b) a polypeptide comprising only one of the two or more amino acid substitutions.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 286 of a wild type feline IgG. In some embodiments, the amino acid substitution is selected from the group consisting of T286E and T286D. [0020] In some embodiments, the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 289 of a wild type feline IgG. In some embodiments, the amino acid substitution is selected from the group consisting of T289K and T289H.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 301 of a wild type feline IgG. In some embodiments the amino acid substitution is R301L. [0022] In some embodiments, the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 334 of a wild type feline IgG. In some embodiments, the amino acid substitution is R334D.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 426 of a wild type feline IgG.
  • the amino acid substitution is selected from the group consisting of S426L and S426H.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 437 of a wild type feline IgG. In some embodiments, the amino acid substitution is T437L. [0025] In some embodiments, the two or more amino acid substitutions are selected from the group consisting of:
  • S428L in combination with one or more of S252R, T286E, Q311 V, Q311K, D312T, I377V, I383L, and N389cR;
  • the polypeptide comprises an amino acid sequence that is at least 80% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 3.
  • the wild type feline IgG is a feline IgGla comprising an Fc domain having an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO: 1, a feline IgGlb comprising an Fc domain having an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO: 2, or a feline IgG2 comprising an Fc domain having an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO: 3.
  • the wild type feline IgG is a feline IgGla comprising an Fc domain having an amino acid sequence of SEQ ID NO: 1.
  • the wild type feline IgG is a feline IgGlb comprising an Fc domain having an amino acid sequence of SEQ ID NO: 2.
  • the wild type feline IgG is a feline IgG2 comprising an Fc domain having an amino acid sequence of SEQ ID NO: 3.
  • the polypeptide further comprises a binding domain.
  • the binding domain comprises (i) six complementarity determining regions (CDRs) of an immunoglobulin molecule, (ii) a ligand binding domain of a feline receptor protein, (iii) a nanobody, or (iv) an extracellular domain of a feline receptor protein.
  • the binding domain specifically binds to an antigen selected from the group consisting of NGF, TrKA, ADAMTS, IL-1, IL-2, IL-4, IL-4R, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, IL-5, IL-12, IL-13, IL-31, IL-33, CD3, CD20, CD47, CD52, and complement system complex.
  • an antigen selected from the group consisting of NGF, TrKA, ADAMTS, IL-1, IL-2, IL-4, IL-4R, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, IL-5, IL-12, IL-13, IL-31, IL-33, CD3, CD20, CD47, CD52, and complement system complex.
  • the polypeptide further comprises a protein selected from the group consisting of EPO, CTLA4, LFA3, VEGFR1/VEGFR3, IL- 1R, IL-4R, GLP-1 receptor agonist, and Thrombopoietin binding peptide.
  • the polypeptide binds to a feline FcRn at a higher level at an acidic pH than at a neutral pH. In some embodiments, the polypeptide binds to a feline FcRn at a higher level at pH 5.5 than at pH 7.4. In some embodiments, the polypeptide binds to a feline FcRn at a higher level at pH 6.0 than at pH 7.4.
  • the polypeptide has: (1) increased halfdife in a cat than a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type feline IgG Fc region in place of the IgG Fc region variant; and/or (2) increased binding to feline FcRn than the control polypeptides; and wherein the amino acid positions are based on EU numbering.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising (i) the polypeptide described herein, and (ii) a pharmaceutically acceptable excipient.
  • the disclosure provides a nucleic acid or nucleic acids encoding the polypeptide described herein.
  • the disclosure provides an expression vector or expression vectors comprising the nucleic acid or nucleic acids described herein.
  • the disclosure provides a host cell comprising the nucleic acid or nucleic acids described herein or the expression vector or expression vectors described herein.
  • the disclosure provides a method of making a polypeptide or polypeptides, the method comprising:
  • the method further comprises formulating the polypeptide as a pharmaceutical formulation.
  • the disclosure provides a method of treating a feline disease or disorder in a cat in need thereof, the method comprising administering an effective amount of a composition comprising the pharmaceutical composition described herein to the cat.
  • the disclosure provides a method of preventing a feline disease or disorder in a cat in need thereof, the method comprising administering an effective amount of a composition comprising the pharmaceutical composition described herein to the cat.
  • the disease or disorder is an allergic disease, a chronic pain, an acute pain, an inflammatory disease, an autoimmune disease, an endocrine disease, a gastrointestinal disease, a cardiovascular disease, a renal disease, a fertility related disorder, an infectious disease or a cancer.
  • the disease or disorder is atopic dermatitis, allergic dermatitis, osteoarthritic pain, arthritis, anemia, or obesity.
  • FIG. 1 depicts Biacore sensorgrams for the S428L, S428M, S428Y, S434F, S434W and S434H feline IgGla Fc variants from the NNK libraries.
  • the lighter line on each figure represents the measured data and the darker line represents the fitted curve using a 1 : 1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIG. 2 depicts Biacore sensorgrams for the S252W, S252Y and S252F feline IgGla Fc variants from the NNK libraries. Also depicted are Biacore sensorgrams for the wild-type (WT). The lighter line on each figure represents the measured data and the darker line represents the fitted curve using a 1 : 1 interaction model. Y-axis: Resonance Units (RU); X-axis: time (seconds).
  • RU Resonance Units
  • seconds time
  • FIG. 3 shows the alignment of the amino acid sequences of the wild-type feline IgGla Fc region (SEQ ID NO:l) and the wild-type feline IgGlb Fc region (SEQ ID NO:2) with the putative wild-type feline IgG2 Fc region (SEQ ID NO:3).
  • the hinge region lies between the triangles. Arrows indicate the cysteine residues in the hinge region likely involved in disulfide bridges between the two heavy chains (from Strietzel etal ., 2014, Vet. Immunol. Immunopathol ., 158:214-223).
  • FIG. 4 shows the alignment of the amino acid sequences of the wild-type feline IgGla Fc (SEQ ID NO: 1) and the human IgGl Fc region, based on EU numbering. The 55 amino acid positions used in the generation of the phage library described in Example 2 are highlighted and underlined.
  • FIGs. 5A and 5B depict Carterra LSA sensorgrams for the S252Y feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4. The irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 6A and 6B depict Carterra LSA sensorgrams for the S252Y+Q311R feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 7A and 7B depict Carterra LSA sensorgrams for the
  • FIGs. 8A and 8B depict Carterra LSA sensorgrams for the
  • FIGs. 9A and 9B depict Carterra LSA sensorgrams for the S252Y+Q311L feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 10A and 10B depict Carterra LSA sensorgrams for the S434Y feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 11A and 11B depict Carterra LSA sensorgrams for the
  • FIGs. 12A and 12B depict Carterra LSA sensorgrams for the
  • FIGs. 13A and 13B depict Carterra LSA sensorgrams for the
  • FIGs. 14A and 14B depict Carterra LSA sensorgrams for the
  • FIGs. 15A and 15B depict Carterra LSA sensorgrams for the
  • FIGs. 16A and 16B depict Carterra LSA sensorgrams for the
  • FIGs. 17A and 17B depict Carterra LSA sensorgrams for the
  • FIGs. 18A and 18B depict Carterra LSA sensorgrams for the
  • FIGs. 19A and 19B depict Carterra LSA sensorgrams for the
  • FIGs. 20A and 20B depict Carterra LSA sensorgrams for the
  • FIGs. 21A and 21B depict Carterra LSA sensorgrams for the
  • FIGs. 22A and 22B depict Carterra LSA sensorgrams for the
  • FIGs. 23A and 23B depict Carterra LSA sensorgrams for the
  • FIGs. 24A and 24B depict Carterra LSA sensorgrams for the S434F feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 25A and 25B depict Carterra LSA sensorgrams for the
  • FIGs. 26A and 26B depict Carterra LSA sensorgrams for the
  • FIGs. 27A and 27B depict Carterra LSA sensorgrams for the
  • FIGs. 28A and 28B depict Carterra LSA sensorgrams for the
  • FIGs. 29A and 29B depict Carterra LSA sensorgrams for the
  • FIGs. 30A and 30B depict Carterra LSA sensorgrams for the
  • FIGs. 31A and 31B depict Carterra LSA sensorgrams for the
  • FIGs. 32A and 32B depict Carterra LSA sensorgrams for the
  • FIGs. 33A and 33B depict Carterra LSA sensorgrams for the
  • FIGs. 34A and 34B depict Carterra LSA sensorgrams for the S428L+E380T+S434R feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1 : 1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 35A and 35B depict Carterra LSA sensorgrams for the Q311R feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 36A and 36B depict Carterra LSA sensorgrams for the R392E feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 37A and 37B depict Carterra LSA sensorgrams for the
  • FIGs. 38A and 38B depict Carterra LSA sensorgrams for the
  • FIGs. 39A and 39B depict Carterra LSA sensorgrams for the
  • FIGs. 40A and 40B depict Carterra LSA sensorgrams for the
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1 : 1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 41A and 41B depict Carterra LSA sensorgrams for the
  • FIGs. 42A and 42B depict Carterra LSA sensorgrams for the
  • FIGs. 43A and 43B depict Carterra LSA sensorgrams for the S428L feline IgGla Fc variant from the phage display library and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIGs. 44A and 44B depict Carterra LSA sensorgrams for the
  • FIGs. 45A and 45B depict Carterra LSA sensorgrams for the wild-type feline IgGla Fc variant (SEQ ID NO: 1) and its interaction with feline FcRN at pH6.0 and pH7.4.
  • the irregular lines represent the measured data and the smooth lines are the fitted curves using a 1:1 interaction model.
  • Y-axis Resonance Units (RU);
  • X- axis time (seconds).
  • FIG. 46 depicts a flow diagram of the two-compartmental pharmacokinetic (PK) model with linear clearance using non-linear mixed effects (NLME) modelling that was used to describe serum concentrations of anti-NGF monoclonal antibody (mAh) variants.
  • PK two-compartmental pharmacokinetic
  • NLME non-linear mixed effects
  • FIG. 47 depicts the individual observed serum concentrations of the wild- type (WT) antibody and antibody variants S252W, S428Y, S428Y+L309V,
  • FIG. 48 depicts the predicted serum concentration profiles of the wild- type (WT) antibody and antibody variants S252W, S428Y, S428Y+L309V,
  • FIGs. 49A-49L depict Biacore sensorgrams showing the binding of wild- type feline IgGla and feline IgGla variants.
  • the lighter lines on each figure represents the measured data and the darker line represents the fitted curve.
  • Y-axis Resonance Units (RU);
  • X-axis time (seconds).
  • FIG. 50 depicts individual observed serum concentrations of wild-type and Fc variants with two animals per variant.
  • FIG. 51 depicts predicted serum concentration profiles of the monoclonal antibodies carrying the wild-type (WT) IgGla Fc or the IgGla Fc variants. DETAILED DESCRIPTION
  • polypeptide e.g., antibodies, ligand-binding domains of receptors, enzymes, ligands, peptides
  • polypeptides e.g., antibodies, ligand-binding domains of receptors, enzymes, ligands, peptides
  • this disclosure features feline immunoglobulin Fc regions or feline FcRn-binding regions thereof comprising mutations that enhance the half-life of a polypeptide or polypeptides comprising these sequences. Also disclosed are polypeptides comprising these domains and methods of their use. These peptides can be used for various therapeutic and diagnostic purposes.
  • Cats typically have three IgG heavy chains referred to as IgGla, IgGlb and IgG2. These heavy chains represent three different subclasses of cat IgG.
  • the amino acid and DNA sequences for these heavy chains are available from Strietzel el al., 2014, Vet. Immunol. Immunopathol ., 158:214-223 and the GENBANK database.
  • the amino acid sequence of feline IgGla heavy chain has GENBANK accession number BAA32229.1
  • feline IgGlb heavy chain has GENBANK accession number BAA32230.1
  • feline IgG2 heavy chain has GENBANK accession number KF811175.1.
  • Feline antibodies also include two types of light chains: kappa and lambda.
  • the DNA and amino acid sequence of these light chains can also be obtained from GENBANK database.
  • the feline kappa light chain amino acid sequence has accession number AF 198257.1 and the feline lambda light chain has accession number E07339.1.
  • the CH2 region of a feline antibody comprises or consists of amino acids 231 to 340 (according to EU numbering) of a feline IgG antibody. It is to be understood that the CH2 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
  • amino acid sequence of the CH2 region of feline IgGla is provided below:
  • amino acid sequence of the CH2 domain of feline IgGlb is provided below:
  • VPEIPGAPSVFIFPPKPKDTLSISRTP EVTCLVVDLGPDDSNVQITWFVDNTE MHT AKTRPREEQFNSTYRVV S VLPILHQDWLKGKEFKCKVN SKSLPS AMER TISKAK(SEQ ID NO:6)
  • the CH3 region of a feline antibody comprises or consists of amino acids 341 to 447 (according to EU numbering) of a feline IgG antibody. It is to be understood that the CH3 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
  • amino acid sequence of the CH3 domain of feline IgGla is provided below:
  • amino acid sequence of the CH3 domain of feline IgGlb is provided below:
  • amino acid sequence of the CH3 domain of feline IgG2 is provided below:
  • the Fc region of a feline IgG antibody comprises or consists of amino acids 231 to 447 (according to EU numbering) of the feline IgG antibody.
  • amino acid sequence of the Fc domain of feline IgGla is provided below:
  • VPEIPGAPSVFIFPPKPKDTLSISRTP EVTCLVVDLGPDDSNVQITWFVDNTE MHTAKTRPREEQFNSTYRVV S VLPILHQDWLKGKEFKCKVN SKSLPS AMER TISKAKGQPHEPQVYVLPPTQEELSENKVSVTCLIKGFHPPDIAVEWEITGQP EPENNY QTTPPQLD SDGTYFLY SRLS VDRSHW QRGNT YTC SV SHEALHSHH TQKSLTQSPGK (SEQ ID NO:3) [00113] Table 1 below compares the amino acid sequences of the CH2 and CH3 domains of human IgGl, feline IgGla, feline IgGlb, and feline IgG2, based on EU numbering:
  • Increased serum persistence is a beneficial property for therapeutic polypeptides.
  • This disclosure features substitutions in wild type feline IgGla, IgGlb and IgG2 Fc regions that enhance the half-life of a polypeptide or polypeptides comprising these Fc regions in a cat relative to a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type feline IgG Fc region in place of the IgG Fc region variant.
  • the substitutions to increase half-life may be made in one or more of a feline CH2 region, a feline CH3 region, or in the context of a feline Fc (e.g., a CH2+CH3) region.
  • the present disclosure provides a polypeptide comprising a feline IgG Fc region variant, or a feline FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
  • the polypeptide has increased binding affinity to feline FcRn at a pH of about 5.0 to about 6.5 (e.g., about 5.5 or about 6.0) when compared to an Fc domain of the wild type feline IgG.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 252 of a wild type feline IgG.
  • the amino acid substitution at position 252 of the wild type feline IgG is S252W.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 254 of a wild type feline IgG.
  • the amino acid substitution at position 254 of the wild type feline IgG is S254R.
  • the amino acid substitution at position 254 of the wild type feline IgG is S254K.
  • the polypeptide comprises amino acid substitution L309V or L309Y.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 311 of a wild type feline IgG.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311R.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311 V.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311K.
  • the amino acid substitution at position 311 of the wild type feline IgG is Q311L.
  • the polypeptide comprises the amino acid substitution at a position that corresponds to amino acid position 428 of a wild type feline IgG.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428M.
  • the polypeptide comprises at least the amino acid substitution S428Y.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428Y.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428R.
  • the amino acid substitution at position 428 of the wild type feline IgG is S428H.
  • the polypeptide comprises an amino acid substitution at one or more positions that correspond to amino acid positions selected from the group consisting of 262, 286, 289, 290, 293, 301, 312, 326, 334, 347, 355, 377, 380, 383, 389c, 392, 426 and 437 of a wild type feline IgG.
  • the amino acid substitution is selected from the group consisting of L262Q, L262E, T286E, T286D, T289K, S290V, S290Y, E293D, E293H, E293K, R301L, D312T, K326D, R334D, Q347L, Q355L, I377V, I377Y, E380D, E380V, E380T, I383L, N389c-R, R392E, S426L, S426H and T437L, and conservative amino acid substitutions of any of foregoing.
  • the amino acid substitution is selected from the group consisting of L262Q, L262E, T286E, T286D, T289K, S290V, S290Y, E293D, E293H, E293K, R301L, D312T, K326D, R334D, Q347L, Q355L, I377V, I377Y, E380D, E380V, E380T, I383L, N389c-R, R392E, S426L, S426H and T437L.
  • the disclosure provides a polypeptide comprising a feline IgG Fc region variant, or a feline FcRn-binding region thereof, wherein the polypeptide comprises two or more amino acid substitutions, wherein the two or more amino acid substitutions are selected from the group consisting of:
  • amino acid substitution at a position that corresponds to amino acid position 252 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S252W, S252Y, S252F and S252R;
  • amino acid substitution at a position that corresponds to amino acid position 254 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S254R and S254K;
  • amino acid substitution at a position that corresponds to amino acid position 309 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of L309V, L309Y and L309E;
  • amino acid substitution at a position that corresponds to amino acid position 311 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of Q311R, Q31 IV, Q311L and Q31 IK;
  • amino acid substitution at a position that corresponds to amino acid position 428 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S428L, S428M, S428Y, S428H and S428R;
  • an amino acid substitution at a position that corresponds to amino acid position 434 of a wild type feline IgG wherein the amino acid substitution is selected from the group consisting of S434F, S434W, S434H, S434R, and S434Y; wherein the amino acid positions are based on EU numbering, wherein the two or more amino acid substitutions are at different positions, and wherein the polypeptide has increased binding affinity to feline FcRn when compared to (a) an Fc domain of the wild type feline IgG, and (b) a polypeptide comprising only one of the two or more amino acid substitutions.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 286 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of T286E and T286D.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 289 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of T289K and T289H.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 301 of a wild type feline IgG, wherein the amino acid substitution is R301L.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 334 of a wild type feline IgG, wherein the amino acid substitution is R334D.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 426 of a wild type feline IgG, wherein the amino acid substitution is selected from the group consisting of S426L and S426H.
  • the two or more amino acid substitutions comprise an amino acid substitution at a position that corresponds to amino acid position 437 of a wild type feline IgG, wherein the amino acid substitution is T437L.
  • the two or more amino acid substitutions are selected from the group consisting of:
  • S252Y in combination with Q311R and / or Q311L
  • S434Y in combination with one or more of S254R, S254K, L262E, T286D, T286E, T289K, E293D, E293K, L309V, L309E, K326D and Q347L;
  • the polypeptide comprises an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 3.
  • this disclosure provides a feline IgG CH2 region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:4 to 6. Also provided are feline IgG CH2 region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:4 to 6 by 1 to 15 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
  • this disclosure features a feline IgG CH3 region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97% or at least 98% or at least 99%, identical to the amino acid sequence set forth in any one of SEQ ID NOs.:7 to 9. Also featured are feline IgG CH3 region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:7 to 9 by 1 to 15 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
  • this disclosure features a feline IgG Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:l to 3. Also disclosed are feline IgG Fc region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:l to 3 by 1 to 20 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids.
  • a polypeptide or polypeptides comprising a feline IgG Fc CH2 region variant, the CH2 region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the amino acid sequence set forth in any one of SEQ ID NOs.:4 to 6.
  • a polypeptide or polypeptides comprising a feline IgG Fc CH3 region variant, the CH3 region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:7 to 9.
  • a polypeptide or polypeptides comprising a feline IgG Fc region variant, the Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:l to 3.
  • the polypeptide in some embodiments, further comprises at least one additional amino acid substitution in a region corresponding to amino acid positions 250-256, amino acid positions 285-288; amino acid positions 307-315; amino acid positions 376-380, amino acid positions 383 to 392; or amino acid positions 428-437 of the wild type feline IgG, wherein the amino acid positions are based on EU numbering, and wherein the polypeptide has increased binding to feline FcRn compared to an Fc domain of the wild type feline IgG.
  • the polypeptide comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) additional amino acid substitution selected from those disclosed in Table 2, below.
  • Table 2 List of amino acid substitutions (Groups 1 and 2) that increase binding of the feline IgGla Fc variant to feline FcRN.
  • the amino acid substitutions may be made on one or both chains of a CH2 domain, a CH3 domain, or an Fc domain. In some instances, the substitutions on both chains of a CH2 domain, a CH3 domain, or an Fc domain are identical. In some instances, the substitutions on both chains of a CH2 domain, a CH3 domain, or an Fc domain are not identical. In some instances, the Fc region includes one or more additional substitutions that increase or decrease effector function and/or improve product heterogeneity.
  • a therapeutic polypeptide/protein e.g., a monoclonal antibody
  • a complex process that entails coordination of a complex set of activities to generate the desired polypeptide/protein. These include optimization of the specificity, affinity, functional activity, expression level in engineered cell lines, long term stability, elimination or enhancement of effector functions and development of commercially viable manufacturing and purification methods. This disclosure encompasses any additional substitution that facilitates any one or more of the above goals.
  • the substitutions are introduced to reduce effector function of the feline Fc region.
  • Such substitutions will be familiar to persons skilled in the art and may be at one or more (e.g., 1, 2, 3, 4, 5, 6, or 7) positions of the feline
  • IgG Illustrative examples include WO 2019/035010 Al.
  • substitutions are introduced to a wild type feline IgG Fc region to enhance binding to Protein A so as to facilitate purification by protein A chromatography. Such substitutions will be familiar to persons skilled in the art and may be at one or more (e.g., 1, 2, 3, 4, 5, 6, or 7) positions of the feline IgG.
  • Illustrative examples include WO 2019/035010 Al.
  • additional amino acid substitutions can be made to alter binding affinity to FcRn as compared to a parent polypeptide or a wild-type polypeptide (e.g., to increase or reduce binding affinity with FcRn).
  • the polypeptide comprises a hinge region of a feline antibody.
  • modifications can be made to the hinge region of the feline antibody to increase half-life.
  • the disclosure encompasses any polypeptide that may benefit from having an increased half-life in a cat.
  • these polypeptides are designed to include an Fc region variant (e.g., a CH2 region, a CH3 region, a CH2+CH3 region) disclosed above.
  • Exemplary polypeptides include, but are not limited to, whole antibodies, scFvs, nanobodies, ligand-binding portions of a receptor, cytokines, growth factors, enzymes, and peptides.
  • a CH3 domain variant disclosed above may be attached to an scFv nanobody, ligand-binding portion of a receptor (e.g., the ligand binding portion of feline IL-13Ral or IL-13Ra2), a cytokine, a growth factor, an enzyme, or a peptide.
  • nanobody As used herein, the terms “nanobody”, “VHH”, “VHH antibody fragment” and “single domain antibody” are used interchangeably herein to denote the variable domain of the single heavy chain of antibodies of the type of those found in Camelidae , which are typically found in nature to lack light chains. Suitable nanobodies will be familiar to persons skilled in the art, illustrated examples of which include nanobodies of camels, dromedaries, llamas and alpacas. Alternatively, an Fc region variant disclosed above may be attached to these polypeptides. In another embodiment, a feline or felinized antibody is modified to include an Fc region variant disclosed herein.
  • the polypeptides of this disclosure include an antibody hinge region.
  • the hinge region may be placed between the antigen or ligand binding domain of the polypeptide and the Fc region variant.
  • the hinge region is attached to the C-terminus of a cytokine, a growth factor, an enzyme, or a peptide and the hinge region is attached to the N-terminus of the Fc region variant. Exemplary hinge region sequences are provided below.
  • IgGla KTDHPPGPKPCDCPKCP (SEQ ID NO: 10);
  • IgGlb KTDHPPGPKPCDCPKCP(SEQ ID NO: 11);
  • IgG2 KT AS TIE SKT GEGPKCP (SEQ ID NO: 12);
  • the hinge region if used, in a recombinant protein of this disclosure may include zero to six (i.e., 0, 1, 2, 3, 4, 5, or 6) amino acid substitutions relative to an amino acid sequence set forth in any one of SEQ ID NOs.: 10-12.
  • the hinge region used in a recombinant protein of this disclosure is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an amino acid sequence set forth in any one of SEQ ID NOs:10-12.
  • the polypeptide or polypeptides of this disclosure may comprise a binding domain.
  • the binding domain can specifically bind to a protein, subunit, domain, motif, and/or epitope of a selected target described herein.
  • the polypeptide or polypeptides e.g., fusion polypeptide
  • the target e.g., for the target of the binding domain
  • the therapeutic protein e.g., for the fusion polypeptide
  • the target is selected from the group consisting of: 17-IA, 4-1BB, 4Dc, 6-keto- PGFla, 8-iso-PGF2a, 8-oxo-dG, A1 Adenosine Receptor, A33, ACE, ACE-2, Activin, Activin A, Activin AB, Activin B, Activin C, Activin RIA, Activin RIA ALK-2, Activin RIB ALK-4, Activin RIIA, Activin RUB, ADAM, ADAMIO, ADAM 12, ADAM 15, ADAM 17/T ACE, ADAMS, ADAM9, ADAMTS, ADAMTS4, ADAMTS5, Addressins, aFGF, ALCAM, ALK, ALK-1, ALK-7, alpha- 1 -antitrypsin, alpha-V
  • the binding domain specifically binds to one or more therapeutic targets or antigens in feline, such as, but are not limited to, ACE, ACE-2, Activin, Activin A, Activin AB, Activin B, Activin C, Activin RIA, Activin RIA ALK-2, Activin RIB ALK-4, Activin RIIA, Activin RUB, ADAM, AD AMI 0, ADAM 12, AD AMI 5, ADAM 17/T ACE, ADAMS, ADAM9, AD AMTS, ADAMTS4, ADAMTS5, ANG, Ang, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, Atrial natriuretic factor, av/b3 integrin, b-ECGF, CD19, CD20, CD30, CD34, CD40, CD40L, CD47, COX, CTLA-4, EGFR (ErbB-1), EPO, Follicle stimulating hormone
  • the polypeptide or polypeptides can comprise a protein, wherein the protein is a therapeutic protein, e.g., EPO, CTLA4, LFA3, VEGFR1/VEGFR3, IL-1R, IL-4R, GLP-1 receptor agonist, or Thrombopoietin binding peptide.
  • a therapeutic protein e.g., EPO, CTLA4, LFA3, VEGFR1/VEGFR3, IL-1R, IL-4R, GLP-1 receptor agonist, or Thrombopoietin binding peptide.
  • the therapeutic protein is ACE, ACE-2, Activin, Activin A, Activin AB, Activin B, Activin C, Activin RIA, Activin RIA ALK- 2, Activin RIB ALK-4, Activin RIIA, Activin RUB, ADAM, AD AMI 0, AD AMI 2, ADAM15, ADAM 17/T ACE, ADAMS, ADAM9, ADAMTS, ADAMTS4, ADAMTS5, ANG, Ang, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, Atrial natriuretic factor, av/b3 integrin, b-ECGF, CD19, CD20, CD30, CD34, CD40, CD40L, CD47, COX, CTLA-4, EGFR (ErbB-1), EPO, Follicle stimulating hormone, GDF-8 (Myostatin), GLP1, GLP2, GnRH, Growth hormone releasing factor, I
  • polypeptide or polypeptides described herein can be admixed with a pharmaceutically acceptable carrier or excipient.
  • a pharmaceutically acceptable carrier or excipient See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984)).
  • Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N. Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al.
  • the polypeptide or polypeptides of the present invention are diluted to an appropriate concentration in a sodium acetate solution pH 5-6, and NaCl or sucrose is added for tonicity.
  • Toxicity and therapeutic efficacy of the polypeptide compositions, administered alone or in combination with another agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LDso (the dose lethal to 50% of the population) and the EDso (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index (LD50/ED50).
  • a polypeptide or polypeptides exhibiting high therapeutic indices are desirable.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in felines.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration.
  • the mode of administration can vary. Suitable routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
  • the polypeptide or polypeptides can be administered by an invasive route such as by injection.
  • the polypeptide or polypeptides is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery.
  • compositions disclosed herein may also be administered by infusion.
  • implants and modules form administering pharmaceutical compositions include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments. Many other such implants, delivery systems, and modules are well known to those skilled in the art.
  • polypeptide or polypeptides may be administered in a local rather than systemic manner, for example, via injection of the antibody directly into an arthritic joint or pathogen-induced lesion characterized by immunopathology, often in a depot or sustained release formulation.
  • a targeted drug delivery system for example, in a liposome coated with a tissue-specific antibody, targeting, for example, arthritic joint or pathogen-induced lesion characterized by immunopathology.
  • the liposomes will be targeted to and taken up selectively by the afflicted tissue.
  • the administration regimen depends on several factors, including, without limitation, the age, weight, and physical condition of the feline being treated, the serum or tissue turnover rate of the therapeutic antibody, the level of symptoms, the immunogenicity of the therapeutic polypeptide or polypeptides, and the accessibility of the target cells in the biological matrix.
  • the administration regimen delivers sufficient therapeutic polypeptide or polypeptides to effect improvement in the target disease state, while simultaneously minimizing undesired side effects.
  • the amount of biologic delivered depends in part on the particular therapeutic polypeptide or polypeptides and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies is available (see, e.g., Wawrzynczak Antibody Therapy, Bios Scientific Pub.
  • Determination of the appropriate dose of the polypeptide or polypeptides is made by one skilled in the art, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
  • nucleic Acids Nucleic Acids, Vectors, Host Cells, and Methods of Making [0161]
  • the disclosure also encompasses nucleic acid or nucleic acids encoding the polypeptide or polypeptides described herein, a vector or vectors comprising the nucleic acid or nucleic acids, and host cells comprising the nucleic acid or nucleic acids or the vector or vectors.
  • polypeptide or polypeptides described herein may be produced in bacterial or eukaryotic cells.
  • Some polypeptides, e.g, Fab’s can be produced in bacterial cells, e.g., E. coli cells.
  • Polypeptides can also be produced in eukaryotic cells such as transformed cell lines (e.g., CHO, 293E, COS, 293T, Hela).
  • polypeptides e.g., scFv’s
  • yeast cell such as Pichia (see, e.g, Powers et al., J Immunol Methods. 251:123-35 (2001)), Hanseula, or Saccharomyces .
  • a polynucleotide or polynucleotides encoding the polypeptide or polypeptides is/are constructed, introduced into an expression vector or expression vectors, and then expressed in suitable host cells.
  • the nucleotide sequences of the genes can be recoded without changing (or minimally changing - e.g., removal of a C-terminal residue of the heavy or light chain) the amino acid sequence.
  • the areas for potential recoding include those associated with translation initiation, codon usage, and possible unintended mRNA splicing.
  • Polynucleotides encoding an Fc region variant described herein would be readily envisioned by the ordinarily skilled artisan.
  • Standard molecular biology techniques can be used to prepare the recombinant expression vector(s), transfect the host cells, select for transformants, culture the host cells, and recover the polypeptide (e.g., antibody).
  • the expression vector should have characteristics that permit amplification of the vector in the bacterial cells. Additionally, when E. coli such as JM109, DH5a, HB101, or XL 1 -Blue is used as a host, the vector must have a promoter, for example, a lacZ promoter (Ward et al., 341:544-546 (1989), araB promoter (Better et al., Science, 240: 1041-1043 (1988)), or T7 promoter that can allow efficient expression in E. coli.
  • a promoter for example, a lacZ promoter (Ward et al., 341:544-546 (1989), araB promoter (Better et al., Science, 240: 1041-1043 (1988)
  • T7 promoter that can allow efficient expression in E. coli.
  • Such vectors include, for example, Ml 3-series vectors, pUC- series vectors, pBR322, pBluescript, pCR-Script, pGEX-5X-l (Pharmacia), “QIAexpress system” (QIAGEN), pEGFP, and pET (when this expression vector is used, the host is preferably BL21 expressing T7 RNA polymerase).
  • the expression vector may contain a signal sequence for antibody secretion.
  • the pelB signal sequence Lei et al, J. Bacteriol., 169:4379 (1987)
  • calcium chloride methods or electroporation methods may be used to introduce the expression vector into the bacterial cell.
  • the expression vector includes a promoter necessary for expression in these cells, for example, an SV40 promoter (Mulligan et al, Nature, 277:108 (1979)) (e.g., early simian virus 40 promoter), MMLV-LTR promoter, EFla promoter (Mizushima et al, Nucleic Acids Res., 18:5322 (1990)), or CMV promoter (e.g., human cytomegalovirus immediate early promoter).
  • SV40 promoter Mulligan et al, Nature, 277:108 (1979)
  • MMLV-LTR promoter e.g., MMLV-LTR promoter
  • EFla promoter e.g., EFla promoter
  • CMV promoter e.g., human cytomegalovirus immediate early promoter
  • the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see, e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017).
  • the selectable marker gene confers resistance to drugs, such as G418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced.
  • vectors with selectable markers include pMAM, pDR2, pBK-RSV, pBK-CMV, pOPRSV, and pOP13.
  • the polypeptide or polypeptides are produced in mammalian cells.
  • exemplary mammalian host cells for expressing polypeptide or polypeptides include Chinese Hamster Ovary (CHO cells) (including dhfr- CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol.
  • human embryonic kidney 293 cells e.g., 293, 293E, 293T
  • COS cells e.g., NIH3T3 cells
  • lymphocytic cell lines e.g., NS0 myeloma cells and SP2 cells
  • a cell from a transgenic animal e.g., a transgenic mammal.
  • the cell is a mammary epithelial cell.
  • a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain of the antibody is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection.
  • the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/ AdMLP promoter regulatory element or an SV40 enhancer/ AdMLP promoter regulatory element) to drive high levels of transcription of the genes.
  • enhancer/promoter regulatory elements e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/ AdMLP promoter regulatory element or an SV40 enhancer/ AdMLP promoter regulatory element
  • the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
  • the selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and the antibody is recovered from the culture medium.
  • polypeptide or polypeptides disclosed herein can be used to treat or prevent any disease or disorder in a cat in need thereof. This invention is particularly helpful in the treatment of chronic conditions where repeated dosing is required. Because of the increased half-life of the protein therapeutic, less frequent dosing and/or reduced dose levels may be possible.
  • the disease, disorder, condition or symptoms being treated or prevented is an allergic disease, a chronic pain, an acute pain, an inflammatory disease, an autoimmune disease, an endocrine disease, a gastrointestinal disease, a skeletal/musculoskeletal disease, a cardiovascular disease, a neurological disease, a renal disease, a metabolic disease, a immunological disease, a genetic/inherited disease, a fertility related disorder, an infectious disease or a cancer.
  • the disease or disorder being treated or prevented is atopic dermatitis, allergic dermatitis, food allergy, osteoarthritic pain, perioperative pain, dental pain, cancer pain, arthritis, anemia, obesity, or diabetes.
  • Antibodies may not only be used to treat or prevent disease but also to modulate normal biological function, for example, to manage fertility or behavior.
  • polypeptide or polypeptides disclosed herein can also be used for various diagnostic purposes, for example, to determine whether a cat has any particular disease or disorder.
  • the polypeptide or polypeptides may comprise a binding domain.
  • the binding domain can specifically bind to a protein, subunit, domain, motif, and/or epitope as described herein (e.g., a maker for cancer cells).
  • the polypeptide or polypeptides further comprises a labeling group.
  • label groups fall into a variety of classes, depending on the assay in which they are to be detected: a) isotopic labels, which may be radioactive or heavy isotopes; b) magnetic labels (e.g., magnetic particles); c) redox active moieties; d) optical dyes; enzymatic groups (e.g. horseradish peroxidase, b-galactosidase, luciferase, alkaline phosphatase); e) biotinylated groups; and f) predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags, etc.).
  • the labelling group is coupled to the antibody via spacer arms of various lengths to reduce potential steric hindrance.
  • Various methods for labelling proteins are known in the art and may be used in performing the present invention.
  • the labeling group is a probe, a dye (e.g., a fluorescent dye), or a radioactive isotope (e.g., 3 H, 14 C, 22 Na, 36 C1, 35 S, 33 P, or 125 I).
  • a dye e.g., a fluorescent dye
  • a radioactive isotope e.g., 3 H, 14 C, 22 Na, 36 C1, 35 S, 33 P, or 125 I.
  • Specific labels can also include optical dyes, including, but not limited to, chromophores, phosphors and fluorophores, with the latter being specific in many instances. Fluorophores can be either “small molecule” fluores, or proteinaceous fluores.
  • the fluorescent label can be any molecule that may be detected via its inherent fluorescent properties. Suitable fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade BlueJ, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cascade Yellow and R-phycoerythrin (PE) (Molecular Probes, Eugene, Oreg.), FITC, Rhod
  • Suitable optical dyes including fluorophores, are described in Molecular Probes Handbook by Richard P. Haugland, which is incorporated by reference in its entirety.
  • Suitable proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., 1994, Science 263:802-805), EGFP (Clontech Laboratories, Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc. 1801 de Maisonneuve Blvd.
  • Binding to FcyRI and FcyRIII is a measure of the ability of an antibody to mediate ADCC. In order to assess this property for an antibody an assay to measure binding of the antibody to FcyRI and FcyRIII can be conducted using methods known in the art.
  • Binding to the first component of complement, Clq is a measure of the ability of an antibody to mediate complement-dependent cytotoxicity (CDC).
  • CDC complement-dependent cytotoxicity
  • the half-life of an antibody can be measured by injection of the antibody into an animal model (e.g. a cat model) and measuring levels of the antibody in the serum over a certain period of time.
  • animal models include non-human primate models and transgenic mouse models.
  • the transgenic mouse models e.g. Tg32 or Tg276 transgenic mice
  • the human FcRn alpha chain can pair in vivo with the mouse p2-microglobulin protein forming a functional chimeric FcRn heterodimer.
  • NNK (SEQ ID NO: 1) was synthesized and used as template for the NNK mutagenesis.
  • the NNK saturation mutagenesis method is an effective strategy to generate all 20 possible amino acids at a desired position (Hogrefe et ah, Biotechniques. 33: 1158-1165 [2002]).
  • Individual NNK libraries at positions 252, 428 and 434 (EU numbering) were generated.
  • the PCR-product was subcloned into the GenScript FASEBA plasmid, transformed into E. coli and sequenced verified for the presence of the variant.
  • SASA single-domain antibody against serum albumin
  • the SASA antibody enables the capture of the Fc to the sensor chip surface described below.
  • the PelB pectate lyase B signal peptide is at the N-terminus to facilitate secretion of the Fc into the medium.
  • the expression of CH2-CH3 protein was regulated by the Lac promoter.
  • the supernatants from conditioned medium were analyzed for binding to feline FcRn (GenBankKF773786 [IgG receptor FcRn large subunit p51] and European Nucleotide Archive AY829266.1 [feline beta-2-microglobulin]) at pH 6.0 for variants using surface plasmon resonance (SPR).
  • feline FcRn GenBankKF773786 [IgG receptor FcRn large subunit p51] and European Nucleotide Archive AY829266.1 [feline beta-2-microglobulin]
  • bovine serum albumin (BSA) was immobilized to CM5 sensor chip.
  • the sensor chip surface of flow cells 1 and 2 were activated by freshly mixed 50 mmol/L N-Hydroxysuccinimide and 200 mmol/L 1 -ethyl-3 -(3 -dimethylaminopropyl) carbodiimide hydrochloride for 420s (10 pL/min).
  • BSA diluted in 10 mM sodium acetate (pH 4.5) was injected into the flow cell 2 to achieve conjugation, while flow cell 1 was set as blank.
  • the running buffer for the binding experiment was HBS-EP (10 mM HEPES, 500 mM NaCl, 3 mM EDTA, 0.05% Tween 20, pH 5.5) and it was run at 25°C.
  • Supernatants from the variants were injected over chip surface and captured via the SASA tag onto the immobilized BSA for 60 sec.
  • Feline FcRn at 200 nM was injected for 120 sec and the dissociation was complete with running buffer for 120 sec.
  • the flow rate for the immobilization phase of BSA was 10 m ⁇ /min and the flow rate for the association and dissociation phase was 30 m ⁇ /min. All of the data was processed using the Biacore 8K evaluation software version 1.1. See Figures 1 and 2 for the Biacore sensorgrams.
  • the variants tested showed increased binding affinity for feline FcRn at pH 6.0 when compared to wild type feline IgGla Fc (SEQ ID NO: 1).
  • NNK mutagenesis at amino acid positions 252, 428 and 434 were found to yield mutants which increased binding to FcRn at pH 6.0. Sequencing of all 90 clones generated at these 3 positions indicated that the following 6 clones had not been generated, namely S252H, S428E, S428C, S428F, S428W and S434Y. All other amino acid substitutions at these positions yielded no benefit on testing. The results are summarized in Table 3 below. Table 3: IgG variants and FcRn binding kinetics.
  • a phage display library approach was used to identify feline IgGla Fc variants that increase the affinity to feline FcRn at pH 6.0.
  • the feline IgGla Fc (Kanai et al., 2000. Vet. Immunol. Immunopathol . 73:53) was synthesized by Twist Bioscience to have variants at 55 different positions ( Figure 4). At each of the mutated positions, eight possible amino acids were substituted. These amino acids were arginine and lysine (positively charged side chain), aspartic acid and glutamic acid (negatively charged side chain), threonine and glutamine (polar uncharged side chain), and leucine and valine (hydrophobic side chain).
  • the Fc DNA library was designed to have an average of two variants per Fc molecule.
  • the Fc variants with the desired site-specific mutations were printed as mutagenic oligonucleotides on Twist's silicon-based platform.
  • the oligonucleotides were then assembled to create a full-length Fc gene fragment pool using assembly PCR.
  • the assembled Fc gene fragment pool was then cloned into the pADL-22c phagemid vector from Antibody Design Labs into the Sfi cut-sites.
  • the cloned DNA library was transformed into electrocompetent TGI E.coli cells to create an experimental diversity of 8 x 10 10 variants.
  • the phagemid transformed E. coli cells were then co-transfected with M13K07 helper phage to generate a phage pool that was used for protein-based panning.
  • the library was resuspended into 20 mM MES buffer, pH 6.0, 0.05% tween 20 and 3% milk.
  • the quality of the library was determined by picking 96 random phage clones and sequenced by the Sanger method. The number of mutants per phage are shown in Table 4, below.
  • a Protein A capture step was used to eliminate any Fc variants that have lost Protein A binding.
  • the phage library was captured onto Protein A beads and washed with PBS, pH 7.4.
  • the phage were eluted with 0.1M glycine, pH 2.7 and the pH was immediately neutralized with 1 M Tris-HCl, pH 7.5.
  • the neutralized phage was precipitated with polyethylene glycol/NaCl and centrifuged. The pelleted phage were resuspended in 20 mM MES, pH 6.0, 0.05% tween 20, 3% milk.
  • the phage was eluted with PBS, pH 7.4 by incubating at 37°C for 30 minutes.
  • the eluted phage were depleted with 0.31 pg/ml of feline FcRn at pH 7.4.
  • the unbound phage was amplified in TGI cells. The exact conditions and results for each round are shown in Table 5, below.
  • Table 5 Wash conditions and number of depletions for phage selections. [0189] A total of 768 phage clones were isolated from the output of the third round of selection and 768 phage clones from the fourth round of selection. The clones were sequenced by next generation sequencing using the Illumina MiSeq.
  • a Carterra instrument was used to determine the binding kinetics.
  • the antibodies ( ⁇ 5 pg/ml) were amine-coupled to the HC30M sensor chip by EDC/NHS activation, followed by ethanolamine HC1 quenching.
  • a set of further anti-nerve growth factor (NGF) feline IgGla antibody variants were synthesized by Twist Bioscience using the variable domains previously described by Gearing et al. (2016, J Vet Intern Med, 30:1129).
  • the modifications to the Fc region of these antibodies are set out in Tables 8 and 9, below, as compared to the reference sequence of the wild-type feline IgGla Fc domain that is described by Kanai etal. (2000, Vet. Immunol. Immunopathol. 73:53).
  • the feline IgGla constructs were subcloned into a mammalian expression vector and transfected into Expi293 cells with ExpiFectamine 293 transfection reagent.
  • the IgGla Fc variants were purified from the conditioned medium with Protein A chromatography and formulated in 43 mM sodium citrate, 130 mM sodium bicarbonate, pH 6.0. A Carterra instrument was then used to determine the binding affinity of the IgG Fc variants to feline FcRn.
  • the antibody variants ( ⁇ 5 pg/ml) were amine-coupled to the HC30M sensor chip by EDC/NHS activation, followed by ethanolamine HC1 quenching.
  • Feline FcRn (FCN- F82W3, Acrobiosystems) at 333nM, l l lnM, 37nM, 12.3nM, 4.1nM, 1.37nM or 0.45nM was flowed over the sensor chip in HBSTE (10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Tween-20), 0.5% bovine serum albumin at pH 6.0 to determine the kinetics at pH 6.0. This same strategy was employed to determine the binding affinity of the Fc variants to feline FcRn at pH 7.4, where the pH of the HBSTE buffer was adjusted to 7.4.
  • Example 4 Pharmacokinetic study of feline IgGla Fc variants with increased FcRn binding and wild-type feline IgGla.
  • the animals were randomized into six groups with a male and female in each group. Each animal was administered with single intravenous dose of 2mg/kg of antibody. Approximately 0.5 ml of whole blood was collected at the following time points: 0 (pre-dose), 4 hours, and 1, 2, 4, 6, 10, 14, 18, 22, 30, 34 38, 42 days post injection. Serum was separated from whole blood and assayed for the presence of the antibody by an ELISA that is specific for anti-NGF antibodies. Serum concentrations of six anti-NGF monoclonal antibody (mAh) variants were described with a two- compartmental pharmacokinetic (PK) model with linear clearance using non-linear mixed effects (NLME) modelling (Figure 46).
  • PK pharmacokinetic
  • NLME non-linear mixed effects
  • the wild-type (WT) mAh variant was used as a reference.
  • the estimated PK parameters are given in Table 9, below.
  • the predicted serum concentration profiles of the monoclonal antibodies carrying the wild-type (WT) IgGla Fc or the IgGla Fc variants S252W, S428Y, S428Y+L309V, S428Y+Q311V, and S428Y+S254R for a typical 2 kg cat receiving a single IV dose of 2 mg/kg are shown in Figure 48.
  • Table 9 PK parameter estimates for a cat of 2 kg body weight.
  • Example 5 Binding kinetics of feline IgGla variants to feline FcRn using Cl biosensors
  • feline IgGla variants S252W, L309V, Q311V, S428Y, S428Y + Q311V, S428Y + 254R, S428Y + L309V, S428Y + Q311 V + T286E, S428Y + Q311 V + E380T, S428Y + L309V + T286E, and S428Y + L309V + E380T
  • feline FcRn GenBank KF773786 [feline FcRn large subunit p51] and European Nucleotide Archive AY829266.1 [feline beta-2-microglulin]
  • feline Fc variants carrying single amino acid substitutions or a combination of amino acid substitutions were synthesized into the feline IgGla (Kanai etal. , 2000, Vet. Immunol. Immunopathol. 73 :53) using the variable domain described by Gearing DP et al. (2016, J Vet Intern Med, 30: 1129).
  • the synthesized feline IgGa variant DNAs were subcloned into a mammalian expression vector and transiently transfected into CHO cells. The conditioned media were purified using protein A chromatography.
  • concentrations per antibody were injected at 5 m ⁇ /min for 90 seconds, followed by 180 seconds dissociation. Each concentration series was injected three times in this format, with at least three buffer-only cycles for proper reference subtraction. The surface was regenerated with two injections of IX PBS-P+, pH 7.4 for 30 seconds, followed by a 60 second wait command. Three startup cycles were included to stabilize the surface prior to analysis.
  • Example 6 Pharmacokinetic study of feline IgGla Fc variants with two or three Fc substitutions and wild-type feline IgGla
  • PK pharmacokinetic
  • Feline IgGla Fc variants including the antibody carrying a wild-type feline IgGla Fc domain, were prepared using the anti-NGF variable domain as previously described by Gearing et al. (2016, J Vet Intern Med , 30: 1129).
  • the feline IgGla variants tested in this study included: S428Y + L309V, S428Y + Q311V, S428Y + Q311V + T286E, S428Y + L309V + E380T, S428Y + Q311 V + E380T, S428Y + L309V + T286E, wild- type.
  • the animals were randomized into seven groups with a male and female in each group. Each animal was administered with a single intravenous dose of 2mg/kg of antibody. Approximately 0.5 ml of whole blood was collected at the following time points: 0 (pre-dose), 4 hours, and 1, 2, 4, 6, 10, 14, 18, 22, 30, 34 38, 42 days post injection. Serum was separated from whole blood and assayed for the presence of the antibody by an ELISA that is specific for feline anti-NGF antibodies.
  • Serum concentrations of the seven anti-NGF monoclonal antibody (mAh) variants were described with a two-compartmental pharmacokinetic (PK) model with linear clearance using non-linear mixed effects (NLME) modelling (Population parameters were estimated using the stochastic approximation of expectation-maximization (SAEM) algorithm implemented in Monolix Suite 2019R1 (Monolix version 2019R1. Antony, France: Lixoft SAS, 2019). Serum concentrations of S428Y + Q31 IV, S428Y + L309V and wild-type from the PK study described in Example 4 were modeled as above and included in these calculations. Individual parameters were modeled as random variables with log-normal distributions.
  • SAEM stochastic approximation of expectation-maximization
  • f ror was the population typical parameter
  • h was a random variable with mean 0 and standard deviation w
  • BW L was the body weight of animal i
  • B W re was the reference body weight of 2 kg.
  • the wild-type (WT) mAh was used as a reference.
  • Table 12 PK parameter estimates for a cat of 2 kg body weight.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
PCT/US2021/038714 2020-07-10 2021-06-23 Compositions for increasing half-life of a therapeutic agent in felines and methods of use Ceased WO2022010652A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
MX2023000500A MX2023000500A (es) 2020-07-10 2021-06-23 Composiciones para aumentar la semivida de un agente terapeutico en felinos y modos de uso.
CN202411349658.3A CN119899259A (zh) 2020-07-10 2021-06-23 用于延长治疗剂在猫科动物中的半衰期的组合物和使用方法
KR1020237004652A KR20230038522A (ko) 2020-07-10 2021-06-23 고양이에서 치료제의 반감기를 증가시키기 위한 조성물 및 사용 방법
CN202180056036.XA CN116096741B (zh) 2020-07-10 2021-06-23 用于延长治疗剂在猫科动物中的半衰期的组合物和使用方法
AU2021306179A AU2021306179A1 (en) 2020-07-10 2021-06-23 Compositions for increasing half-life of a therapeutic agent in felines and methods of use
EP21745871.0A EP4178977A1 (en) 2020-07-10 2021-06-23 Compositions for increasing half-life of a therapeutic agent in felines and methods of use
CA3188448A CA3188448A1 (en) 2020-07-10 2021-06-23 Compositions for increasing half-life of a therapeutic agent in felines and methods of use
JP2023501003A JP2023534636A (ja) 2020-07-10 2021-06-23 治療薬のネコにおける半減期を増加させるための組成物及びその使用方法
BR112022027028A BR112022027028A2 (pt) 2020-07-10 2021-06-23 Composições para aumentar a meia-vida de um agente terapêutico em felinos e métodos de uso

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063050535P 2020-07-10 2020-07-10
US63/050,535 2020-07-10
US202163143720P 2021-01-29 2021-01-29
US63/143,720 2021-01-29

Publications (1)

Publication Number Publication Date
WO2022010652A1 true WO2022010652A1 (en) 2022-01-13

Family

ID=77043030

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/038714 Ceased WO2022010652A1 (en) 2020-07-10 2021-06-23 Compositions for increasing half-life of a therapeutic agent in felines and methods of use

Country Status (11)

Country Link
US (4) US11498953B2 (https=)
EP (1) EP4178977A1 (https=)
JP (1) JP2023534636A (https=)
KR (1) KR20230038522A (https=)
CN (2) CN116096741B (https=)
AU (1) AU2021306179A1 (https=)
BR (1) BR112022027028A2 (https=)
CA (1) CA3188448A1 (https=)
MX (1) MX2023000500A (https=)
TW (1) TW202216749A (https=)
WO (1) WO2022010652A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024145280A3 (en) * 2022-12-27 2024-08-08 Invetx, Inc. Polypeptides with altered binding to neonatal fc receptor (fcrn) and methods of use
US12344650B2 (en) 2020-07-10 2025-07-01 Invetx, Inc. Compositions for increasing half-life of a therapeutic agent in felines and methods of use

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10093731B2 (en) 2017-02-24 2018-10-09 Kindred Biosciences, Inc. Anti-IL31 antibodies for veterinary use
US12297272B2 (en) 2017-08-15 2025-05-13 Eianco US inc. IgG Fc variants for veterinary use
CN113544153B (zh) 2019-01-03 2024-12-10 因外泰克斯公司 用于增加治疗剂在犬中的半衰期的组合物及使用方法
CN120590527A (zh) 2020-05-11 2025-09-05 因外泰克斯公司 用于增加治疗剂在犬中的半衰期的组合物和使用方法
JP7796415B2 (ja) * 2020-06-10 2026-01-09 株式会社バイカ・セラピュティクス エリスロポエチンポリペプチドを含む融合タンパク質
EP4255933A4 (en) * 2020-12-07 2025-07-23 Invetx Inc COMPOSITIONS FOR INCREASING THE HALF-LIFE OF A THERAPEUTIC AGENT IN LIVESTOCK ANIMALS AND METHODS OF USE
KR20230121056A (ko) * 2020-12-18 2023-08-17 조에티스 서비시즈 엘엘씨 고양이 항체 불변 영역의 돌연변이
AU2024210302A1 (en) 2023-01-20 2025-09-04 Invetx, Inc. Bispecific binding agents for use in companion animals
EP4662227A1 (en) * 2023-02-08 2025-12-17 Levicept Limited Fusion protein

Citations (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
WO1992015673A1 (en) 1991-03-11 1992-09-17 The University Of Georgia Research Foundation, Inc. Cloning and expression of renilla luciferase
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5292658A (en) 1989-12-29 1994-03-08 University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center Cloning and expressions of Renilla luciferase
WO1995007463A1 (en) 1993-09-10 1995-03-16 The Trustees Of Columbia University In The City Of New York Uses of green fluorescent protein
US5683888A (en) 1989-07-22 1997-11-04 University Of Wales College Of Medicine Modified bioluminescent proteins and their use
WO1998014605A1 (en) 1996-10-04 1998-04-09 Loma Linda University Renilla luciferase and green fluorescent protein fusion genes
US5741668A (en) 1994-02-04 1998-04-21 Rutgers, The State University Of New Jersey Expression of a gene for a modified green-fluorescent protein
WO1998026277A2 (en) 1996-12-12 1998-06-18 Prolume, Ltd. Apparatus and method for detecting and identifying infectious agents
US5777079A (en) 1994-11-10 1998-07-07 The Regents Of The University Of California Modified green fluorescent proteins
US5804387A (en) 1996-02-01 1998-09-08 The Board Of Trustees Of The Leland Stanford Junior University FACS-optimized mutants of the green fluorescent protein (GFP)
US5874304A (en) 1996-01-18 1999-02-23 University Of Florida Research Foundation, Inc. Humanized green fluorescent protein genes and methods
US5876995A (en) 1996-02-06 1999-03-02 Bryan; Bruce Bioluminescent novelty items
US5925558A (en) 1996-07-16 1999-07-20 The Regents Of The University Of California Assays for protein kinases using fluorescent protein substrates
WO1999049019A2 (en) 1998-03-27 1999-09-30 Prolume, Ltd. Luciferases, fluorescent proteins, nucleic acids encoding the luciferases and fluorescent proteins and the use thereof in diagnostics
US20130129727A1 (en) 2011-11-17 2013-05-23 Nanjingjinsirui Science & Technology Biology Corporation Methods and systems for increasing protein stability
WO2018073185A1 (en) * 2016-10-17 2018-04-26 Vetoquinol Sa Modified antibody constant region
WO2019035010A1 (en) 2017-08-15 2019-02-21 Kindred Biosciences, Inc. IGG VARIANTS FOR VETERINARY USE
WO2020082048A1 (en) * 2018-10-18 2020-04-23 Kindred Biosciences, Inc. Fc variants with altered binding to neonatal fc receptor (fcrn) for veterinary use
WO2020116560A1 (ja) * 2018-12-05 2020-06-11 株式会社バイカ・セラピュティクス 抗体のFc領域改変体

Family Cites Families (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7658921B2 (en) 2000-12-12 2010-02-09 Medimmune, Llc Molecules with extended half-lives, compositions and uses thereof
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
AU2005274905B2 (en) * 2004-08-04 2010-12-23 Mentrik Biotech, Llc Variant Fc regions
AU2005285347A1 (en) * 2004-08-19 2006-03-23 Genentech, Inc. Polypeptide variants with altered effector function
US8546543B2 (en) * 2004-11-12 2013-10-01 Xencor, Inc. Fc variants that extend antibody half-life
CN101098890B (zh) * 2004-11-12 2012-07-18 赞科股份有限公司 对FcRn的结合被改变的Fc变体
US8802820B2 (en) * 2004-11-12 2014-08-12 Xencor, Inc. Fc variants with altered binding to FcRn
EP2411050A4 (en) 2009-03-25 2013-07-17 Vet Therapeutics Inc ANTIBODY REGIONS WITH A CONSTANT DOMAIN AND THEIR USE
WO2010117448A2 (en) 2009-04-05 2010-10-14 Provenance Biopharmaceuticals Corp. Chimeric immunocytokines and methods of use thereof
GB2504887B (en) 2011-05-06 2016-02-03 Nvip Pty Ltd Anti-Nerve growth factor antibodies and methods of preparing and using the same
US8790651B2 (en) 2011-07-21 2014-07-29 Zoetis Llc Interleukin-31 monoclonal antibody
US20140294812A1 (en) * 2013-03-15 2014-10-02 Xencor, Inc. Fc variants that improve fcrn binding and/or increase antibody half-life
EP3194429A4 (en) 2014-09-18 2018-06-13 Askgene Pharma, Inc. Novel feline erythropoietin receptor agonists
EP3448427A1 (en) 2016-04-29 2019-03-06 CureVac AG Rna encoding an antibody
EP3481413A4 (en) 2016-07-08 2020-01-08 Askgene Pharma, Inc. FUSION PROTEIN WITH LEPTIN AND METHOD FOR THE PRODUCTION AND USE THEREOF
US10093731B2 (en) 2017-02-24 2018-10-09 Kindred Biosciences, Inc. Anti-IL31 antibodies for veterinary use
BR112020017701A2 (pt) 2018-03-12 2020-12-29 Zoetis Services Llc Anticorpos anti-ngf e métodos dos mesmos
CA3093539A1 (en) 2018-03-16 2019-09-19 Zoetis Services Llc Interleukin-31 monoclonal antibodies for veterinary use
JP2022500037A (ja) 2018-09-14 2022-01-04 キンドレッド バイオサイエンシズ インコーポレイテッド 獣医学的使用のための抗il4受容体抗体
CN120904316A (zh) 2018-12-27 2025-11-07 伊兰科美国公司 兽用IgG Fc变体
CN113544153B (zh) 2019-01-03 2024-12-10 因外泰克斯公司 用于增加治疗剂在犬中的半衰期的组合物及使用方法
WO2021165417A1 (en) 2020-02-19 2021-08-26 Adivo Gmbh Modified fc regions
CN115996949A (zh) 2020-04-17 2023-04-21 硕腾服务有限责任公司 犬抗体变异体
MX2022012793A (es) 2020-04-17 2022-11-07 Zoetis Services Llc Variantes de anticuerpos felinos.
CN120590527A (zh) 2020-05-11 2025-09-05 因外泰克斯公司 用于增加治疗剂在犬中的半衰期的组合物和使用方法
US20220119513A1 (en) 2020-06-08 2022-04-21 Zoetis Services Llc Anti-tgfb antibodies and therapeutic uses thereof
KR20230038522A (ko) 2020-07-10 2023-03-20 인베티엑스 인코포레이티드 고양이에서 치료제의 반감기를 증가시키기 위한 조성물 및 사용 방법
MX2023004020A (es) 2020-10-07 2023-07-07 Zoetis Services Llc Anticuerpos anti-ngf y métodos para su uso.
TWI904261B (zh) 2020-10-19 2025-11-11 美商碩騰服務公司 犬及貓抑瘤素M受體β之抗體及其用途
KR20230121056A (ko) 2020-12-18 2023-08-17 조에티스 서비시즈 엘엘씨 고양이 항체 불변 영역의 돌연변이
CA3238769A1 (en) 2021-11-23 2023-06-01 William Brondyk Anti-ngf antibodies and uses thereof

Patent Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US5683888A (en) 1989-07-22 1997-11-04 University Of Wales College Of Medicine Modified bioluminescent proteins and their use
US5292658A (en) 1989-12-29 1994-03-08 University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center Cloning and expressions of Renilla luciferase
US5418155A (en) 1989-12-29 1995-05-23 University Of Georgia Research Foundation, Inc. Isolated Renilla luciferase and method of use thereof
WO1992015673A1 (en) 1991-03-11 1992-09-17 The University Of Georgia Research Foundation, Inc. Cloning and expression of renilla luciferase
WO1995007463A1 (en) 1993-09-10 1995-03-16 The Trustees Of Columbia University In The City Of New York Uses of green fluorescent protein
US5741668A (en) 1994-02-04 1998-04-21 Rutgers, The State University Of New Jersey Expression of a gene for a modified green-fluorescent protein
US5777079A (en) 1994-11-10 1998-07-07 The Regents Of The University Of California Modified green fluorescent proteins
US5874304A (en) 1996-01-18 1999-02-23 University Of Florida Research Foundation, Inc. Humanized green fluorescent protein genes and methods
US5804387A (en) 1996-02-01 1998-09-08 The Board Of Trustees Of The Leland Stanford Junior University FACS-optimized mutants of the green fluorescent protein (GFP)
US5876995A (en) 1996-02-06 1999-03-02 Bryan; Bruce Bioluminescent novelty items
US5925558A (en) 1996-07-16 1999-07-20 The Regents Of The University Of California Assays for protein kinases using fluorescent protein substrates
WO1998014605A1 (en) 1996-10-04 1998-04-09 Loma Linda University Renilla luciferase and green fluorescent protein fusion genes
WO1998026277A2 (en) 1996-12-12 1998-06-18 Prolume, Ltd. Apparatus and method for detecting and identifying infectious agents
WO1999049019A2 (en) 1998-03-27 1999-09-30 Prolume, Ltd. Luciferases, fluorescent proteins, nucleic acids encoding the luciferases and fluorescent proteins and the use thereof in diagnostics
US20130129727A1 (en) 2011-11-17 2013-05-23 Nanjingjinsirui Science & Technology Biology Corporation Methods and systems for increasing protein stability
WO2018073185A1 (en) * 2016-10-17 2018-04-26 Vetoquinol Sa Modified antibody constant region
WO2019035010A1 (en) 2017-08-15 2019-02-21 Kindred Biosciences, Inc. IGG VARIANTS FOR VETERINARY USE
WO2020082048A1 (en) * 2018-10-18 2020-04-23 Kindred Biosciences, Inc. Fc variants with altered binding to neonatal fc receptor (fcrn) for veterinary use
WO2020116560A1 (ja) * 2018-12-05 2020-06-11 株式会社バイカ・セラピュティクス 抗体のFc領域改変体
EP3892632A1 (en) * 2018-12-05 2021-10-13 Bica Therapeutics Inc. Modified product of fc domain of antibody

Non-Patent Citations (27)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. KF773786
"GENBANK", Database accession no. KF811175.1
"Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary", 1984, MACK PUBLISHING COMPANY
BENIAMINOVITZ ET AL., NEW ENGL. J. MED., vol. 343, 2000, pages 1594 - 1602
BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043
BOOTH ET AL., MABS, vol. 10, no. 7, 2018, pages 1098 - 1110
BORROK ET AL., JBIOL. CHEM., vol. 290, 2015, pages 4282
CHALFIE ET AL., SCIENCE, vol. 263, 1994, pages 802 - 805
DONG ET AL., CLIN PHARMACOKINET, vol. 50, 2011, pages 131
GEARING DP ET AL., J VET INTERN MED, vol. 30, 2016, pages 1129
GENBANK , no. U55762
GHOSH ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 24 - 32
HEIM ET AL., CURR. BIOL., vol. 6, 1996, pages 178 - 182
HOGREFE ET AL., BIOTECHNIQUES, vol. 33, 2002, pages 1158 - 1165
ICHIKI ET AL., J. IMMUNOL., vol. 150, 1993, pages 5408 - 5417
KANAI ET AL., VET. IMMUNOL. IMMUNOPATHOL., vol. 73, 2000, pages 53
KAUFMANSHARP, MOL. BIOL., vol. 159, 1982, pages 601 621
LEI ET AL., J. BACTERIOL., vol. 169, 1987, pages 4379
MILGROM ET AL., NEW ENGL. J. MED., vol. 341, 1999, pages 1966 - 1973
MIZUSHIMA ET AL., NUCLEIC ACIDS RES., vol. 18, 1990, pages 5322
MULLIGAN ET AL., NATURE, vol. 277, 1979, pages 108
NOLAN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2603 - 2607
POWERS ET AL., J IMMUNOL METHODS, vol. 251, 2001, pages 123 - 35
SLAMON ET AL., NEW ENGL. J. MED., vol. 344, 2001, pages 783 - 792
STAUBER, BIOTECHNIQUES, vol. 24, 1998, pages 462 - 471
STRIETZEL ET AL., VET. IMMUNOL. IMMUNOPATHOL., vol. 158, 2014, pages 214 - 223
URLAUBCHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12344650B2 (en) 2020-07-10 2025-07-01 Invetx, Inc. Compositions for increasing half-life of a therapeutic agent in felines and methods of use
WO2024145280A3 (en) * 2022-12-27 2024-08-08 Invetx, Inc. Polypeptides with altered binding to neonatal fc receptor (fcrn) and methods of use

Also Published As

Publication number Publication date
US20230090405A1 (en) 2023-03-23
CA3188448A1 (en) 2022-01-13
US12344650B2 (en) 2025-07-01
US11739135B2 (en) 2023-08-29
MX2023000500A (es) 2023-04-12
US20220009994A1 (en) 2022-01-13
CN119899259A (zh) 2025-04-29
EP4178977A1 (en) 2023-05-17
US20250304650A1 (en) 2025-10-02
US20220259282A1 (en) 2022-08-18
US11498953B2 (en) 2022-11-15
BR112022027028A2 (pt) 2023-03-07
CN116096741A (zh) 2023-05-09
AU2021306179A1 (en) 2023-03-02
KR20230038522A (ko) 2023-03-20
TW202216749A (zh) 2022-05-01
CN116096741B (zh) 2024-10-18
JP2023534636A (ja) 2023-08-10

Similar Documents

Publication Publication Date Title
US20240166749A1 (en) Compositions for increasing half-life of a therapeutic agent in canines and methods of use
US12344650B2 (en) Compositions for increasing half-life of a therapeutic agent in felines and methods of use
US11434276B2 (en) Polypeptides with altered binding to neonatal Fc receptor (FcRn) and methods of use
US20250197478A1 (en) Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use
US20240209062A1 (en) Polypeptides with altered binding to neonatal fc receptor (fcrn) and methods of use
HK40085105B (zh) 用於延长治疗剂在猫科动物中的半衰期的组合物和使用方法
HK40085105A (en) Compositions for increasing half-life of a therapeutic agent in felines and methods of use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21745871

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3188448

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2023501003

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022027028

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20237004652

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021745871

Country of ref document: EP

Effective date: 20230210

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021306179

Country of ref document: AU

Date of ref document: 20210623

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112022027028

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20221229

WWD Wipo information: divisional of initial pct application

Ref document number: 820149

Country of ref document: NZ