WO2021243185A9 - Sars-cov-2 binding agents and uses thereof - Google Patents

Sars-cov-2 binding agents and uses thereof Download PDF

Info

Publication number
WO2021243185A9
WO2021243185A9 PCT/US2021/034810 US2021034810W WO2021243185A9 WO 2021243185 A9 WO2021243185 A9 WO 2021243185A9 US 2021034810 W US2021034810 W US 2021034810W WO 2021243185 A9 WO2021243185 A9 WO 2021243185A9
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
antibody
cdr3
Prior art date
Application number
PCT/US2021/034810
Other languages
French (fr)
Other versions
WO2021243185A2 (en
WO2021243185A3 (en
Inventor
Xiaomin Fan
Original Assignee
Avantgen, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Avantgen, Inc. filed Critical Avantgen, Inc.
Publication of WO2021243185A2 publication Critical patent/WO2021243185A2/en
Publication of WO2021243185A3 publication Critical patent/WO2021243185A3/en
Publication of WO2021243185A9 publication Critical patent/WO2021243185A9/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1002Coronaviridae
    • C07K16/1003Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2 or Covid-19]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein.
  • agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
  • binding agents are useful, including in compositions and in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
  • Coronavirus are positive-sense, single-stranded RNA viruses that have been classified into 4 groups, a, b, yand d coronaviruses. They infect birds and mammals; common human coronaviruses include the b-coronaviruses HCovOC43 and HCoV-HKU1 and the a-coronaviruses HCoV-229E and HCoV-NL63 that cause common colds and more severe lower respiratory tract infections in the very young and the elderly.
  • SARS-CoV-1 SARS-CoV-2
  • SARS-CoV-2 SARS-CoV-2
  • HCoV- NL63 the host receptor is the angiotensin converting enzyme 2 (ACE2) expressed on mucosal epithelia of the lungs and the Gl tract.
  • ACE2 angiotensin converting enzyme 2
  • the spike glycoprotein protomer for SARS-CoV-2 is a 1273 amino acid protein, wherein the S1 domain comprises residues 13 - 685 and the S2 domain comprises residues 686 -1273.
  • SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein.
  • agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
  • Such antibodies may bind to a SARS-CoV-2 spike glycoprotein (e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
  • SARS-CoV-2 spike glycoprotein e.g., homotrimer, protomer
  • RBD receptor binding domain
  • compositions comprising a SARS- CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein.
  • Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
  • the present disclosure also provides methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition with a SARS-CoV-2 binding agent or a composition comprising the SARS-CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein or composition comprising such an agent.
  • Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
  • FIG. 1 illustrates exemplary results from assays for separation of potential inhibitors of receptor binding from non-inhibitors, including from FACS identification of a subset of SARS-CoV-2-RBD positive antibody clones that inhibit ACE2 receptor binding to captured antigen.
  • Left panel unstained yeast cells.
  • Right panel yeast cells after induction of antibody display were stained with biotinylated SARS-CoV-2 RBD and Phycoerythrin (PE)-conjugated streptavidin (P1 gate), followed by incubation with human ACE2-human Fc fusion protein (which had been shown to bind to SARS-CoV-2-RBD with high affinity).
  • PE Phycoerythrin
  • Bound ACE2-human Fc was then detected by Dylight 647 conjugated goat anti-human Fc.
  • Antibody clones that could bind ACE2 in the presence of bound antigen appear double positive (P3 gate).
  • Antibody clones that bind biotinylated SARS-CoV-2 RBD in a manner that prevents binding of ACE2-Fc to antigen are potential inhibitory antibody clones that block the RBD-receptor interaction.
  • FIG. 2 illustrates exemplary results from ELISA screening assays to identify antibody clones that inhibit the interaction of SARS-CoV-2-RBD with ACE2, including from characterization of individual antibody clone Fab-containing culture media.
  • Exemplary results of ELISA competition assays testing the ability of secreted Fab from individual yeast antibody clones to inhibit binding of SARS-CoV-2-RBD to ACE2 coated wells are shown.
  • Secreted Fab in culture medium was used directly for assessing the ability of the Fab to block SARS-CoV-2-RBD binding to ACE2-Fc coated wells and compared with the level of binding in the presence of yeast media alone as the null effect control.
  • FIG. 3 illustrates exemplary results from assays of Fab supernatant binding to 293F cells that were transfected to express a SARS-CoV-2 spike glycoprotein, including from evaluation of the Fab in individual clone culture media to bind to SARS-CoV-2 spike glycoprotein expressed in the 293F cells.
  • 293F cells transiently transfected with a vector encoding full-length spike protein as a green fluorescent protein (GFP) fusion were incubated in the presence of 50 pi of clone culture media, a negative control clone culture media, or plain culture media (for secondary detection staining alone) added to 50 mI DMEM.
  • GFP green fluorescent protein
  • FIGS. 4A-4D illustrates exemplary results from viral neutralization assays.
  • Vero E6 cells were plated in 96-well plates at 20,000 cells per well and assessed for viral induced cytopathic effects 2-4 days after addition of SARS-CoV-2 isolate WA1- F6/2020 equivalent to 100 TCID50.
  • FIG. 4A Phase contrast of uninfected Vero E6 cells, or SARS-CoV-2 infected Vero E6 cells 4 days after infection.
  • FIGS. 4B-4D Phase contrast of uninfected Vero E6 cells, or SARS-CoV-2 infected Vero E6 cells 4 days after infection.
  • FIGS. 4B-4D illustrates exemplary results from viral neutralization assays.
  • the antibody clones were diluted in Complete DMEM and serially diluted 1:3 ranging from 10 pg/ml to 0.00005 pg/ml.
  • the dilutions of antibody were incubated with 100 TCIDso per 50 pL of SARS-CoV-2 for 1 hr and added to the assay plates.
  • the plates were incubated for 4 days at 37°C, 5% CO2 and 95% relative humidity and the inhibitory effects of the antibodies were measured using an MTS colorimetric cell viability method and the IC50 values were determined using Prism software (GraphPad, San Diego CA).
  • FIGS. 5A-5C illustrate the binding properties of Clone B (AvGn-B).
  • FIG. 5A Binding of monomeric biotinylated SARS-CoV-2-RBD at different concentrations to immobilized Clone B (AvGn-B) coated on wells of Immobilon plates.
  • FIG. 5B Binding of ACE-2-Fc and Clone B (AvGn-B) to SARS-COV-2 spike-protein expressing transfected 293 cells versus concentration.
  • FIG. 5C Inhibitory activity versus concentration curve measuring the ability of Clone B (AvGn-B) to block SARS-CoV-2-RBD binding to wells coated with ACE2-Fc. Curve fitting and determination of KD and IC50 values were performed using Prism software.
  • FIGS. 6A and 6B illustrate the effect of dosing Clone B (AvGn-B) on body weight and lung viral load in SARS-CoV-2 infected hamsters.
  • AvGn-B dosing Clone B
  • FIG. 6A Body weight changes post infection. Hamster body weights were recorded daily (0-5 days post-infection [dpi]), and weight loss was defined as percentage loss from 0dpi. Weight loss of infected groups compared to the uninfected control group was analyzed using two-way ANOVA in Prism GraphPad for each day (p ⁇ 0.0001).
  • FIG. 6B Quantification of viral load (gene copy number/reaction) in infected hamster lung was compared between treatment groups (analyzed by Mann-Whitney U Test in Prism GraphPad) (*P ⁇ 0.05).
  • FIGS. 7A and 7B illustrate the effect of Clone B (AvGn-B) on lung histology 5 days post-infection compared with lungs from uninfected hamsters.
  • FIG. 7A H&E stained whole lung lobe section from uninfected control (panel A), infected with no treatment (Untreated, panel B), infected treated with 2.5 mg control lgG1 (panel C), and infected treated with 1 mg Clone B (AvGn-B) (panel D).
  • FIG. 7B Quantification of bronchiointerstitial pneumonia within regions of interest delineated from each lung lobe of each animal. (*P ⁇ 0.05, **P ⁇ 0.01,***P ⁇ 0.001, ****P ⁇ 0.0001).
  • FIG. 8 illustrates the effect of Clone B (AvGn-B) on SARS-CoV-2 viral content of hamsters 5 days post infection (dpi). Staining for the nucleocapsid protein of SARS-CoV-2 in lungs of an infected, untreated (panel A) and control lgG1 treated (2.5 mg/dose) treated (panel C) compared with lungs from infected, clone B (AvGn- B) treated hamsters at 1 mg/dose (panel B) or 2.5 mg/dose (panel D).
  • FIG. 9A and 9B illustrate the effect of Clone B (AvGn-B) on macrophage activity within lungs of hamsters 5 days post infection with SARS-CoV-2 virus compared to uninfected hamsters.
  • FIG. 9A Macrophage content/pm determined using IBA1 staining to identify monocytes and macrophages within lung tissue measured using a scanning digital microscope and cellSens software.
  • FIG. 9B Colocalization of SARS-CoV-2 virus and monocytes/macrophages within the lung of infected hamsters determined using IBA1 staining for monocytes and macrophages and anti-SARS-CoV-2 nucleocapsid protein to stain for virus. (*P ⁇ 0.05,
  • FIGS. 10A and 10B illustrate the comparison of Clone B (AvGn-B) with an exemplary engineered variant.
  • FIG. 10A Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transfected 293 cells versus concentration.
  • FIG. 10A Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transfected 293 cells versus concentration.
  • FIG. 10A Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transf
  • 11 A and 11 B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone G2 (AvGn-B-G2), Clone G4 (AvGn-B-G4), Clone H1 (AvGn-B-H1), Clone H2 (AvGn- B-H2), Clone A1 (AvGn-B-A1), Clone F2 (AvGn-B-F2), and Clone F11 (AvGn-B- F11 ), including consensus sequences for VFI CDR1 , VFI CDR2, VFI CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
  • FIGS. 12A and 12B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone C (AvGn-C), and Clone F (AvGn-F), including sequences for VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
  • SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein.
  • agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
  • Such antibodies may bind to a SARS-CoV-2 spike glycoprotein ⁇ e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
  • binding agents ⁇ e.g., antibodies) are useful in compositions and in methods of treating, preventing, or alleviating a coronavirus-mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
  • the present disclosure provides SARS-CoV-2 binding agents such as agents the bind to a SARS-CoV-2 spike glycoprotein, including agents that are antibodies or antibody fragments, and methods of using SARS-CoV-2 binding agents such as agents that bind to a SARS-CoV-2 spike glycoprotein, in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
  • SARS-CoV-2 binding agents such as agents, including antibodies, that bind to a SARS-CoV-2 spike glycoprotein (e.g., monospecific or multispecific antibodies, including bispecific antibodies) are useful in such methods of treatment, prevention, or alleviation.
  • agents including antibodies
  • SARS-CoV-2 spike glycoprotein e.g., monospecific or multispecific antibodies, including bispecific antibodies
  • binding agents which bind to SARS- CoV-2, including agents (e.g., antibodies) that bind to a SARS-CoV-2 spike glycoprotein (e.g., with an amino acid sequence of SEQ ID NO:31).
  • a SARS-CoV-2 binding agent e.g., antibody
  • a SARS-CoV-2 binding agent may bind to a SARS-CoV-2 spike glycoprotein or portion thereof such as an S1 domain (e.g., with an amino acid sequence of SEQ ID NO:28) or receptor binding domain (e.g., with an amino acid sequence of SEQ ID NO:27).
  • An exemplary amino acid sequence of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 ⁇ see, e.g., amino acids 13-1273).
  • An exemplary amino acid sequence of an S1 domain of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 ⁇ see, e.g., amino acids 13(Ser)-685(Arg)).
  • An exemplary amino acid sequence of a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 ⁇ see.e.g., amino acids 319(Arg)-532(Asn)).
  • SARS-CoV-2 binding agent e.g., antibody
  • SEQ ID NO:3 amino acid sequence that is YYVGWGWFDV
  • An exemplary anti-SARS-CoV-2 antibody is provided herein which comprises a heavy chain variable (VFI) region, for example, comprising a VFI CDR1 , VFI CDR2, and VFI CDR3, and a light chain variable (VL) region, for example, comprising a VL CDR1 ,
  • antibody immunoglobulin
  • immunoglobulin is used interchangeably herein, and is used in the broadest sense and specifically covers, for example polyclonal antibodies, monoclonal antibodies (including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies), antibody compositions with polyepitopic or monoepitopic specificity, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), synthetic antibodies, chimeric antibodies, humanized antibodies, or human versions of antibodies having full length heavy and/or light chains.
  • Antibodies and fragments thereof as disclosed herein include antibodies and fragments thereof that bind to SARS-CoV-2, including, for example, a SARS-CoV-2 spike glycoprotein (e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
  • Antibodies may be neutralizing antibodies.
  • the present disclosure includes antibody fragments (and/or polypeptides that comprise antibody fragments) that retain SARS-CoV-2 binding characteristics.
  • Non-limiting examples of antibody fragments include antigen-binding regions and/or effector regions of the antibody, e.g., F(ab)2, F(ab')2, Fab, Fab', Fd, Fc, and Fv fragments (e.g., fragments consisting of the variable regions of the heavy and light chains that are non-covalently coupled), disulfide-linked Fvs (dsFv), or single-domain antibodies ⁇ e.g., nanobodies).
  • a variable (V) region domain may be any suitable arrangement of immunoglobulin heavy (VH) and/or light (VL) chain variable domains.
  • the present disclosure also includes tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, and an antibody heavy chain monomer.
  • the V region domain may be dimeric and contain VH-VH, VH-VL, or VL-VL dimers that bind SARS CoV-2, including a SARS CoV-2 spike glycoprotein or portion thereof (e.g., S1 domain, receptor binding domain).
  • the VH and VL chains may be covalently coupled either directly or through a linker to form a single chain Fv (scFv).
  • antibody fragments e.g., single-chain antibodies or other binding domains
  • Antibody fragments can exist alone or in combination with one or more of the following: hinge region, CH1, CH2, CH3, or CH4 domains, J chain, or secretory component.
  • Another form of an antibody fragment is a peptide comprising one or more complementarity determining regions (CDRs) of an antibody.
  • CDRs also termed “minimal recognition units” or “hypervariable region” can be obtained by constructing polynucleotides that encode the CDR of interest.
  • Such polynucleotides are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA of antibody-producing cells as a template (see, for example, Larrick et al. , Methods: A Companion to Methods in Enzymology, 2:106 (1991); Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies Production, Engineering and Clinical Application, Ritter et al.
  • Antibody fragments may be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, variable domains of new antigen receptors (v-NAR), and bis-single chain Fv regions (see, e.g., Hollinger and Hudson, Nature Biotechnology, 23(9): 1126-1136, 2005).
  • the binding agent in some embodiments, contains a light chain and/or a heavy chain constant region, such as one or more constant regions, including one or more lgG1, lgG2, lgG3 and/or lgG4 constant regions.
  • antibodies can include epitope-binding fragments of any of the above.
  • the antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., lgG1, lgG2, lgG3, lgG4, lgA1, and lgA2) of immunoglobulin molecule.
  • Antibodies may be neutralizing antibodies.
  • the term "monospecific” antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen.
  • the term “bispecific” means that the antibody is able to specifically bind to at least two distinct antigenic determinants, for example two binding sites each formed by a pair of an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL) binding to different antigens or to different epitopes on the same antigen.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • Such a bispecific antibody may have a 1+1 format.
  • bispecific antibody formats may be 2+1 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding sites for a second antigen or epitope).
  • a bispecific antibody comprises two antigen binding sites, each may bind to a different antigenic determinant.
  • Such a bispecific antibody may bind to two different epitopes on the same antigen (e.g., epitopes on a SARS-CoV-2 spike glycoprotein).
  • nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
  • the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
  • Various algorithms and software that can be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variants thereof.
  • two nucleic acids or polypeptides are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
  • identity exists over a region of the amino acid sequences that is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues in length or any integral value there between.
  • identity exists over a longer region than 60- 80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a target protein or an antibody. In some embodiments, identity exists over a region of the nucleotide sequences that is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases in length or any integral value there between.
  • identity exists over a longer region than 60-80 bases, such as at least about 80-1000 bases or more, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as a nucleotide sequence encoding a protein of interest.
  • a “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a side chain with similar chemical characteristics.
  • Families of amino acid residues having similar side chains have been generally defined in the art, including basic side chains (e.g ., lysine, arginine, histidine), acidic side chains ⁇ e.g., aspartic acid, glutamic acid), uncharged polar side chains ⁇ e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains ⁇ e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains ⁇ e.g., threonine, valine, isoleucine) and aromatic side chains ⁇ e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e.g lysine, arginine, histidine
  • acidic side chains ⁇ e.g
  • polypeptide refers to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can include ⁇ e.g., be interrupted by) non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as linkage to or conjugation with (directly or indirectly) a moiety such as a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids
  • the polypeptides of this disclosure can be based upon antibodies or other members of the immunoglobulin superfamily, in some embodiments, the polypeptides can occur as single chains.
  • an “antigen” is a moiety or molecule that contains an epitope to which an antibody can bind. As such, an antigen is also is bound by an antibody.
  • the antigen, to which an antibody described herein binds is SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein), or a fragment thereof.
  • an “epitope” is a term in the art and refers to a localized region of an antigen to which an antibody can bind.
  • An epitope can be a linear epitope or a conformational, non-linear, or discontinuous, epitope.
  • an epitope can be contiguous amino acids of the polypeptide (a “linear” epitope) or an epitope can comprise amino acids from two or more non-contiguous regions of the polypeptide (a “conformational,” “non-linear” or “discontinuous” epitope), e.g., a SARS-CoV-2 spike glycoprotein.
  • a linear epitope may or may not be dependent on secondary, tertiary, or quaternary structure.
  • an antibody binds to a group of amino acids regardless of whether they are folded in a natural three dimensional protein structure.
  • an antibody requires amino acid residues making up the epitope to exhibit a particular conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
  • the terms “specifically binds,” “specifically recognizes,” “immunospecifically binds,” “selectively binds,” “immunospecifically recognizes” and “immunospecific” are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., epitope) as such binding is understood by one skilled in the art.
  • “specifically binds” means, for instance that a polypeptide or molecule interacts more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including related and unrelated proteins.
  • a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, generally with lower affinity as determined by, e.g., immunoassays, BiacoreTM, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or Bio-Layer Interferometry (BLI) assays, GatorTM instrument (Probe Life, Inc., Palo Alto, CA), or other assays known in the art.
  • immunoassays e.g., immunoassays, BiacoreTM, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or Bio-Layer Interferometry (BLI) assays, GatorTM instrument (Probe Life, Inc., Palo Alto, CA), or other assays known in the art.
  • an antibody or antigen binding domain binds to or specifically binds to an antigen when it binds to an antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
  • RIA radioimmunoassays
  • ELISAs enzyme linked immunosorbent assays
  • a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed.,
  • the extent of binding of an antibody or antigen binding domain to a “non-target” protein is less than about 10% of the binding of the antibody or antigen binding domain to its particular target antigen, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA.
  • FACS fluorescence activated cell sorting
  • molecules that specifically bind to an antigen bind to the antigen with a Ka that is at least 2 logs, 2.5 logs, 3 logs, 4 logs or greater than the Ka when the molecules bind to another antigen.
  • molecules that specifically bind to an antigen do not cross react with other proteins.
  • “specifically binds” means, for instance, that a polypeptide or molecule binds a protein or target with a KD of about 0.1 mM or less, but more usually less than about 1mM. In some embodiments, “specifically binds” means that a polypeptide or molecule binds a target with a KD of at least about 0.1 mM or less, at least about 0.01 mM or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include a polypeptide or molecule that recognizes a protein or target in more than one species.
  • specific binding can include a polypeptide or molecule that recognizes more than one protein or target. It is understood that, in some embodiments, a polypeptide or molecule that specifically binds a first target may or may not specifically bind a second target. As such, “specific binding” does not necessarily require (although it can include) exclusive binding, e.g., binding to a single target. Thus, a polypeptide or molecule can, in some embodiments, specifically bind more than one target. In some embodiments, multiple targets can be bound by the same antigen-binding site on the polypeptide or molecule.
  • an antibody can, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins.
  • an antibody can be bispecific and comprise at least two antigen-binding sites with differing specificities.
  • binding means “specific binding”.
  • the term “constant region” or “constant domain” is a well- known antibody term of art and refers to an antibody portion, e.g., for example, a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor.
  • the term refers to a portion of an immunoglobulin molecule having a generally more conserved amino acid sequence relative to an immunoglobulin variable domain.
  • the term “Fc region” or “Fc domain” is used herein to refer to a portion of a constant region or one or more constant regions.
  • the term “heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino- terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy-terminal portion includes one or more constant regions.
  • the “heavy chain” can refer to any distinct types, e.g., for example, alpha (a), delta (d), epsilon (e), gamma (y) and mu (m), based on the amino acid sequence of the constant domain, which give rise to IgA, IgD, IgE, IgG and IgM classes of antibodies, respectively, including subclasses of IgG, e.g., lgG1, lgG2, lgG3 and lgG4.
  • the term “light chain” when used in reference to an antibody can refer to a polypeptide chain of about 25 kDa, wherein the amino- terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy-terminal portion includes a constant region.
  • the approximate length of a light chain is 211 to 217 amino acids.
  • K kappa
  • l lambda
  • Light chain amino acid sequences are well known in the art.
  • an “isolated” or “purified” antibody or antigen binding fragment is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the antibody or antigen binding fragment is derived, or substantially free of chemical precursors or other chemicals when the antibody or antigen binding fragment is chemically synthesized.
  • secretory component refers to a protein that specifically binds to J-chain-containing antibody, and is related to, derivable from, or identical to an extracellular portion of the polymeric immunoglobulin receptor (plgR), preferably a human plgR.
  • the secretory component confers increased stability to the J-chain containing immunoglobulin.
  • the secretory component can become associated with an antibody (e.g., dimeric or polymeric IgA or pentameric IgM) comprising a J chain.
  • the secretory component may confer increased stability to the J-chain containing antibody.
  • J-chain refers to J-chain polypeptide of about 15kDa of IgM or IgA antibodies of any animal species, including mature human J- chain.
  • the amino acid sequence of mature human J-chain is well known in the art.
  • the J chain sequence may be modified, for example, to comprise a fragment or variant of the J chain native sequence or to comprise a heterologous moiety or peptide.
  • the J chain may be a full-length native J chain, but may also contain amino acid alterations, such as substitutions, insertions, deletions, truncations, including J chain fragments.
  • the J-chain is modified to comprise a heterologous moiety or peptide.
  • the heterologous moiety may be attached directly or indirectly (e.g., through a linker).
  • the J chain may comprise a moiety that is a binding domain. See, e.g., U.S. Patent Nos. 10,400,038 and 9,951 , 134.
  • the J chain may comprise a moiety that confers a desired characteristic to the antibody.
  • the J-chain may comprise a moiety that affects the absorption, distribution, metabolism, or excretion (ADME) characteristics of an antibody. See, e.g., U.S. Patent No. 10,618,978.
  • the heterologous moiety does not affect polymerization of the antibody (e.g., pentamerization of IgM and dimerization of IgA) and binding of the antibody to a target.
  • antigen binding fragment refers to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding fragment, domain, or region its specificity and affinity for the antigen (e.g., the CDRs).
  • Antigen binding fragment as used herein include “antibody fragment,” which comprise a portion of an intact antibody including one or more CDRs, such as the antigen binding or variable region of the intact antibody.
  • antibody fragments include, without limitation, Fab, Fab’, F(ab’)2, and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger et al., Proc Natl Acad Sci 1993, 90:6444-48; Lu et al., J Biol Chem, 2005, 280:19665-72; Hudson et al., Nat Med, 2003, 9:129-34; WO 93/11161; and U.S. Pat. Nos. 5,837,242 and 6,492,123); single-chain antibody molecules (see, e.g., U.S. Pat. Nos.
  • a SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein can bind to a SARS-CoV-2 spike glycoprotein (e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
  • SARS-CoV-2 spike glycoprotein e.g ., homotrimer, protomer
  • RBD receptor binding domain
  • an SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein ⁇ e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
  • a SARS-CoV-2 binding agent includes an antibody, antibody fragment, or other peptide-based molecule.
  • Antibodies provided herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab’) fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-ld) antibodies, and epitope binding fragments of any of the above.
  • synthetic antibodies e.g., monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab’) fragments, disul
  • antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, including molecules that contain one or more antigen binding sites that bind to a SARS-CoV-2 antigen.
  • Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA or IgY), any class, (e.g., lgG1, lgG2, lgG3, lgG4, lgA1 or lgA2), or any subclass (e.g., lgG2a or lgG2b) of immunoglobulin molecule.
  • Antibodies may be neutralizing antibodies.
  • antibodies described herein are IgG antibodies (e.g., human IgG), or a class (e.g., human lgG1 , lgG2, lgG3 or lgG4) or subclass thereof.
  • antibodies described herein are IgA antibodies (e.g., human IgA), or a class (e.g., human lgA1 or lgA2) or subclass thereof.
  • Antibody classes and subclasses including lgG1, lgG2, lgG3, lgG4, lgA1, lgA2, are well known in the art and are known to confer functional specialization. Modified versions of each of these classes and subclasses may be prepared by those skilled in the art.
  • antibodies are hybrid antibodies with properties of more than one class or subclass of antibody. Methods for making hybrid antibodies (e.g., IgA/lgG and IgM/lgG) are known in the art.
  • Antibodies include those of all isotypes, sub- classes and forms, including their fragments, for example, SARS-CoV-2 binding fragments.
  • An antibody can include a J-chain and/or a secretory component.
  • Antibodies may be modified to include sequences from other isotypes, such as IgG to produce chimeric antibodies.
  • An antibody encompasses anything ranging from a small binding fragment of an antibody to a full sized antibody, including a multimeric antibody, for example, an IgA antibody that includes four complete heavy chains and four complete light chains and optionally includes a J chain and/or a secretory component, or an IgM antibody that includes ten or twelve complete heavy chains and ten or twelve complete light chains and, optionally, includes a J-chain and/or a secretory component.
  • an antibody is a 4-chain antibody unit comprising two heavy (H) chain / light (L) chain pairs, wherein the amino acid sequences of the H chains are identical and the amino acid sequences of the L chains are identical.
  • the H and L chains comprise constant regions, for example, human constant regions.
  • the L chain constant region of such antibodies is a kappa or lambda light chain constant region, for example, a human kappa or lambda light chain constant region.
  • the H chain constant region of such antibodies comprise a gamma heavy chain constant region, for example, a human gamma heavy chain constant region.
  • such antibodies comprise IgG constant regions, for example, human IgG constant regions ( e.g lgG1, lgG2, lgG3, and/or lgG4 constant regions).
  • An antibody or fragment thereof may preferentially bind to SARS-CoV-2 meaning that the antibody or fragment thereof binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein and/or binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein.
  • the antibody or fragment thereof may specifically recognize and bind a SARS-CoV-2 spike glycoprotein or a portion thereof. “Specific binding” means that the antibody or fragment thereof binds to SARS-CoV-2 with an affinity that is at least 5, 10, 15, 20, 25, 50, 100, 250, 500, 1000, or 10,000 times greater than the affinity for an unrelated control protein (e.g., hen egg white lysozyme).
  • the antibody or fragment thereof may bind SARS-CoV-2 substantially exclusively (e.g., is able to distinguish SARS-CoV-2 from other known polypeptides such other SARS-CoV-2, for example, by virtue of measurable differences in binding affinity).
  • the term “hypervariable region”, “HVR”, or “HV”, when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3). A number of hypervariable region delineations are in use and are encompassed herein.
  • CDRs The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (see, e.g., Kabat etal., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)).
  • the end of the Chothia CDR- H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag).
  • the “contact” hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions or CDRs are noted below.
  • IMGT ImMunoGeneTics
  • Information System ®
  • IG immunoglobulins
  • TR T cell receptors
  • MHC major histocompatibility complex
  • CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain.
  • Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 or 26-35A (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
  • a SARS-CoV-2 binding agent e.g ., antibody
  • an agent ⁇ e.g., antibody that binds to a SARS-CoV-2 spike glycoprotein, comprises a VH region which comprises VH CDR1 , VH CDR2, and/or VH CDR3, and a VL region which comprises VL CDR1 , VL CDR2, and/or VL CDR3 of any one of the binding agents described herein (see, e.g., Tables 1-8).
  • a SARS-CoV-2 binding agent e.g., antibody
  • an agent e.g., antibody
  • the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • the SARS-CoV-2 binding agent e.g., antibody
  • the SARS-CoV-2 binding agent provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8.
  • the SARS-CoV-2 binding agent (e.g., antibody) provided herein is bispecific and comprises a first binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8 and a second binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from another antibody, including, for example, another antibody that binds to SARS-CoV-2 and/or SARS-CoV-1.
  • Table 1 Antibody Clone B (AvGn-B)
  • SARS-CoV-2 binding agents e.g ., antibodies
  • SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VH region or VH domain.
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VL region or VL chain.
  • SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein have a combination of (i) a VH domain or VH region and (ii) a VL domain or VL region.
  • the CDRs disclosed herein include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-8).
  • a “consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and/or variable amino acids that vary within a given amino acid sequence.
  • the CDR consensus sequences provided include CDRs corresponding to VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2 and/or VL CDR3.
  • Consensus sequences of CDRs of SARS-CoV-2 binding agents including an agent that binds to a SARS-CoV-2 spike glycoprotein, are shown in FIGS. 11A and 11 B.
  • a SARS-CoV-2 binding agent e.g., antibody
  • a SARS-CoV-2 binding agent e.g., antibody
  • VH heavy chain variable
  • VL light chain variable
  • the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is
  • a SARS-CoV-2 binding agent e.g ., antibody
  • a SARS-CoV-2 binding agent e.g ., antibody
  • a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • VH heavy chain variable
  • a SARS-CoV-2 binding agent ⁇ e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
  • VL light chain variable
  • a SARS- CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
  • the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
  • the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid.
  • the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • the VL CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid.
  • the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of Xi AX2SRAT (SEQ ID NO: 111) wherein Xi and X2 are each independently a naturally occurring amino acid.
  • the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
  • a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X 2 A, I, L orV, and X3 is Q or R; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA
  • a SARS-CoV-2 binding agent e.g., antibody
  • a SARS-CoV-2 binding agent e.g., antibody
  • a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X 2 A, I, L orV, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • VH heavy chain variable
  • a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:115) wherein Xi is S, G or D; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S orT; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
  • VL light chain variable
  • a SARS-CoV-2 binding agent e.g ., antibody
  • a SARS-CoV-2 binding agent e.g ., antibody
  • a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VFI CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X 2 A, I, L orV, and X3 is Q or R; and (3) a VFI CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX
  • the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H.
  • the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R.
  • the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • the VL CDR1 of a SARS- CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D.
  • the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T.
  • the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Tables 1-8.
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, provided herein comprise a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • SARS-CoV-2 binding agents e.g ., antibodies, including bispecific antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein provided herein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8.
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies, including bispecific antibodies
  • agents that bind to a SARS- CoV-2 spike glycoprotein provided herein comprise one or more CDRs, including six CDRs, VL CDRs listed in Tables 1-8.
  • SARS-CoV-2 binding agents e.g., antibodies, including bispecific antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8 and one or more CDRs, including six VL CDRs listed in Tables 1-8.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
  • CDRs complementarity determining regions
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58- 64, 66-75, 78-82, 85-96 and 99-105.
  • CDRs complementarity determining regions
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32- 48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
  • CDRs complementarity determining regions
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises four or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
  • CDRs complementarity determining regions
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises five or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
  • CDRs complementarity determining regions
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises six or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
  • CDRs complementarity determining regions
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS- CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS- CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18; and/or (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable region (VL) comprising
  • VH CDR1 VH complementarity determining region 1
  • VH CDR2 VH complementarity determining region 2
  • VH CDR3 VH complementarity
  • VL CDR1 VL complementarity determining region 1
  • VL CDR2 VL complementarity determining region 2
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • a heavy chain variable region comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:1, 7, 12, 13, and 18; (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and (b) a light chain variable region (VL) comprising (i) a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16,
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO: 11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent (. e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable region
  • VL light chain variable region
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and/or a VL comprising an amino acid sequence of SEQ ID NO:26.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and a VL comprising an amino acid sequence of SEQ ID NO:26.
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35,
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35, 36, 39, 40, 42, 43, 45, 46, and 47.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 32, 37, and 41.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 33, 38, 44, and 48.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:34, 39, 42, and 45.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:36, 43, and 47.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VH CDR1 having an amino
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino amino acid sequence selected from the group consisting of S
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and/or a VL comprising an amino acid sequence of SEQ ID NO:50.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and a VL comprising an amino acid sequence of SEQ ID NO:50.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 38, 44, 48, and 51.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VH CDR1 having an amino
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 38,
  • VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20
  • VL light chain variable region
  • a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55
  • a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46
  • a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and/or a VL comprising an amino acid sequence of SEQ ID NO:57.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and a VL comprising an amino acid sequence of SEQ ID NO:57.
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 58, 60, and 62.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 59, 61, 63, and 64.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and/or a VL comprising an amino acid sequence of SEQ ID NO:57.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and a VL comprising an amino acid sequence of SEQ ID NO:57.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53,
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53, 54, 55, 67, 68, 70, 71, 73, and 74.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:67, 70, and 73.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a selected from a group consisting group consisting of SEQ ID NO:68, 71, and 74.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or (3)
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 66,
  • VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71 , and 74.
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and/or a VL comprising an amino acid sequence of SEQ ID NO:77.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and a VL comprising an amino acid sequence of SEQ ID NO:77.
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21, 23, 35, 40, and 46.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21 , 23, 35, 40, and 46.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:78, 79, 80, 81 , and 82.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15 and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and/or a VL comprising an amino acid sequence of SEQ ID NO:84.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and a VL comprising an amino acid sequence of SEQ ID NO:84.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:85, 88, 91 , 92, and 93.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • VH CDR2 VH complementarity determining region 2
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:87, 90, and 95.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and (3)
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and/or a VL comprising an amino acid sequence of SEQ ID NO:98.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and a VL comprising an amino acid sequence of SEQ ID NO:98.
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 14, 99, 101, 103, and 105.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
  • VH CDR3 VH complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 100, 102, and 104.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 99, 101 , 103, and 105; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL C
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 101 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and/or a VL comprising an amino acid sequence of SEQ ID NO: 107.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and a VL comprising an amino acid sequence of SEQ ID NO: 107.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:118, 119, 120, 124, 125, 126, 129, 130, 131 , 132, 135, 136, 137, and 141.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 118, 119, 120, 124, 125, 126, 129, 130, 131, 132, 135, 136, 137, and 141 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 118, 124, 129, 130, and 135.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • VH CDR2 VH complementarity determining region 2
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:120, 126, 132, and 137.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 121, 127, 133, and 138.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 122, 128, and 139.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 123, 134, and 140.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:119, 125, 131, 136, and 141; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; and/or (2) a VL CDR2 having an amino acid sequence selected from the group
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 126; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 130; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 135; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 137; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131 , 136, and 141 ; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and/or a VL comprising an amino acid sequence of SEQ ID NO: 143.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and a VL comprising an amino acid sequence of SEQ ID NO: 143.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165.
  • VL light chain variable region
  • CDRs VL complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165.
  • VH heavy chain variable region
  • CDRs VH complementarity determining regions
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 144, 150, 154, 155, and 160.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 145, 151 , 156, 161 , and 166.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 146, 152, 157, and 162.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 147, 153, 158, and 163.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:90, 148, and 164.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 149, 159, and 165.
  • VL CDR3 VL complementarity determining region 3
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or (2) a VL CDR2 having an amino acid sequence
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 150; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 151 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 157; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 160; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 162; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
  • VH heavy chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of S
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 159.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
  • VH heavy chain variable
  • VL light chain variable
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and/or a VL comprising an amino acid sequence of SEQ ID NO: 168.
  • the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and a VL comprising an amino acid sequence of SEQ ID NO:168.
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO:167 and the light chain variable region having an amino acid sequence of SEQ ID NO: 168.
  • the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/
  • VH CDR3 as set forth in SEQ ID NO: 143; or (x) a VH CDR1 , a VH CDR2, and a VH
  • VL CDR3 as set forth in SEQ ID NO: 167, and/or a VL CDR1 , a VL CDR2, and a VL
  • the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR
  • the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143.
  • the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
  • the SARS-CoV-2 binding agent comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies
  • SARS-CoV-2 binding agents are provided that compete with one of the exemplified SARS-CoV-2 binding agents ⁇ e.g., antibodies) disclosed herein.
  • Such binding agents may also bind to the same or essentially the same epitope as one of the herein exemplified SARS-CoV-2 binding agents ⁇ e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, or an overlapping epitope.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents include those with the VH and VL regions, and CDRs provided herein (see, e.g., Tables 1-8).
  • the SARS-CoV-2 binding agents ⁇ e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, that are provided include those that compete with an antibody comprising: (a) 1, 2, 3, 4, 5 or all 6 of the VH and VL CDRs identified in Tables 1-8; (b) a VH and a VL identified in Tables 1-8; or (c) two light chains each comprising a VL and two heavy chains each comprising a VH, including the VL and VH identified in Tables 1-8.
  • an antibody comprising: (a) 1, 2, 3, 4, 5 or all 6 of the VH and VL CDRs identified in Tables 1-8; (b) a VH and a VL identified in Tables 1-8; or (c) two light chains each comprising a VL and two heavy chains each comprising a VH, including the VL and VH identified in Tables 1-8.
  • the CDRs of an SARS-CoV-2 binding agent e.g., an antibody
  • an agent that binds to a SARS-CoV-2 spike glycoprotein can be determined according to the Kabat system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • the CDRs of an SARS-CoV-2 binding agent can be determined according to the Chothia system, which will be referred to herein as the “Chothia CDRs” (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al- Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1): 175-82; and U.S.
  • the CDRs of an SARS-CoV-2 binding agent can be determined according to the ImMunoGeneTics (IMGT) system, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7:132-136 and Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212 (“IMGT CDRs”).
  • IMGT ImMunoGeneTics
  • the CDRs of an SARS-CoV-2 binding agent can be determined according to the AbM system, which will be referred to herein as the “AbM CDRs,” for example as described in MacCallum et al., 1996, J. Mol. Biol., 262:732-745. See also, e.g., Martin, A., “Protein Sequence and Structure Analysis of Antibody Variable Domains,” in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001).
  • the CDRs of an SARS-CoV-2 binding agent can be determined according to the Contact system, which will be referred to herein as the “Contact CDRs” (see, e.g., MacCallum RM et al. , 1996, J Mol Biol 5: 732-745).
  • the Contact CDRs are based on an analysis of the available complex crystal structures.
  • the position of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1 , CDR2, or CDR3) region of a SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary by one, two, three, four, five, or six amino acid positions so long as binding to SARS-CoV-2 (e.g., a SARS- CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • the position defining a CDR as identified in Tables 1-8 may vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the current CDR position, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • SARS-CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
  • the length of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • SARS-CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
  • a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99- 105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • SARS-CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
  • the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78- 82, 85-96 and 99-105, so long as binding to SARS-CoV-2 (e.g ., a SARS-CoV-2 spike glycoprotein) is maintained ⁇ e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • SARS-CoV-2 e.g ., a SARS-CoV-2 spike glycoprotein
  • the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51- 55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained ⁇ e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained ⁇ e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
  • any method known in the art can be used to ascertain whether binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained, for example, the binding assays and conditions described in the Examples provided herein.
  • Examples 1 and 2 provided herein describe assays for measuring binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein).
  • the SARS-CoV-2 binding agents e.g., antibodies
  • an agent that binds to a SARS-CoV-2 spike glycoprotein presented herein that bind to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein
  • conservative sequence modifications include conservative amino acid substitutions that include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta-branched side chains ⁇ e.g., threonine, valine, isoleucine
  • aromatic side chains ⁇ e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • a predicted nonessential amino acid residue is replaced with another amino acid residue from the same side chain family.
  • Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art ⁇ see, e.g., Brummell et al. , Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
  • the conservative sequence modifications described herein modify the amino acid sequences of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, by 50%, or 55%, or 60%, or 65%, or 70%, or 75%, or 80%, or 85%, or 90%, or 95%, or 98%, or 99%.
  • the nucleotide and amino acid sequence modifications refer to at most 1 , 2, 3, 4, 5, or 6 amino acid substitutions to the CDRs described in Tables 1-8.
  • each such CDR may contain up to 5 conservative amino acid substitutions, for example up to (not more than) 4 conservative amino acid substitutions, for example up to (not more than) 3 conservative amino acid substitutions, for example up to (not more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution.
  • the present disclosure also provides conjugates, including immunoconjugates comprising any one of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD), of the present disclosure, including those directly or indirectly linked another agent.
  • SARS-CoV-2 binding agents e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD
  • SARS-CoV-2 binding agents e.g ., antibodies
  • SARS-CoV-2 spike glycoprotein or a fragment thereof ⁇ e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD
  • SARS-CoV-2-S1, SARS-CoV- 2-RBD may be covalently bound by a synthetic linker to one or more agents.
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein, described herein which bind to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein may be linked or conjugated (directly or indirectly) to a polypeptide.
  • an SARS-CoV-2 binding agent e.g., antibody
  • an agent that binds to a SARS-CoV-2 spike glycoprotein is linked or conjugated (directly or indirectly) to an agent.
  • SARS-CoV-2 binding agents e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein provided herein are conjugated or recombinantly linked (directly or indirectly) to a therapeutic agent or to a diagnostic or detectable agent.
  • the conjugated or recombinantly linked antibodies can be useful, for example, for treating or preventing a disease or disorder such as an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
  • conjugated or recombinantly linked SARS-CoV-2 binding agents can be useful, for example, for monitoring or prognosing the onset, development, progression, and/or severity of an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
  • Such diagnosis and detection can be accomplished, for example, by coupling the SARS-CoV-2 binding agent (e.g., an antibody) to detectable substances including, for example: enzymes, including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, including, but not limited to, streptavidin/biotin or avidin/biotin; fluorescent materials, including, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; luminescent materials, including, but not limited to, luminol; bioluminescent materials, including, but not limited to, luciferase, luciferin, or aequorin; chemiluminescent material, including, but not limited
  • SARS-CoV-2 binding agents e.g ., antibodies
  • SARS-CoV-2 binding agents e.g ., antibodies
  • a heterologous protein or polypeptide or fragment thereof, for example, to a polypeptide ⁇ e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids
  • a polypeptide ⁇ e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids
  • fusion proteins comprising an antigen-binding fragment of SARS-CoV-2 binding agents (e.g., an antibody), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein (e.g., comprising CDR1 , CDR2, and/or CDR3 of VH and/or VL) and a heterologous protein, polypeptide, or peptide.
  • SARS-CoV-2 binding agent e.g., an antibody
  • the heterologous protein, polypeptide, or peptide that the SARS-CoV-2 binding agent e.g., antibody
  • SARS-CoV-2 binding agents e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein can be linked (directly or indirectly) to marker or “tag” sequences, such as a peptide, to facilitate purification.
  • the marker or tag amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (see, e.g., QIAGEN, Inc.), among others, many of which are commercially available. For example, as described in Gentz et al., 1989, Proc. Natl. Acad. Sci.
  • hexa-histidine provides for convenient purification of a fusion protein.
  • Other peptide tags useful for purification include, but are not limited to, the hemagglutinin (‘ ⁇ A”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767-78), and the “FLAG” tag.
  • Fusion proteins may be generated, for example, through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”).
  • DNA shuffling may be employed to alter the activities of the SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, as provided herein, including, for example, SARS-CoV-2 binding agents with higher affinities and lower dissociation rates (see, e.g., U.S. Pat. Nos.
  • SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination.
  • One or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., antibody) provided herein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
  • SARS-CoV-2 binding agents e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein provided herein can also be linked or conjugated (directly or indirectly) to a second antibody to form an antibody heteroconjugate (see, e.g., U.S. Pat. No. 4,676,980).
  • SARS-CoV-2 binding agents e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein provided herein may also be attached to solid supports, which are useful for immunoassays or purification of the target antigen.
  • solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene.
  • the linker may be a “cleavable linker” facilitating release of the linked or conjugated agent in a cell, but non-cleavable linkers are also contemplated herein.
  • Linkers for use in conjugates of the present disclosure include, without limitation, acid labile linkers (e.g., hydrazone linkers), disulfide-containing linkers, peptidase- sensitive linkers (e.g., peptide linkers comprising amino acids, for example, valine and/or citrulline such as citrulline-valine or phenylalanine-lysine), photolabile linkers, dimethyl linkers (see, e.g., Chari etai, 1992, Cancer Res.
  • Conjugates of an antibody and agent may be made using a variety of bifunctional protein coupling agents such as BMPS, EMCS, GMBS, HBVS, LC- SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo- GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate).
  • conjugates of antibodies and agents may be prepared using any suitable methods as disclosed in the art (see, e.g., Bioconjugate Techniques (Hermanson ed., 2d ed. 2008)).
  • selenocysteine is cotranslationally inserted into an antibody sequence by recoding the stop codon UGA from termination to selenocysteine insertion, allowing site specific covalent conjugation at the nucleophilic selenol group of selenocysteine in the presence of the other natural amino acids (see, e.g., Hofer etai, 2008, Proc. Natl. Acad. Sci. USA 105:12451-56; and Hofer et a/., 2009, Biochemistry 48(50): 12047-57).
  • SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein may be monospecific, bispecific, trispecific or of greater multispecificity.
  • agents may include antibodies.
  • Multispecific antibodies such as bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens (e.g., SARS-CoV-2 and SARS-CoV-1) or two different epitopes on the same antigen (e.g., a SARS-CoV-2 spike glycoprotein).
  • the multispecific antibodies can be constructed based on the sequences of the antibodies provided herein, e.g., the CDR sequences listed in Tables 1-8.
  • the multispecific antibodies provided herein are bispecific antibodies.
  • bispecific antibodies are mouse, chimeric, human or humanized antibodies.
  • multispecific antibody molecules can comprise more than one antigen-binding site, in which different sites are specific for different antigens.
  • multispecific antibody molecules can bind more than one (e.g ., two or more) epitopes on the same antigen.
  • one of the binding specificities is for SARS-CoV-2 and the other is for any other antigen ⁇ e.g., SARS-CoV-1).
  • Bispecific antibodies can be prepared in various antibody formats, including as full length antibodies or antibody fragments ⁇ e.g., F(ab’)2 bispecific antibodies).
  • Multispecific antibodies Methods for making multispecific antibodies are known in the art, such as, by co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (see, e.g., Milstein and Cuello, 1983, Nature 305:537-40).
  • multispecific antibodies e.g., bispecific antibodies
  • Bispecific Antibodies Kontermann ed., 2011 .
  • bispecific antibody molecules can be classified into different structural groups: (i) bispecific immunoglobulin G (BslgG); (ii) IgG appended with an additional antigen-binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates.
  • BslgG formats can include crossMab, DAF (two-in-one), DAF (four-in-one),
  • BslgG comprises heavy chains that are engineered for heterodimerization.
  • heavy chains can be engineered for heterodimerization using a "knobs-into-holes" strategy, a SEED platform, a common heavy chain (e.g., in kl-bodies), and use of heterodimeric Fc regions.
  • Strategies are known in the art to avoid heavy chain pairing of homodimers in BslgG, including knobs-into-holes, duobody, azymetric, charge pair, FIA-TF, SEEDbody, and differential protein A affinity.
  • bispecific antibody format is IgG appended with an additional antigen-binding moiety.
  • monospecific IgG can be engineered to have bispecificity by appending an additional antigen-binding unit onto the monospecific IgG, e.g., at the N- or C- terminus of either the heavy or light chain.
  • additional antigen-binding units include single domain antibodies ⁇ e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable domains ⁇ e.g., single chain variable fragments or variable fragments).
  • Non-limiting examples of appended IgG formats include dual variable domain IgG (DVD-lg), lgG(H)-scFv, scFv-(H)lgG, lgG(L)-scFv, scFv-(L)lgG, lgG(L,H)-Fv, lgG(H)-V, V(H)-lgG, lgG(L)-V, V(L)-lgG, KIH IgG-scFab, 2scFv-lgG, lgG-2scFv, scFv4-lg, zybody, and DVI-lgG (four- in-one). See, Spiess et al. Mol. Immunol. 67(2015):95-106.
  • Bispecific antibody fragments are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region.
  • bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell.
  • bispecific antibody fragments include, but are not limited to, nanobody, nanobody- FIAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CFI3, Diabody-CFI3, triple body, miniantibody, minibody, TriBi minibody, scFv-CFI3 KIH, Fab-scFv, scFv- CH-CL-scFv, F(ab')2, F(ab')2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody.
  • Bispecific fusion proteins include antibody fragments linked to other proteins.
  • bispecific fusion proteins can be linked to other proteins to add additional specificity and/or functionality.
  • the dock-and- lock (DNL) method can be used to generate bispecific antibody molecules with higher valency.
  • bispecific antibody fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments.
  • chemical conjugation for example, chemical conjugation of antibodies and/or antibody fragments, can be used to create BsAb molecules.
  • An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof. In embodiments, the conjugation improves the serum half-life.
  • multispecific antibodies including bispecific antibodies
  • multispecific antibodies, including bispecific antibodies can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly or by expression of the component antibodies in a single host cell.
  • Purification of multispecific antibody molecules can be performed by various methods known in the art, such as affinity chromatography.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents e.g., antibodies
  • a multispecific ⁇ e.g., bispecific antibody disclosed herein comprises an SARS-CoV-2 binding agent and a second binding agent, wherein the SARS-CoV-2 binding agent (e.g., antibody) comprises a VL and/or VH amino acid sequence of Tables 1 -8.
  • a bispecific antibody disclosed herein comprises an SARS-CoV-2 binding agent that comprises a VL and/or VH amino acid sequence of Tables 1-8 and further comprises a VL and/or VH amino acid sequence of another antibody.
  • a bispecific antibody which binds to SARS -CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) that comprises VL and VH CDRs (e.g., VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3), wherein at least one VH CDR3 of the bispecific antibody comprises the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • SARS -CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
  • VL and VH CDRs e.g., VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 1 (SEQ ID NOS:1, 2, 3, 4, 5 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:7, 8, 9, 10, 11 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:12, 2, 3, 4, 5, and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 13, 14, 15, 16,
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 18, 19, 20, 21, 22 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 1 , 24, 3, 4, 5 and/or 6).
  • a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 2 (SEQ ID NOS:32, 33, 3, 34, 35 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:37, 38, 9, 39, 40 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:12, 33, 3, 34, 35 and/or 36).
  • provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:41 , 14, 15, 42, 40 and/or 43). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS: 18, 44, 20, 45, 46 and/or 47). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:32, 48, 3, 34, 35 and/or 36).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 3 (SEQ ID NOS:1 , 51 , 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:7, 38, 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:12, 51, 3, 52, 35 and/or 6).
  • provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 13, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 18, 44, 20, 55, 46 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:1 , 48, 3, 52, 35 and/or 6).
  • a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 4 (SEQ ID NOS:58, 59, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:60, 61 , 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:12, 59, 3, 52, 35 and/or 6).
  • provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:62, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS: 18, 63, 20, 55, 46, and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:58, 64, 3, 52, 35 and/or 6).
  • a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 5 (SEQ ID NOS:1 , 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:7, 69, 9, 53, 70 and/or 68).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:12, 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS: 13, 14, 15, 54, 70 and/or 71). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:18, 72, 20, 55, 73 and/or 74).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:1 , 75, 3, 52, 67 and/or 68). [00277] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 6 (SEQ ID NOS:78, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:79, 69, 9, 10, 40 and/or 6).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:80, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:81 , 14, 15, 16, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:82, 72, 20, 21 , 46 and/or 23).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:78, 75, 3, 4, 35 and/or 6). [00278] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 7 (SEQ ID NOS:85, 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:88, 89, 9, 53, 90 and/or 6).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:91 , 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:92, 14, 15, 54, 90 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:93, 94, 20, 55, 95 and/or 23).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:85, 96, 3, 52, 87 and/or 6). [00279] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 8 (SEQ ID NOS:1, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS:7, 101, 9, 10, 40 and/or 100).
  • provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 12, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 13, 14, 15, 16, 40 and/or 102). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 18, 103, 20, 21 , 46 and/or 104). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 1 , 105, 3, 4, 35 and/or 100).
  • Antibodies that bind SARS-CoV-2 including antibodies that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be obtained by any suitable method, such as (but not limited to) immunization with whole cells expressing a SARS-CoV-2 spike glycoprotein or a fragment thereof and collection of antibodies, recombinant techniques, or screening libraries of antibodies or antibody fragments using a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD).
  • a SARS-CoV-2 spike glycoprotein or a fragment thereof e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD
  • Monoclonal antibodies may be generated using a variety of known techniques (see, for example, Coligan et al. (eds.), Current Protocols in Immunology, 1:2.5.12.6.7 (John Wiley & Sons 1991); Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol (eds.) (1980); Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press (1988); and Picksley et al., “Production of monoclonal antibodies against proteins expressed in E. coli," in DNA Cloning 2: Expression Systems, 2nd Edition, Glover et al.
  • One exemplary technique for generating monoclonal antibodies comprises immunizing an animal with a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) and generating a hybridoma from spleen cells taken from the animal.
  • a hybridoma may produce a monoclonal antibody or antibody fragment that binds SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD).
  • human antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof may be generated by any of a number of techniques including, but not limited to, Epstein Barr Virus (EBV) transformation of human peripheral blood cells (e.g ., containing B lymphocytes), in vitro immunization of human B cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein.
  • EBV Epstein Barr Virus
  • human antibodies that bind SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof may be obtained from transgenic animals that have been engineered to produce specific human antibodies in response to antigenic challenge.
  • SARS-CoV-2-S1, SARS-CoV- 2-RBD a SARS-CoV-2 spike glycoprotein or a fragment thereof
  • transgenic animals having a human Ig locus, wherein the animals do not produce functional endogenous immunoglobulins due to the inactivation of endogenous heavy and light chain loci.
  • Transgenic non-primate mammalian hosts capable of mounting an immune response to an immunogen, wherein the antibodies have primate constant and/or variable regions, and wherein the endogenous immunoglobulin encoding loci are substituted or inactivated, also have been described.
  • International Patent Publication No. WO 96/30498 discloses the use of the Cre/Lox system to modify the immunoglobulin locus in a mammal, such as to replace all or a portion of the constant or variable region to form a modified antibody molecule.
  • WO 94/02602 discloses non-human mammalian hosts having inactivated endogenous Ig loci and functional human Ig loci.
  • U.S. Patent No. 5,939,598 discloses methods of making transgenic mice in which the mice lack endogenous heavy chains, and express an exogenous immunoglobulin locus comprising one or more xenogeneic constant regions.
  • an immune response can be produced to a selected antigenic molecule, and antibody producing cells can be removed from the animal and used to produce hybridomas that secrete human-derived monoclonal antibodies.
  • Immunization protocols, adjuvants, and the like are known in the art, and are used in immunization of, for example, a transgenic mouse as described in International Patent Publication No. WO 96/33735.
  • the monoclonal antibodies can be tested for the ability to inhibit or neutralize the biological activity or physiological effect of the corresponding protein.
  • Humanized antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof may be produced using techniques known to those skilled in the art (Zhang et al., Molecular Immunology, 42(12): 1445-1451, 2005; Hwang et al., Methods, 36(1): 35- 42, 2005; Dall'Acqua et al., Methods, 36(1): 43-60, 2005; Clark, Immunology Today, 21(8): 397-402, 2000, and U.S. Patent Nos. 6,180,370; 6,054,927; 5,869,619; 5,861,155; 5,712,120; and 4,816,567.
  • an isolated cell e.g., a hybridoma
  • an SARS-CoV-2 binding agent e.g., antibody or antibody fragment
  • a cell e.g., an isolated cell
  • one or more polynucleotides comprising one or more nucleic acid sequences encoding a SARS-CoV-2 binding agent (e.g., antibody or antibody fragment) may be generated.
  • the one or more polynucleotides are isolated and/or recombinant polynucleotides.
  • the one or more isolated polynucleotides comprise one or more nucleotide sequences that encode an antibody heavy chain variable region (VH) and/or an antibody light chain variable region (VL), wherein the VH and the VL comprise complementarity determining regions (CDRs) as shown in Tables 1-8.
  • one or more vectors may comprise one or more polynucleotides for expression of one or more polynucleotides in a suitable host cell.
  • Such vectors are useful, e.g., for amplifying the polynucleotides in host cells to create useful quantities thereof, and for expressing binding agents, such as antibodies or antibody fragments, using recombinant techniques.
  • Vectors also are useful in “gene therapy” treatment regimens, wherein, for example, one or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., an antibody, including a multispecific antibody such as a bispecific antibody), is introduced into a subject suffering from or at risk of suffering from a SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
  • a SARS-CoV-2 binding agent e.g., an antibody, including a multispecific antibody such as a bispecific antibody
  • one or more vectors are expression vectors wherein one or more polynucleotides are operatively linked to one or more polynucleotides comprising expression control sequences.
  • Autonomously replicating recombinant expression constructs such as plasmid and viral DNA vectors incorporating one or more polynucleotides encoding antibody sequences that bind SARS-CoV-2 are specifically contemplated.
  • Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression construct is to be utilized. Promoter and enhancer sequences are generally selected for the ability to increase gene expression, while operator sequences are generally selected for the ability to regulate gene expression.
  • Expression constructs may also include sequences encoding one or more selectable markers that permit identification of host cells bearing the construct. Expression constructs may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell. In some embodiments, expression constructs of the can also include sequences necessary for replication in a host cell.
  • Exemplary expression control sequences include promoter/enhancer sequences, e.g., cytomegalovirus promoter/enhancer (Lehner et al. , J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41: 521-530, 1985); Rous sarcoma virus promoter (Davis et al., Hum. Gene Then, 4: 151, 1993); Tie promoter (Korhonen et al., Blood, 86(5): 1828-1835, 1995); simian virus 40 promoter; DRA (downregulated in adenoma; Alrefai et al., Am. J. Physiol.
  • promoter/enhancer sequences e.g., cytomegalovirus promoter/enhancer (Lehner et al. , J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41
  • MCT1 monocarboxylate transporter 1 ; Cuff et al., Am. J. Physiol. Gastrointet. Liver Physiol., G977-G979. 2005
  • Mathl mime atonal homolog 1; Shroyer et al., Gastroenterology, 132: 2477-2478, 2007
  • the promoter is an epithelial-specific promoter or endothelial-specific promoter.
  • Polynucleotides may also optionally include a suitable polyadenylation sequence (e.g., the SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (e.g., 3’) of the polypeptide coding sequence.
  • a suitable polyadenylation sequence e.g., the SV40 or human growth hormone gene polyadenylation sequence
  • the one or more polynucleotides also optionally comprise nucleotide sequences encoding secretory signal peptides fused in frame with the polypeptide sequences.
  • the secretory signal peptides direct secretion of the antibody polypeptides by the cells that express the one or more polynucleotides, and are cleaved by the cell from the secreted polypeptides.
  • the one or more polynucleotides may further optionally comprise sequences whose only intended function is to facilitate large scale production of the vector.
  • polynucleotides may further comprise additional sequences to facilitate uptake by host cells and expression of the antibody or fragment thereof (and/or any other peptide).
  • a “naked” transgene encoding an antibody or fragment thereof described herein e.g., a transgene without a viral, liposomal, or other vector to facilitate transfection is employed.
  • Any suitable vectors may be used to introduce one or more polynucleotides that encode an antibody or fragment thereof into the host.
  • Exemplary vectors that have been described include replication deficient retroviral vectors, including but not limited to lentivirus vectors (Kim et al., J. Virol., 72(1): 811- 816, 1998; Kingsman & Johnson, Scrip Magazine, October, 1998, pp. 43-46); parvoviral vectors, such as adeno-associated viral (AAV) vectors (U.S. Patent Nos. 5,474,935; 5,139,941 ; 5,622,856; 5,658,776; 5,773,289; 5,789,390; 5,834,441; 5,863,541; 5,851 ,521 ; 5,252,479; Gnatenko et al., J. Invest.
  • AAV adeno-associated viral
  • adenoviral vectors U.S. Patent Nos. 5,792,453; 5,824,544; 5,707,618; 5,693,509; 5,670,488; 5,585,362; Quantin et al., Proc. Natl. Acad. Sci. USA, 89: 2581-2584, 1992; Stratford Perricaudet et al., J. Clin. Invest., 90: 626-630, 1992; and Rosenfeld et al., Cell, 68: 143-155, 1992); an adenoviral adeno-associated viral chimeric (U.S. Patent No.
  • viral vectors are rendered replication-deficient by, e.g., deleting or disrupting select genes required for viral replication.
  • An expression vector (or the antibody or fragment thereof discussed herein) may be entrapped in a liposome. See, e.g., Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104 (1991); Radler et al., Science, 275(5301): 810-814, 1997). Also contemplated are various commercial approaches involving “Npofection” technology.
  • the liposome may be complexed with a hemagglutinating virus (HVJ).
  • the liposome is complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al., J. Biol. Chem., 266: 3361-3364, 1991).
  • HMG-1 nuclear nonhistone chromosomal proteins
  • the liposome are complexed or employed in conjunction with both HVJ and HMG-1.
  • SARS-CoV-2 binding agent e.g ., antibody
  • an agent that binds to a SARS-CoV-2 spike glycoprotein is included in the liposome to target the liposome to cells.
  • a cell may comprise one or more polynucleotide or vectors, e.g., the cell is transformed or transfected with one or more polynucleotides encoding a SARS-CoV- 2 binding agent ⁇ e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, or one or more vectors comprising the one or more polynucleotides.
  • cells express a SARS-CoV-2 binding agent (e.g., antibody), containing one or more, including six CDRs having at least 75% identity to the CDRs identified in Tables 1-8.
  • the cells express a SARS-CoV-2 binding agent (e.g., antibody) containing a VH and/or a VL comprising CDRs as identified in Tables 1-8.
  • SARS-CoV-2 binding agent e.g., antibody
  • the cells may be prokaryotic cells, such as Escherichia coli (see, e.g., Pluckthun et al.
  • eukaryotic cells such as an animal cell (e.g., a myeloma cell, Chinese Hamster Ovary cell, or hybridoma cell), yeast (e.g., Saccharomyces cerevisiae), or a plant cell (e.g., a tobacco, corn, soybean, or rice cell).
  • animal cell e.g., a myeloma cell, Chinese Hamster Ovary cell, or hybridoma cell
  • yeast e.g., Saccharomyces cerevisiae
  • a plant cell e.g., a tobacco, corn, soybean, or rice cell.
  • Use of mammalian host cells may provide for translational modifications (e.g., glycosylation, truncation, lipidation, and phosphorylation) that may be desirable to confer optimal biological activity on recombinant expression products.
  • polypeptides e.g., SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein
  • polypeptides may be glycosylated or non-glycosylated and/or have been covalently modified to include one or more water soluble polymer attachments such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
  • Methods for introducing DNA or RNA into a host cell include transformation, transfection, electroporation, nuclear injection, or fusion with carriers such as liposomes, micelles, ghost cells, and protoplasts.
  • host cells are useful for amplifying polynucleotides and also for expressing polypeptides encoded by the polynucleotides.
  • a process for the production of a SARS-CoV-2 binding agent may comprise culturing a host cell as described herein and isolating the SARS-CoV-2 binding agent.
  • Transferring a naked DNA expression construct into cells can be accomplished using particle bombardment, which depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327: 70-73, 1987).
  • particle bombardment depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them.
  • Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990).
  • the microprojectiles used have consisted of biologically inert substances such as tungsten or gold beads.
  • a host cell may be isolated and/or purified.
  • a host cell also may be a cell transformed in vivo to cause transient or permanent expression of the polypeptide in vivo.
  • a host cell may also be an isolated cell transformed ex vivo and introduced post-transformation, e.g., to produce the polypeptide in vivo for therapeutic purposes.
  • the definition of host cell explicitly excludes a transgenic human being.
  • a SARS-CoV-2 binding agent e.g., antibody
  • an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof is produced using any suitable method, e.g., isolated from an immunized animal, recombinantly or synthetically generated, or genetically- engineered, including as described above.
  • Antibody fragments derived from an antibody are obtained by, e.g., proteolytic hydrolysis of an antibody. For example, papain or pepsin digestion of whole antibodies yields a 5S fragment termed F(ab’)2 or two monovalent Fab fragments and an Fc fragment, respectively.
  • F(ab)2 can be further cleaved using a thiol reducing agent to produce 3.5S Fab monovalent fragments.
  • Methods of generating antibody fragments are further described in, for example, Edelman et al., Methods in Enzymology, 1 : 422 Academic Press (1967); Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244, 1960; Porter, Biochem. J., 73: 119-127, 1959; U.S. Patent No. 4,331 ,647; and by Andrews, S.M. and Titus, J.A. in Current Protocols in Immunology (Coligan et al. , eds), John Wiley & Sons, New York (2003), pages 2.8.1 2.8.10 and 2.10A.1 2.10A.5.
  • a SARS-CoV-2 binding agent e.g., antibody
  • an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof e.g., SARS-CoV-2- S1 , SARS-CoV-2-RBD
  • a SARS-CoV-2 binding agent or an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof comprises, e.g., a variable region domain generated by recombinant DNA engineering techniques.
  • variable region is optionally modified by insertions, deletions, or changes in the amino acid sequence of the antibody to produce an antibody of interest, including as described above.
  • Polynucleotides encoding complementarity determining regions (CDRs) of interest are prepared, for example, by using polymerase chain reaction to synthesize variable regions using mRNA of antibody producing cells as a template (see, for example, Courtenay Luck, “Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al.
  • Humanized antibodies are antibodies in which CDRs of heavy and light variable chains of non-human immunoglobulin are transferred into a human variable domain. Constant regions need not be present, but if they are, they optionally are substantially identical to human immunoglobulin constant regions, e.g., at least about 85-90%, about 95%, 96%, 97%, 98%, 99% or more identical, in some embodiments. Hence, in some instances, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences.
  • humanized antibodies are human immunoglobulins ⁇ e.g., host antibody) in which hypervariable region residues of the host antibody are replaced by hypervariable region residues from a non human species (donor antibody) such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
  • the antibody is a human antibody, including, but not limited to, an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences as described, for example, in Kabat et al. (1991) Sequences of proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242. If the antibody contains a constant region, the constant region also preferably is derived from human germline immunoglobulin sequences.
  • Human antibodies may comprise amino acid residues not encoded by human germline immunoglobulin sequences, for example, to enhance the activity of the antibody, but do not comprise CDRs derived from other species (e.g., a mouse CDR placed within a human variable framework region).
  • SARS-CoV-2 binding agents e.g., antibodies
  • agents that bind to a SARS-CoV-2 spike glycoprotein e.g., homotrimer, protomer
  • an S1 domain of a SARS-CoV-2 spike glycoprotein e.g., SARS-CoV-2-S1
  • a receptor binding domain e.g., SARS- CoV-2-RBD
  • SARS-CoV-2-RBD receptor binding domain of a SARS-CoV-2 spike glycoprotein
  • kits for treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition, in a subject by administering to the subject an effective amount of a SARS CoV-2 binding agent (e.g., antibody) disclosed herein.
  • a SARS CoV-2 binding agent e.g., antibody
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are used to prevent a SARS-CoV-2 related disease, disorder, or condition (e.g., infection).
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are administered to a subject prior to or at an early stage of disease (e.g., prior to infection).
  • SARS-CoV-2 binding agents (e.g ., antibodies) disclosed herein are administered to a subject as a prophylactic to prevent a SARS-CoV-2 related disease ⁇ e.g., infection).
  • administration of SARS-CoV-2 binding agents ⁇ e.g., antibodies) disclosed herein can occur prior to SARS-CoV-2 related disease ⁇ e.g., infection) or prior to manifestation of symptoms characteristic of SARS-CoV-2 related disease ⁇ e.g., infection).
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 related disease e.g., infection
  • subjects who are at high risk of exposure to SARS-CoV-2 including, for example, medical professionals such as doctors, nurses, parmedics, medical technicians and assistants).
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are administered to a subject at elevated risk for a SARS-CoV-2 related disease, including mortality from such disease.
  • subjects are at elevated risk for SARS-CoV-2 related mortality if one or more coexisting factors or disorders is present, including elevated age, elevated body mass index, history of smoking, chronic obstructive pulmonary disease, diabetes, hypertension, coronary heart disease, cerebrovascular disease, hepatitis B infection, cancer, chronic renal disease, and immunodeficiency.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 agents e.g., antibodies
  • SARS-CoV-2 related disease e.g., infection
  • SARS-CoV-2 related disease e.g., infection
  • manifestation of symptoms such that SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition is prevented or delayed in its progression.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are administered to treat a subject diagnosed with a SARS-CoV-2 related disease (e.g., infection).
  • a subject may be diagnosed with a SARS-CoV-2 related disease (e.g., infection) using any method known or developed in the art.
  • SARS-CoV-2 binding agents (e.g., antibodies) provided herein are used in treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition, in a subject who has undergone confirmatory testing for a SARS-CoV-2 related disease (. e.g ., infection), using any testing known in the art including molecular testing (e.g ., PCR), serological testing (ELISA), and viral culture.
  • molecular testing e.g ., PCR
  • serological testing ELISA
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies
  • SARS-CoV-2 binding agents are useful in a method of treating, preventing or alleviating one or more symptoms of a SARS-CoV-2-related disease, disorder, or condition in a subject, wherein the method comprises administering a SARS-CoV-2 agent ⁇ e.g., antibody) disclosed herein to the subject.
  • Symptoms of a SARS-CoV-2-related disease, disorder, or condition can include cough, dyspnea, chest tightness, fever, adverse Gl effects, fatigue, myalgia, arthralgia, lymphocytopenia, conjunctival congestion, nasal congestion, headache, sore throat, sputum production, hemoptysis, shortness of breath, nausea, vomiting, diarrhea, chills, throat congestion, tonsil swelling, lymph node enlargement, rash, pain or pressure in the chest, difficulty in breathing, reduced clarity of vision, loss of taste or smell, and confusion.
  • SARS-CoV-2 related diseases, disorders, or conditions related by SARS-CoV-2 include pneumonia (e.g., atypical pneumonia, acute respiratory distress syndrome (ARDS), multiple-organ failure, and cytokine storm).
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are administered to a subject who has symptoms of a SARS-CoV-2 related disease, disorder, or condition (e.g., an infection such as a viral respiratory infection), for example, symptoms associated with SARS-CoV-2 related disease (e.g., infection) based on a clinical assessment (e.g., to distinguish an influenza infection or other pneumonia).
  • one or more symptoms of a SARS-CoV-2 related disease, disorder, or condition are assessed using any methods known in the art.
  • symptoms are assessed using radiologic assessments including chest radiography or computed tomography (CT) and/or using laboratory assessments known in the art, including complete blood count, blood chemical analysis, coagulation testing, assessment of liver and renal function, and measures of electrolytes, C-reactive protein, procalcitonin, lactate dehydrogenase, and creatine kinase.
  • CT computed tomography
  • administration of SARS-CoV-2 binding agents prevents or reduces morbidity and/or mortality in subjects with a SARS-CoV-2 related disease, disorder, or condition.
  • administration of SARS-CoV-2 binding agents e.g antibodies
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies) disclosed herein bind with high affinity ⁇ e.g., in vitro and/or in vivo) to SARS-CoV-2 ⁇ e.g., SARS-CoV- 2 receptor binding domain (RBD)).
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies
  • SARS-CoV-2 bind to SARS-CoV-2 ⁇ e.g., SARS-CoV-2 receptor binding domain (RBD)) and neutralize SARS-CoV-2 ⁇ e.g., in vitro and/or in vivo).
  • RBD SARS-CoV-2 receptor binding domain
  • SARS-CoV-2 binding agents ⁇ e.g., antibodies
  • SARS-CoV-2 RBD SARS-CoV-2 receptor-associated ICso of less than about 1 pg/mL, about 0.1 pg/mL, about 0.01 pg/mL, about 1 ng/mL, about 0.1 ng/ml, or about 0.01 ng/ml as assessed by methods described herein or known to one of skill in the art.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease burden in SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein provides disease ameliorating effects in vivo, for example, on viral load (e.g., lung viral load) and/or body weight as a clinical symptom.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease severity, including, for example, at a histological level in vivo, in SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces susceptibility to and/or pathogenesis of SARS-CoV-2 infection in a subject.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces pulmonary monocyte-macrophage infiltration, decreases viral load, and/or decreases pulmonary pathology in SARS-CoV-2 infected subjects.
  • ROS reactive oxygen species
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces generation of ROS and/or phospholipid peroxidation. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces oxidative stress in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g ., antibodies) disclosed herein prevents or reduces signaling associated with oxidative stress in SARS-CoV-2 infected subjects.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents prevents or reduces induction of Toll-like receptor 4 expression and signaling in SARS-CoV-2 infected subjects, including, for example, by macrophages that in turn upregulate pro-inflammatory cytokine production.
  • macrophages that in turn upregulate pro-inflammatory cytokine production.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the amount of oxidized lipids in macrophage-rich inflammatory exudates from SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of pro-atherogenic cytokines and/or chemokines, including, for example, upon their stimulation with oxidized low-density lipoprotein (oxLDL), in SARS-CoV-2 infected subjects.
  • oxLDL oxidized low-density lipoprotein
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of TNF, IL-6, IL-8 and/or CD36 in SARS-CoV-2 infected subjects.
  • administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the interaction of CD36 with oxidized low-density lipoprotein (oxLDL) in SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces CD36-mediated signaling cascades for inflammatory responses in SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the recognition and/or internalization of oxLDL by CD36 in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces macrophage activation in affected tissues of SARS-CoV-2 infected subjects.
  • SARS-CoV-2 binding agents e.g., antibodies
  • administration of SARS-CoV-2 binding agents prevents or reduces macrophage activation in non-affected tissues of SARS-CoV-2 infected subjects, including, for example, where pro-atherogenic stimuli have induced a population of long-lasting inflammatory monocytes in the circulation of subjects producing a “trained innate immune response”.
  • administration of SARS-CoV-2 binding agents (. e.g ., antibodies) disclosed herein decreases the number of activated monocytes, for example, in microcirculation of infected tissues including in the pulmonary circulation of SARS-CoV-2 infected subjects.
  • administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein ameliorates disease severity, including, for example, in the pulmonary parenchyma of SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents modify the immunometabolism of monocyte/macrophage populations in subjects (e.g., in atherosclerotic subjects) with SARS-CoV-2 infection.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are administered to a subject who has a cytokine storm associated with or in response to SARS-CoV-2 infection.
  • administration of SARS-CoV-2 binding agents prevents or suppresses a cytokine storm, including, for example, by preventing or suppressing the monocyte-macrophage system (e.g., by reducing viral load and/or accumulation with macrophages such as lung macrophages) in SARS-CoV-2 infected subjects.
  • SARS-CoV-2 binding agents e.g., antibodies
  • administration of SARS-CoV-2 binding agents prevents or reduces release of cytokines, including, for example, cytokines that directly or indirectly lead to vascular endothelial damage (e.g., inflammatory and coagulation sequelae of SARS-CoV-2 infection including within parenchymatous organs such as lung, hear, kidneys, and liver).
  • cytokines including, for example, cytokines that directly or indirectly lead to vascular endothelial damage (e.g., inflammatory and coagulation sequelae of SARS-CoV-2 infection including within parenchymatous organs such as lung, hear, kidneys, and liver).
  • SARS-CoV-2 binding agents e.g., antibodies
  • are administered to subjects e.g., children with Kawasaki-like disease associated with or in response to SARS-CoV-2 infection.
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents are administered to subjects predisposed to atherosclerosis, including, for example, atherosclerosis due to underlying conditions of hypertension and/or diabetes mellitus.
  • administration of SARS-CoV-2 binding agents (e.g ., antibodies) disclosed herein prevents or reduces inflammation associated with or in response to SARS-CoV-2 infection in a subject.
  • administration of SARS-CoV-2 binding agents ⁇ e.g., antibodies reduces the number of infiltrating macrophages in SARS-CoV-2 infected subjects.
  • SARS-CoV-2 binding agents e.g., antibodies
  • a hyperinflammatory response e.g., cytokine storm
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the contribution of hyperactivated monocytes to coagulation and/or activation of polymorph nuclear leukocytes (PMN), including, for example, in affected lungs of SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces microthrombi of the lungs, brain, heart, kidneys, liver and/or limbs of SARS-CoV-2 infected subjects.
  • administration of SARS-CoV-2 binding agents prevents or reduces intravascular coagulation, including, for example, disseminated intravascular coagulation (DIC) that primarily or secondarily takes place in microcirculation (e.g., in the lungs) associated with or in response to SARS-CoV-2 infection.
  • DIC disseminated intravascular coagulation
  • SARS-CoV-2 binding agents e.g., antibodies
  • SARS-CoV-2 binding agents e.g., antibodies
  • cytokine storm fever
  • intravascular coagulation e.g., DIC
  • cardiac ischemia stroke
  • neuropsychological effects e.g., acute lung injury, acute respiratory distress syndrome, septic shock, sepsis, multi-organ dysfunction or failure.
  • SARS-CoV-2 binding agents e.g., antibodies
  • An administration regimen of SARS-CoV-2 binding agents for a particular subject will depend, in part, upon the agent used, the amount of agent administered, the route of administration, and the cause and extent of any side effects.
  • the amount of agent administered to a subject should be sufficient to effect the desired response over a reasonable time frame.
  • SARS-CoV-2 binding agents e.g., antibodies
  • the administration is on a schedule such as three times daily, twice daily, once daily, once every two days, once every three days, once weekly, once every two weeks, once every month, once every two months, once every three months, and once every six months, nine months, 12 months, 15 months, 18 months, 21 months, two years, or more.
  • the antibody is administered continuously, e.g., via a minipump.
  • Suitable routes of administering a composition such as a physiologically- acceptable composition, comprising a SARS-CoV-2 binding agent (e.g., antibody), are well known in the art. Although more than one route are used to administer an agent, a particular route can provide a more immediate and more effective reaction than another route. Depending on the circumstances, a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) is applied or instilled into body cavities, absorbed through the skin or mucous membranes, ingested, inhaled, and/or introduced into circulation.
  • a SARS-CoV-2 binding agent e.g., antibody
  • a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) through injection by intravenous, subcutaneous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems, or by implantation devices.
  • the antibody may be administered locally or systemically.
  • a SARS-CoV-2 binding agent e.g., antibody
  • a SARS-CoV-2 binding agent e.g., antibody
  • a SARS-CoV-2 binding agent may be administered locally via implantation of a membrane, sponge, or another appropriate material on to which the desired agent has been absorbed or encapsulated.
  • the device is, one aspect, implanted into any suitable tissue or organ, and delivery of a SARS-CoV-2 binding agent (e.g., antibody) is for example, via diffusion, timed-release bolus, or continuous administration.
  • any delivery route known to those skilled in the art may be used, and other delivery routes for SARS-CoV-2 binding agents (e.g., antibodies) include via the pulmonary route using a powder inhaler or metered dose inhaler, via the buccal route formulated into a tablet or a buccal patch, via the rectal route formulated into suppositories; and via the oral route in the form of a tablet, a capsule or a pellet.
  • the SARS-CoV-2 binding agents e.g ., antibodies
  • the SARS-CoV-2 binding agents ⁇ e.g., antibodies may be administered as part of a composition as described herein.
  • the dosage of antibody may be in the range of 0.1-100 mg/kg, alternatively 0.5-50 mg/kg, 1-20 mg/kg, or 1-10 mg/kg.
  • the serum concentration of the antibody may be measured by any method known in the art.
  • SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject in combination with one or more additional agents.
  • the one or more additional agents are independently useful in treating, preventing or alleviating a SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition (e.g., resulting from infection).
  • the effect of the one or more additional agents may synergize with the effect of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein.
  • the one or more additional agents may be selected by one skilled in the art.
  • the method further comprises administering one or more additional agents, which may be present in a composition comprising a SARS- CoV-2 binding agent (e.g., antibody) or provided in a separate composition using the same or a different route of administration.
  • Co-administration of SARS-CoV-2 binding agents (e.g., antibodies) with one or more additional agents (combination therapy) may encompass administering a composition comprising SARS-CoV-2 binding agents (e.g., antibodies) and the one or more additional agents as well as administering two or more separate compositions, one comprising the SARS-CoV-2 binding agents (e.g., antibodies) and the other(s) comprising the additional agent(s).
  • SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at the same time as one another. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at different times. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) may be administered, for example, once every three days, while an additional agent is administered once daily. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) are administered prior to or subsequent to treatment with the one or more additional agents, for example after a subject has failed therapy with the additional agent.
  • the SARS-CoV-2 binding agents (e.g ., antibodies) and one or more additional agents ⁇ e.g., combination therapy) may be administered once, twice or at least the period of time until the SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition ⁇ e.g., resulting from infection) is treated, prevented, alleviated, or cured.
  • the SARS-CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered multiple times.
  • SARS- CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered via any routes of administration disclosed herein or known in the art.
  • the one or more additional agents may comprise agents for influenza (e.g., Favipiravir, Fujifilm Toyama Chemical), H IV-1 protease inhibitor (e.g., ritonavir (Abbvie), prezcobix, ASC09 (Ascletis)), FI IV-1 nucleoside analog reverse transcriptase inhibitor (e.g., emtricitabine and tenofovir), hepatitis C virus protease inhibitor (e.g., danoprevir), a neuraminiase inhibitor.
  • influenza e.g., Favipiravir, Fujifilm Toyama Chemical
  • H IV-1 protease inhibitor e.g., ritonavir (Abbvie), prezcobix, ASC09 (Ascletis)
  • FI IV-1 nucleoside analog reverse transcriptase inhibitor e.g., emtricitabine and tenofovir
  • the one or more additional agents are remdesivir (Gilead), galidesivir (BioCryst Pharma), umifenovir, vicromax, ISR-50, oseltamivir (Tamiflu), virazole (Bausch Health), EIDD-2801 (Ridgeback Biotherapeutics), clevudine (Levovir), AB001 (Agastiya Biotech), BTL-tml (Beech Tree Labs), DAS181 (Ansun Biopharma), emetine hydrochloride (Acer Therapeutics), AT-527 (Atea Pharma), ruxolitinib (Novartis), transmembrane protease serine 2 (TMPRSS2) inhibitor (e.g., camostat mesylate), an NMDA receptor glutamate receptor antagonist targeting Glu2NB (e.g., ifenprodil (Algernon Pharma)), soluble human angio
  • the one or more additional agents comprise an anti-viral compound ⁇ e.g., an anti-coronaviral compound).
  • anti-viral agents include an antibody, an inhibitor of viral RNA-dependent RNA polymerase, an inhibitor of a virus-encoded protease (e.g., a protease that affects processing of a viral RNA-dependent RNA polymerase), an inhibitor of viral budding from host cells, an inhibitor of vial release from host cells (e.g., by altering the activity of hemagglutinin-esterase), an inhibitor of viral binding to a cell surface receptor, an inhibitor of receptor-induced conformational changes in virus spike glycoprotein, or an inhibitor of viral entry into cells.
  • a virus-encoded protease e.g., a protease that affects processing of a viral RNA-dependent RNA polymerase
  • an inhibitor of viral budding from host cells e.g., an inhibitor of vial release from host cells (e.g., by altering
  • the anti-viral compound is a nucleoside/nucleotide reverse transcriptase inhibitor. In some embodiments, the anti-viral compound is a protease inhibitor. In some embodiments, any anti-viral compounds or anti-viral drug combination disclosed herein or known in the art may be used as an additional agent.
  • the one or more additional agents comprise a cell- based therapy.
  • the cell based therapy may include placenta-based cell therapy (e.g., PLX cell product (PlurStem Therapeutics), mesenchymal stem cells, autologous adipose-tissue derived mesenchymal stem cells (ADMSs), allogenic mesenchymal stem cells (e.g., remestemcel-L (Ryoncil), bone marrow stem cells, allogenic T-cell therapies, natural killer cell-based therapy (e.g., CYNK-001 (Cularity), haNK (ImmunityBio)), allogenic cardiosphere-derived cell therapy (e.g., CAP-1002 (Capricor)), bone marrow-derived mesenchymal stem cells (BM-Allo- MSC), adipose-derived mesenchymal stem cells, (e.g ., Astrostem-V (NatureCell)
  • placenta-based cell therapy
  • the one or more additional agents comprise a RNA-based treatment.
  • the RNA based therapy may include RNAi, siRNA (e.g., VIR-2703 (Vir Biotech)), rintatolimod (AIM ImmunoTech), TGF-beta antisense drug (e.g., OT-101 (Mateon Therapeutics)), inhaled mRNA, and antisense oligonucleotides.
  • the one or more additional agents comprise a previously identified agent for coronavirus (e.g., agents for a SARS-CoV-1 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition).
  • the one or more additional agents is an antibody against SARS-CoV-1, e.g., CR022 (Tian et al. , Emerg Microbes Infect. 20209:382-385).
  • the one or more additional agents is a SARS-associated inflammatory cytokine inhibitor or a tumor necrosis factor (TNF) inhibitor (e.g., a TNF pathway antagonist), nonsteroidal anti inflammatory drugs (NSAIDs), disease-modifying antirheumatic drugs (DMARDs, e.g., hydroxychloroquine, leflunomide, methotrexate, mycophenolate, sulfasalazine), analgesics, topical steroids, systemic steroids (e.g., prednisone), other cytokines, antagonists of inflammatory cytokines (e.g., IL-1, TNF-a, IL-6, IL-12, and IFN-y), antibodies against T cell surface proteins, oral retinoids, salicylic acid, and hydroxyurea.
  • TNF tumor necrosis factor
  • DMARDs disease-modifying antirheumatic drugs
  • topical steroids e.g., prednisone
  • other cytokines
  • the SARS-CoV-2 binding agents e.g., antibodies
  • the SARS-CoV-2 binding agents may be used to treat, prevent, or alleviate a SARS-CoV-2 related disease, disorder, or condition, including a symptom thereof, for example, a cytokine storm, by inhibiting or suppressing the onset or progression of a cytokine storm.
  • Mechanisms of cytokine storm by pathogenic SARS-CoV are known in the art, and the one or more additional agents may suppress any pathway or mechanism known in the art (see, e.g., Ye Q, Wang B, Mao J. J Infect.
  • the SARS-CoV-2 binding agents and/or one or more additional agents may affect high levels of inflammatory cytokines (e.g., IL-1 B, IFN-g, IP-10, and monocyte chemoattractant protein 1 (MCP-1), activation of T-helper type 1 (Th1) cell response, elevated levels of Th2 cell-secreted cytokines (e.g ., IL-4 and IL-10), elevated serum levels of IL-2R, IL-6, granulocyte colony-stimulating factor, IP-10, MCP-1, macrophage inflammatory protein-1 A, and TNF-a.
  • inflammatory cytokines e.g., IL-1 B, IFN-g, IP-10, and monocyte chemoattractant protein 1 (MCP-1
  • MCP-1 monocyte chemoattractant protein 1
  • Th1 monocyte chemoattractant protein 1
  • Th2 cell-secreted cytokines e.g ., IL-4 and IL-10
  • the one or more additional agents is an interferon ⁇ e.g., IFN-l).
  • one or more additional agents may activate epithelial cells, reduce the mononuclear macrophage-mediated proinflammatory activity of IFN-ab, inhibit recruitment of neutrophils to the sites of inflammation, and/or activate the anti-viral genes in epithelial cells.
  • the additional agent is interferon alpha-2b ⁇ e.g., Peglntron (Zydus Cadila)), novaferon (Flu’nan Flaiyao hongxingtan Pharmacueticals), interferon beta 1-a ⁇ e.g., traumakine (Faron Pharma) and SNG001 (Synairgen)), interferon alpha-1 b, abd peginterferon lambda (Eiger BioPharma).
  • interferon alpha-2b e.g., Peglntron (Zydus Cadila)
  • novaferon Felu’nan Flaiyao hongxingtan Pharmacueticals
  • interferon beta 1-a ⁇ e.g., traumakine (Faron Pharma) and SNG001 (Synairgen)
  • interferon alpha-1 b abd peginterferon lambda (Eiger BioPharma).
  • the SARS-CoV-2 binding agents and/or one or more additional agents may affect dysregulated and excessive immune responses, elevated serum cytokine and chemokine levels, elevated number of neutrophils and monocytes in lung tissues and peripheral blood, delayed release of interferons in the early stages of SARS-CoV infection, thereby reducing excessive infiltration of inflammatory cells into lung tissue that leads to lung injury.
  • the one or more additional agents have anti inflammatory functions (e.g., corticosteroids). In some embodiments, the one or more additional agents inhibit excessive inflammation (e.g., during cytokine storm), prevent or inhibit ARDS, and/or protect organ function. Any corticosteroid therapy known in the art is used. For example, in some embodiments, the corticosteroid therapy is methylprednisolone.
  • the one or more additional agents includes an immune substitution and/or immunomodulation therapy (e.g., administration of intravenous immunoglobulin (IVIG)).
  • IVIG intravenous immunoglobulin
  • the one or more additional agents is an inhibitor of IL-1 family cytokines (e.g., IL-1 b, IL-18, and IL-33).
  • the additional agent is an antagonist of IL-1 b (e.g., Anakinra).
  • the one or more additional agents is an inhibitor of IL-6 (e.g., Tocilizumab), a TNF blocker, an IFN-ab inhibitor, chloroquine (e.g., hydroxychloroquine, chloroquine phosphate), ulinastatin, an oxidized phospholipid inhibitor (e.g., eritoran), a sphingosine-1 -phosphate receptor 1 agonist, or an inhibitors of mononuclear macrophage recruitment and function (e.g ., small interfering RNA (siRNA)-mediated silencing of C-C chemokine receptor type 2 (CCR2) or TLR7 agonists).
  • IL-6 e.g., Tocilizumab
  • TNF blocker e.g., TNF blocker
  • chloroquine e.g., hydroxychloroquine, chloroquine phosphate
  • ulinastatin e.g., an oxidized phospholipid inhibitor
  • the one or more additional agents include stem cell therapy.
  • the one or more additional agents include a medical device (e.g., blood purification system, respiratory assist systems, cytokine adsorber).
  • the one or more additional agents include a blood purification system (e.g., plasma exchange, adsorption, perfusion, blood/plasma filtration).
  • the one or more additional agents strengthen the vascular barrier (e.g., by activation of the endothelial Slit-Robo4 pathway).
  • the one or more additional agents comprise a vaccine.
  • the additional agent may be a replicating bacterial vector vaccine, virus-like particle (VLP) vaccine, RNA-based vaccine, replicating viral vector vaccine (e.g., viral vector expressing RBD or spike), protein subunit vaccine (e.g., RBD-based, S protein subunit, peptide-derived from spike protein), non-replicating viral vector, live attenuated virus, inactivated virus, or DNA-based vaccine.
  • VLP virus-like particle
  • viral vector vaccine e.g., viral vector expressing RBD or spike
  • protein subunit vaccine e.g., RBD-based, S protein subunit, peptide-derived from spike protein
  • non-replicating viral vector e.g., live attenuated virus, inactivated virus, or DNA-based vaccine.
  • the one or more additional agents comprise an antibody.
  • the one or more additional agents are antibodies that target a coronavirus spike protein, potential mutations of SARS-CoV-2, vascular endothelial growth factor inhibitor (e.g., bevacizumab), programmed cell death protein (PD-1) or PD-L1, CCR5, interleukin-6 receptor (e.g., sarilumab or tocilizumab), granulocyte- macrophage colony stimulating factor, complement, interleukin-1 -beta, interferon gamma, CD147, angiopoietin-2, C5a, granulocyte macrophage colony-stimulating factor (GM-CSF), TLR4, CXC10, CD14, and interleukin 33.
  • vascular endothelial growth factor inhibitor e.g., bevacizumab
  • PD-1 or PD-L1 programmed cell death protein
  • CCR5 receptor e.g., sariluma
  • the one or more additional agents comprise hyperimmune globulin (H-IG) or hyperimmune gammaglobulin. In some embodiments, the one or more additional agents may comprise antibodies from recovered COVID-19 patients or an antibody cocktail.
  • the one or more additional agents comprise one or more antibodies (e.g., monospecific or multispecific, including bispecific) with different binding specificities than the SARS-CoV-2 binding agents (e.g., antibodies) as disclosed herein.
  • one or more additional antibodies may be used in combination with SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein to simultaneously target one or more epitopes and prevent the emergence of viral escape mutants.
  • one or more epitopes may include regions of SARS-CoV-2 spike glycoprotein (e.g ., homotrimer, protomer), S1 or S2 domain of SARS-CoV-2 spike glycoprotein, other SARS-CoV proteins, S protein receptors, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
  • one or more additional antibodies e.g., monospecific or multispecific, including bispecific
  • SARS-CoV-2 binding agents disclosed herein may be used in combination with SARS-CoV-2 binding agents disclosed herein to simultaneously target multiple viral strains.
  • SARS-CoV-2 binding agents disclosed herein and/or one or more additional therapeutic antibodies may bind to a single strain or multiple strains of SARS-CoV-2.
  • Recombinant receptor binding domain (RBD) of SARS-CoV-2 spike protein encompassing residues Arg319 to Asn532 (SARS-CoV-2-RBD; SEQ ID NO:27) and carrying a His tag and Avi-tag at the C-terminus and the spike-S1 domain encompassing residues Gln14 to Arg 683 (SEQ ID NO:28) both in biotinylated format (Kactus BioSystems, Woburn MA) were used to screen synthetic fully human antibody libraries displayed on yeast (see, e.g., US Patent No.
  • Recombinant SAR-CoV-1 RBD encompassing residues Arg306-Phe527 (SEQ ID NO:29) (Kactus Biosystems) and recombinant human ACE2 extracellular domain encompassing residues Gln18- Ser760 (SEQ ID NO:30) fused to human Fc (Kactus BioSystems) were also used during fluorescence-activated cell sorting (FACS).
  • the six library pools were grown up to 3-fold of the original library titer and induced for antibody expression and screened in parallel.
  • the screening process involved a preliminary enrichment for antigen-binding antibody clones using magnetic bead activated cell sorting (MACS) followed by FACS.
  • MCS magnetic bead activated cell sorting
  • yeast cells were grown and induced to express antibodies culturing in induction medium (0.74 g amino acids without tryptophan, 7 g yeast nitrogen base with ammonium sulfate, 2 g glucose, 20 raffinose, 20 g galactose, 8.4 g NaFI2P04-7FI20 and 7.3 g Na2FIP04, pH 6.25) at 20°C for 16 hours to induce the expression of the scFab.
  • Biotinylated SARS-CoV-2-RBD plus biotinylated SARS-CoV-2-S1 was added in binding buffer (PBS plus 5g/l BSA, but without Ca2+ or Mg2+) to a final concentration of 100 nM each.
  • binding buffer PBS plus 5g/l BSA, but without Ca2+ or Mg2+
  • the cells were incubated on ice for 10 min, washed 3 times with 50 ml binding buffer, followed by incubation with streptavidin-magnetic beads for 10 min on ice. The cells were then washed once with binding buffer and resuspended in binding buffer, before being passed through a magnetic sorting column.
  • the column was washed 3 times with 7 ml binding buffer. Captured cells were eluted in 10 ml of binding buffer per column by turning off the magnetic field, then pelleted and resuspended in selective medium. The collected cells were grown up and induced for Fab expression as described above and used for a second round of magnetic bead sorting using the same conditions.
  • Fab-expressing yeast cells was were incubated with 100 nM biotinylated SARS-CoV-2- RBD plus 100 nM biotinylated SARS-CoV-2-S1 and bound SARS-CoV-2-RBD and SARS-CoV-2-S1 antigens were detected with phycoerythrin (PE)-conjugated streptavidin, while the displayed Fab was detected with goat anti-human Kappa or Lambda followed by APC-conjugated donkey anti-goat antibody. Double positive cells were identified and collected using a FACSAria II (Becton Dickenson) sorter at a rate of 20,000 events per second.
  • PE phycoerythrin
  • the harvested cells were expanded and used for the next round of sorting that included a presort using biotinylated baculovirus detected with PE-conjugated streptavidin to remove polyspecific (or non-specific, sticky) antibody clones, then taking the antibody-only positive cells and subjecting them to a positive sort in the presence of 100 nM biotinylated SARS-CoV-2-RBD.
  • the antigen (biotin) and Fab positive cells were collected and then used for a 3 rd round of FACS, which was designed to select for the subset of SARS-CoV-2-RBD- positive antibody clones that could block binding of the human ACE2 receptor to SARS-CoV-2-RBD antigen captured by the antibody clone displayed at the yeast cell surface.
  • the harvested cells were then subjected to a fourth round of FACS using 50 nM biotinylated SARS-CoV-2-S1 detected with PE-conjugated streptavidin and 100 nM human ACE2-Fc (ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc) detected with Dylight 647-conjugated goat anti-human Fc.
  • ACE2-Fc ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc
  • a final round of FACS was performed to separate the subset of antibody clones expressing antibody that was specific to SARS-CoV-2 RBD from those that expressed antibody that could also bind biotinylated SARS-CoV-1-RBD (residues Arg306 - Phe 537-Avi tag; Kactus Biosystems) at a concentration of 100 nM.
  • EXAMPLE 2 SELECTION OF ANTIBODY CLONES
  • the yeast antibody clones isolated from the final two rounds of FACS were plated on selective media plates and incubated at 30°C for 2 days. Individual colonies were randomly picked from the agar plates and grown in selective medium overnight at 30°C. The medium was replaced with induction medium and cells cultured at 20°C overnight to induce the expression of Fab antibodies.
  • Fab antibody is secreted into the culture medium in addition to those displayed Fab antibodies on the yeast cell surface.
  • the secreted Fab in the culture medium can be used directly for binding assays.
  • a preliminary ELISA was performed to determine binding activity of individual antibody clones to SARS-CoV-1 RBD, SARS-CoV-2 RBD and to baculovirus to identify antibody clones that bound antigen but did not show background binding to baculovirus.
  • a total of 2124 antibody clones were analyzed for SARS-CoV-2 RBD binding and 490 antibody clones from the subset of antibody clones from the harvested pool that bound SARS-CoV-1 RBD were also analyzed. Only 2 of the antibody clones exhibited non-specific binding to baculovirus.
  • a competition ELISA was performed to determine the ability of the secreted Fab from individual antibody clones to block SARS-CoV-2 RBD binding to immobilized ACE2 receptor.
  • 100 ng of human ACE2-Fc in 100 pi PBS was used to coat the wells of Immulon 2 HB ELISA plates at 4°C overnight. The next day, unbound ACE2 receptor was removed, and the wells were blocked with PBS containing 3% BSA for 1 hour at room temperature then washed.
  • the secreted Fab antibodies in 50 mI culture media were mixed with 2 ng of biotinylated SARS-COV-2-RBD or SAR- CoV-1-RBD in 2x binding buffer (0.5 M HEPES, 0.5 M NaCI, 5% BSA, pH 7.5) in a final volume of 100, mI for 30 mins at room temperature, then added to washed ACE2-coated wells. The plates were incubated at 30°C for 1 hr, and the bound biotinylated SARS-RBD detected with HRP-labeled streptavidin (FIG. 2).
  • 2x binding buffer 0.5 M HEPES, 0.5 M NaCI, 5% BSA, pH 7.5
  • Inhibition of binding was determined by assessing the ratio of the signal for antigen binding in the presence of the Fab-containing culture media compared to the signal for antigen binding in the presence of yeast culture media alone in the absence of Fab.
  • Antibody clones that yielded a >50% decrease in signal were considered to be inhibitory antibody clones. From a total of 2122 yeast antibody clones tested, 667 expressed Fab that blocked SARS-CoV-2-RBD binding to ACE2-coated wells by >50%. Of these, 205 antibody clones also bound to SARS-CoV-1 RBD.
  • antibody clones were also tested by ELISA for binding to baculovirus to eliminate those antibody clones exhibiting non-specific binding.
  • Yeast antibody clones expressing specific antibody clones that exhibited > 70% inhibition of SARS-CoV-2-RBD binding to ACE2-coated wells were then combined into 5 new plates and the culture media tested for the ability of the secreted Fab to bind to full-length spike protein expressed as a spike-green- fluorescent protein (GFP) fusion in 293 cells, which should more faithfully represent the conformation of native trimeric spike protein on the virus particle than the isolated RBD domain.
  • GFP spike-green- fluorescent protein
  • GFP green fluorescent protein
  • the cells were then incubated in 50 pi Fab-containing culture supernatant from individual yeast antibody clones for 45 mins with rotation at 4°C, washed 3 times in ice-cold PBSM and then bound Fab detected with either goat anti-human kappa-A647 (SouthernBiotech cat# 2060-31) or goat anti-human lambda-A647 (SouthernBiotech cat# 2070-31)
  • the cells were then washed three times with ice cold PBSM, the washed cell pellet resuspended in ice-cold PBSM and the cell-bound Dylight-647 analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius).
  • EXAMPLE 3 VIRAL NEUTRALIZATION ACTIVITY [00355]
  • the sixty-three (63) antibody clones that represented the unique antibody clones in the set of 65 testing positive for binding to spike glycoprotein expressed by 293F cells were selected for production as full-length IgGl
  • the light and heavy chains were separately cloned into different expression vectors carrying the constant regions of human lgG1 heavy chain and either the kappa or lambda chain (depending of the VL identity of the isolated antibody clone).
  • the heavy and light chain plasmids were co-transfected into Expi293 suspension cells.
  • Secreted antibody was then purified from the culture supernatants by Protein A chromatography, buffer-exchanged into PBS pH 7.4 and its concentration determined by Nanodrop A280 assay. The quality of each IgG was assessed by SDS-PAGE and by HPLC.
  • a viral cytopathic effect (CPE) assay was performed to assess the ability of the 63 selected antibody clones to inhibit cell death of Vero E6 epithelial cells, which naturally express ACE2, upon viral infection in the presence of SARS-CoV-2.
  • CPE viral cytopathic effect
  • Vero E6 cells are seeded into wells of a 96-well plate and grown to confluence then infected with SARS-CoV-2 virus (Washington state SARS-CoV-2 isolate WA1 -F6/2020). After 4 days culture, the cytopathic effect of the virus is clearly visible by microscopy (FIG. 4A).
  • each test antibody clone was diluted into DMEM (FlyClone Characterized) with routine antibiotics and supplements (pen/strep, sodium pyruvate, L-glutamine) to give 20 pg/ml in 100 pi. Then 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was added to each well, thus diluting the antibody in each well to 10 pg/ml.
  • DMEM FelyClone Characterized
  • pen/strep sodium pyruvate, L-glutamine
  • the plates were incubated at 37°C with 5% CO2 in a humidified incubator for 1 hour then the media in the wells with the Vero E6 cell monolayers was removed and the antibody- virus mixtures transferred to the corresponding Vero E6 cell wells.
  • One well on the plate had control irrelevant IgG with virus and one well served as the non-virus control well.
  • the plates were incubated for 48 hrs at 37°C with 5% CO2 in a humidified incubator then each well scored by microscopic analysis for the presence of live cells. Out of the 63 antibody clones tested, 12 showed neutralizing activity at 10 pg/ml.
  • the assay was repeated with the 12 antibody clones that exhibited neutralizing activity, this time using a log3 dilution series ranging from 10 to 0.0045 pg/ml in triplicate of each of the 12 antibody clones that had exhibited neutralizing activity at 10 pg/ml to determine the lowest concentration that could provide protection from cell death, the IC100 value.
  • the wells were scored for absence or presence of viral-induced cell death. The lowest concentration providing protection from cell death for each of the antibody clones is shown in Table 11. Five antibody clones, clone A, B, C, D and E conferred full protection from cell death at concentrations below 0.4 pg/ml.
  • 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was mixed with test antibody in DMEM at concentrations ranging from 10 pg/ml to 0.0005 pg/ml and pre-incubated together for 1 hr.
  • the mixture was then added to the wells with confluent Vero E6 cells and the plates cultured for 4 days.
  • a separate set of wells were cultured in the presence of antibody alone. Each condition was run in 5 replicate wells. Then 3 days later the number of viable cells in each well was measured using the CellTitreAq assay according to the manufacturer’s protocol.
  • the ratio of the viable cell signal in the virus+antibody treated wells to the corresponding antibody-only treated wells at each dilution was plotted and the ICso determined using Prism software.
  • the curve fit plots are shown in FIGS. 4B-4D and the ICso values in Table 12, which indicated that antibody clones B, C and F had ICso values in the 10 to 20 ng/ml range.
  • the plates were incubated at room temperature for 1 hr, washed and bound antigen detected with HRP-labeled streptavidin.
  • the OD values versus test antibody concentration were plotted and curve fitted using Prism software.
  • the ICso curve for Clone B (AvGn-B) is shown in FIG. 5C.
  • the ICso values for 4 clones assessed in this assay ranged from 2.2 nM to 23 nM (Table 13).
  • the binding affinity to full- length native spike protein expressed on transiently transfected 293 cells expressing spike-GFP protein was determined as follows. Following transfection as described above, cells were harvested and washed with ice cold PBSM (phosphate-buffered saline containing EDTA and 0.5% BSA). The cells were blocked in PBSM for 45 min at 4°C with rotation. The cells were transferred to a 96-well plate (80,000 cells/well) and pelleted by centrifugation.
  • PBSM phosphate-buffered saline containing EDTA and 0.5% BSA
  • Anti-SARS-CoV-2-RBD, control IgGs or ACE2-Fc were each serially diluted in ice cold PBSM, and the cell pellets were resuspended and incubated in these IgG/PBSM solutions for 45 min at 4°C with rotation. After the incubation, the cells were washed three times with ice cold PBSM by centrifugation then resuspended in fresh buffer.
  • the washed cell pellets were then resuspended and incubated in the dark, at 4 °C with rotation in PBSM containing goat anti-hlgG- Fc-APC (Jackson ImmunoResearch Laboratories, Inc.cat# 109-135-098) or goat anti-hlgG-Fc-A647 (Jackson ImmunoResearch Laboratories, cat# 109-605-008).
  • the cells were then washed three times with ice cold PBSM and the washed cell pellet resuspended in ice cold PBSM and analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius).
  • BIOPHYSICAL PROPERTIES HPLC analysis of 6 antibody clones indicated that they showed a single discrete peak consistent with monomeric IgG. Thermostability analysis of the 6 antibody clones was performed using by differential scanning fluorimetry (DSF). All DSF assays were carried out using the LightCycler 480 II Real-Time PCR instrument (Roche Applied Science, (Pleasanton, CA)) with filtered PBS buffer. Each test antibody was mixed with 100x SYPRO Orange solution (Invitrogen) to give a final concentration of 1.6mM protein and 20x SYPRO Orange. Twenty-five microliters of this mixture were then added to each well of a white LightCycler 48096-well plate.
  • DSF differential scanning fluorimetry
  • the plate was heated from 20°C to 99°C at a rate of 2.4°C/min, and the resulting fluorescence data were collected.
  • the negative first derivative of the melt curve was calculated, and the minima values were defined as melting temperatures (Tm). Where multiple unfolding transitions were observed, the first (lowest) melting transition was reported as Tm1 , the next lowest as Tm2 and in some cases the third as Tm3.
  • Tm1 melting temperatures
  • Tm2 melting temperatures
  • Tm3 melting temperatures
  • a large scale preparation of Clone B (AvGn-B) was generated as described in Example 3.
  • An aliquot of the purified Clone B (AvGn-B) lgG1 was then tested for endotoxin levels using a Limulus Amoebocyte Lysate (LAL) assay (ThermoFisher Scientific, catalogue # A39552) to ensure endotoxin content per dose was well below the threshold that could trigger untoward effects in vivo.
  • LAL Limulus Amoebocyte Lysate
  • the lungs were then extirpated en bloc and fixed whole in 10% neutral buffered formalin for at least 3 days to ensure virus inactivation before processing for histological analysis.
  • Four transverse whole-lung sections per animal were stained with fast red and slides were counterstained with hematoxylin or processed for IHC.
  • All lung sections were digitalized using a Nikon Eclipse 80i microscope and Nikon Digital Sight DS-FI1 camera (Nikon instruments, USA). Quantitative and qualitative microscopic analysis was determined using micrographs and morphological methods to quantify pulmonary lesions with the use of NIS-Elements (Nikon, Americas, USA).
  • Lungs from the two (2) uninfected AvGn-B treated hamsters did not show significant bronchiolar or parenchymal inflammation.
  • Distal trachea and main stem bronchi contained microscopic hemorrhages and there were variable degrees of iatrogenic atelectasis, especially in cranial and middle portions of the lungs.
  • Occasional peribronchiolar lymphoid follicles of moderate cellularity were present around bronchioles.
  • Other organs, namely, tracheobronchial and hilar lymph nodes, heart and kidneys were within normal histologic limits.
  • lung parenchyma In virus-infected and untreated hamsters, approximately 50-75% of lung parenchyma, especially the inner parenchyma (i.e. , peribronchial lung tissue), was consolidated, dark red and heavier than outer inflated lung parenchyma. Massive cellular infiltrates of predominantly macrophages, 60-70%, intermixed with neutrophils, lymphocytes and plasma cells partially filled the lumina of terminal bronchioles and adjacent alveolar and perivascular spaces to varying degrees. In the most affected lobes, there was near complete obliteration of air spaces ( FIG 7A, panel B) compared to lungs from uninfected hamsters (FIG. 7A, panel A).
  • FI&E sections were manually screened for pattern recognition of affected versus unaffected pulmonary parenchyma. At least 6 representative regions of interest (ROI) were defined (1088 x 816 pm) and subjectively delineated (annotated) by a trained single veterinary pathologist based upon hypercellularity and consolidation of alveolar spaces. Manual annotation was compiled for digital quantification of affected areas of the lung to compare individual hamsters. Data were expressed as mean ( ⁇ SEM). Statistical analyses were performed using one-way ANOVA multiple comparison test p values less than 0.05 were considered significant.
  • ROI regions of interest
  • Sections were stained for DAP I (Sigma) and images were captured using an Olympus BX63 fluorescence microscope equipped with a motorized stage and Flamamatsu ORCA-flash 4.0 LT CCD camera. Images were collected with Olympus cellSens software (v 1.18). Regions of interest (ROIs) were drawn around the perimeter of each tissue section and intensity thresholds were kept constant across groups analyses were performed blinded. Co-localization and intensity measurements were obtained using the Count and Measure feature of cellSens. [00376] Lungs were examined for the extent of macrophage infiltration and SARS- CoV-2 viral load at 5 days post infection by histopathological examination and by immunofluorescence imaging.
  • SARS-CoV-2 virus has been identified with mutations in the RBD region. These include the SARS-CoV-2 B.1.1.7, B.1.427 and P.1 variants which carry mutations that have been linked to increased transmissibility, namely the N501Y, K417N and E484K mutations.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid; and/or
  • VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
  • VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of
  • VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X 2 are each independently a naturally occurring amino acid
  • VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X 3 are each independently a naturally occurring amino acid.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid;
  • VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
  • VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of
  • VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X 2 are each independently a naturally occurring amino acid;
  • VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid;
  • VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
  • VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X 2 are each independently a naturally occurring amino acid;
  • VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or
  • VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and/or
  • VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of RASQSVRX1 TYLA (SEQ ID NO: 115) wherein Xi is S, G or D; and/or
  • VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X 2 is S or T; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X 2 A or L, and X3 is Y or F.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
  • VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
  • VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D;
  • VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X 2 is S or T;
  • VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X 2 A or L, and X3 is Y or F.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
  • VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D;
  • VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X 2 is S or T;
  • VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X 2 A or L, and X3 is Y or F.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:32
  • VH CDR2 having the amino acid sequence of SEQ ID NO:33
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:34;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:52;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:58
  • VH CDR2 having the amino acid sequence of SEQ ID NO:59
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:52;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:52;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:68.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:78
  • VH CDR2 having the amino acid sequence of SEQ ID NO:66
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:85;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:52;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1
  • VH CDR2 having the amino acid sequence of SEQ ID NO:99
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:100.
  • An antibody or fragment thereof that binds to SARS-CoV-2 wherein the antibody or fragment thereof comprises:
  • VH heavy chain variable
  • VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
  • VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24;
  • VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20;
  • VL light chain variable
  • VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
  • VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22;
  • VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:2;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:5;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:7;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:8;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:9;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 10;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:11;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 12;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:2;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:5;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 13;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 14;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:15;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO: 16;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:11;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 18;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 19;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:20;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:21;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:22;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:23.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:24;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:5;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • An antibody or fragment thereof that binds to SARS-CoV-2 wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
  • VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18;
  • VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24;
  • VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20;
  • VL light chain variable
  • VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
  • VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22;
  • VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:7;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:9;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:10;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:12;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:13;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:15;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:16;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:17.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:18;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:20;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:21 ;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:4;
  • VL CDR3 having the amino acid sequence of SEQ ID NO:6.
  • VH heavy chain variable
  • VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
  • VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48;
  • VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20;
  • VL light chain variable
  • VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46;
  • VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:32;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:33;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:34;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:35;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:37;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:38;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising:
  • VL CDR1 having the amino acid sequence of SEQ ID NO:39;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:40;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 12;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:33;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:34;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:35;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:41;
  • VH CDR2 having the amino acid sequence of SEQ ID NO: 14;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or (b) a light chain variable (VL) region comprising:
  • VL CDR1 having the amino acid sequence of SEQ ID NO:42;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:40;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO: 18;
  • VH CDR2 having the amino acid sequence of SEQ ID NO:44;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:20;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:45;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:46;
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or
  • VH CDR2 having the amino acid sequence of SEQ ID NO:48;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
  • VL CDR1 having the amino acid sequence of SEQ ID NO:34;
  • VL CDR2 having the amino acid sequence of SEQ ID NO:35;
  • An antibody or fragment thereof that binds to SARS-CoV-2 wherein the antibody or fragment thereof comprises:
  • VH heavy chain variable
  • VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
  • VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48;
  • VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20;
  • VL light chain variable
  • VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45;
  • VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46;
  • VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
  • VH heavy chain variable
  • VH CDR1 having the amino acid sequence of SEQ ID NO:32;
  • VH CDR3 having the amino acid sequence of SEQ ID NO:3;
  • VL light chain variable
  • VL CDR1 having the amino acid sequence of SEQ ID NO:34;
  • VH heavy chain variable

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pulmonology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present disclosure provides SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such binding agents are useful, including in compositions and in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.

Description

SARS-COV-2 BINDING AGENTS AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS [0001] This application claims the benefit of U.S. Provisional Application No. 63/081,893, filed September 22, 2020, U.S. Provisional Application No. 63/031,565, filed May 28, 2020, U.S. Provisional Application No. 63/031,564, filed May 28, 2020, and U.S. Provisional Application No. 63/031,560, filed May 28, 2020, the disclosure of each of which is incorporated by reference herein in its entirety.
SEQUENCE LISTING
[0002] This application incorporates by reference a Sequence Listing submitted with this application as a text file, entitled 13366-010-228_SEQ_LISTING.txt, created on May 26, 2021 , and is 83,447 bytes in size.
FIELD
[0003] Provided herein are SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such binding agents are useful, including in compositions and in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
BACKGROUND
[0004] Coronavirus are positive-sense, single-stranded RNA viruses that have been classified into 4 groups, a, b, yand d coronaviruses. They infect birds and mammals; common human coronaviruses include the b-coronaviruses HCovOC43 and HCoV-HKU1 and the a-coronaviruses HCoV-229E and HCoV-NL63 that cause common colds and more severe lower respiratory tract infections in the very young and the elderly. Over the past two decades, three serious b-coronaviral infections have arisen by zoonotic transmission of b-coronavirus from animals, most likely originating from bats: SARS-CoV, MERS-CoV and now SARS-CoV-2.
[0005] Cellular infection of coronaviruses is mediated by the viral homotrimeric spike glycoprotein binding to specific host cell receptors. Each protomer consists of an S1 domain which mediates receptor binding and an S2 domain that mediates membrane fusion and cell infection following conformational changes induced by host cell receptor binding. In the case of SARS-CoV-1 , SARS-CoV-2 and HCoV- NL63, the host receptor is the angiotensin converting enzyme 2 (ACE2) expressed on mucosal epithelia of the lungs and the Gl tract. The spike glycoprotein protomer for SARS-CoV-2 is a 1273 amino acid protein, wherein the S1 domain comprises residues 13 - 685 and the S2 domain comprises residues 686 -1273. Previous structural studies with recombinant SARS-CoV-1 S1 domain interactions with ACE2 indicated that a receptor binding domain within the S1 domain encompassing residues 318 - 510 itself consists of two subdomains with a core domain and an extended loop domain consisting of residues 424 - 494 as the receptor binding motif (RBM) that interacts with the ACE2 receptor forming a shallow concave binding surface. Previous structural studies have also indicated that within the native conformation of spike homotrimers, the RBD can exist in either an up or down position, with the number of RBDs within the spike glycoprotein trimer being in the up conformation at any one time being in dynamic flux. Binding to ACE2 can only occur when the RBD is in the up postion. When all three RBDs are in the down conformation, this prevents any interaction with ACE2.
[0006] Many studies are ongoing to understand more about SARS-CoV-2, including its interaction with the ACE2 receptor and there is an urgent need for agents that can be used in methods for treating, preventing, or ameliorating a SARS- CoV-2 related disease, disorder, or condition.
SUMMARY
[0007] The present disclosure provides SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such antibodies (e.g., monospecific or multispecific, including bispecific) may bind to a SARS-CoV-2 spike glycoprotein (e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
[0008] The present disclosure also provides compositions comprising a SARS- CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein. Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. [0009] The present disclosure also provides methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition with a SARS-CoV-2 binding agent or a composition comprising the SARS-CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein or composition comprising such an agent. Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
BRIEF DESCRIPTION OF THE DRAWINGS [0010] FIG. 1 illustrates exemplary results from assays for separation of potential inhibitors of receptor binding from non-inhibitors, including from FACS identification of a subset of SARS-CoV-2-RBD positive antibody clones that inhibit ACE2 receptor binding to captured antigen. Left panel: unstained yeast cells. Right panel: yeast cells after induction of antibody display were stained with biotinylated SARS-CoV-2 RBD and Phycoerythrin (PE)-conjugated streptavidin (P1 gate), followed by incubation with human ACE2-human Fc fusion protein (which had been shown to bind to SARS-CoV-2-RBD with high affinity). Bound ACE2-human Fc was then detected by Dylight 647 conjugated goat anti-human Fc. Antibody clones that could bind ACE2 in the presence of bound antigen appear double positive (P3 gate). Antibody clones that bind biotinylated SARS-CoV-2 RBD in a manner that prevents binding of ACE2-Fc to antigen (P1 gate) are potential inhibitory antibody clones that block the RBD-receptor interaction.
[0011] FIG. 2 illustrates exemplary results from ELISA screening assays to identify antibody clones that inhibit the interaction of SARS-CoV-2-RBD with ACE2, including from characterization of individual antibody clone Fab-containing culture media. Exemplary results of ELISA competition assays testing the ability of secreted Fab from individual yeast antibody clones to inhibit binding of SARS-CoV-2-RBD to ACE2 coated wells are shown. Secreted Fab in culture medium was used directly for assessing the ability of the Fab to block SARS-CoV-2-RBD binding to ACE2-Fc coated wells and compared with the level of binding in the presence of yeast media alone as the null effect control. An aliquot (50 pi) of the culture media was preincubated with 2 nM of biotinylated SARS-CoV-2-RBD in a final volume of 100 mI for 30 mins at room temperature, then added to washed ACE2-coated wells. After incubating for 1 hour at room temperature, the wells were washed and bound antigen detected with HRP-labeled streptavidin. Well H12 was treated with plain yeast media and served as the negative reference control. The results of the antibody clones that resulted in a >50% reduction in biotinylated SARS-CoV-2-RBD binding to the ACE2 coated wells are shaded.
[0012] FIG. 3 illustrates exemplary results from assays of Fab supernatant binding to 293F cells that were transfected to express a SARS-CoV-2 spike glycoprotein, including from evaluation of the Fab in individual clone culture media to bind to SARS-CoV-2 spike glycoprotein expressed in the 293F cells. 293F cells transiently transfected with a vector encoding full-length spike protein as a green fluorescent protein (GFP) fusion were incubated in the presence of 50 pi of clone culture media, a negative control clone culture media, or plain culture media (for secondary detection staining alone) added to 50 mI DMEM. After incubating with rotation for 1 hr at 4°C, cells were washed and bound Fab detected with Alexa-647 labeled goat anti-human light chain (LC). Selected panels from a 96-well plate flow cytometry assessment of Fab binding compared to controls. Upper row: SARS-CoV-2 spike glycoprotein-GFP fusion protein transfected cells. Lower row: non transfected control 293F cells. GFP fluorescence intensity, a measure of SARS-CoV-2-spike glycoprotein-GFP fusion protein expression is shown along the Y axis; Alexa 657 fluorescence intensity, a measure of Fab binding, is shown along the X axis.
[0013] FIGS. 4A-4D illustrates exemplary results from viral neutralization assays. Vero E6 cells were plated in 96-well plates at 20,000 cells per well and assessed for viral induced cytopathic effects 2-4 days after addition of SARS-CoV-2 isolate WA1- F6/2020 equivalent to 100 TCID50. FIG. 4A: Phase contrast of uninfected Vero E6 cells, or SARS-CoV-2 infected Vero E6 cells 4 days after infection. FIGS. 4B-4D:
To determine the ICso values, the antibody clones were diluted in Complete DMEM and serially diluted 1:3 ranging from 10 pg/ml to 0.00005 pg/ml. The dilutions of antibody were incubated with 100 TCIDso per 50 pL of SARS-CoV-2 for 1 hr and added to the assay plates. The plates were incubated for 4 days at 37°C, 5% CO2 and 95% relative humidity and the inhibitory effects of the antibodies were measured using an MTS colorimetric cell viability method and the IC50 values were determined using Prism software (GraphPad, San Diego CA).
[0014] FIGS. 5A-5C illustrate the binding properties of Clone B (AvGn-B). FIG.
5A: Binding of monomeric biotinylated SARS-CoV-2-RBD at different concentrations to immobilized Clone B (AvGn-B) coated on wells of Immobilon plates. FIG. 5B: Binding of ACE-2-Fc and Clone B (AvGn-B) to SARS-COV-2 spike-protein expressing transfected 293 cells versus concentration. FIG. 5C: Inhibitory activity versus concentration curve measuring the ability of Clone B (AvGn-B) to block SARS-CoV-2-RBD binding to wells coated with ACE2-Fc. Curve fitting and determination of KD and IC50 values were performed using Prism software.
[0015] FIGS. 6A and 6B illustrate the effect of dosing Clone B (AvGn-B) on body weight and lung viral load in SARS-CoV-2 infected hamsters. Of the 20 hamsters,
18 were intranasally infected with 2.5x104 TCIDso/mL equivalents of SARS-CoV-2 (strain 2019-nCoV/USA-WA1/2020) and divided into treatment groups as follows: 2.5mg Clone B (AvGn-B) (n=5), 1 mg Clone B (AvGn-B) (n=5), “Untreated” (no antibody) (n=6), and “Ab Control” (2.5 mg isotype control lgG1) (n=2). Two uninfected hamsters received 2.5 mg Clone B (AvGn-B). Each animal was dosed intraperitoneally with corresponding treatment at 24 and 72 hours post-infection.
Each hamster was weighed daily and then euthanized at Day 5. FIG. 6A: Body weight changes post infection. Hamster body weights were recorded daily (0-5 days post-infection [dpi]), and weight loss was defined as percentage loss from 0dpi. Weight loss of infected groups compared to the uninfected control group was analyzed using two-way ANOVA in Prism GraphPad for each day (p<0.0001). FIG. 6B: Quantification of viral load (gene copy number/reaction) in infected hamster lung was compared between treatment groups (analyzed by Mann-Whitney U Test in Prism GraphPad) (*P< 0.05). U = Untreated, virus infected; Hi = high dose (2.5 mg) Clone B (AvGn-B); Lo = low dose (1 mg) Clone B (AvGn-B); and Ctl = Ab Control (2.5 mg isotype control IgG).
[0016] FIGS. 7A and 7B illustrate the effect of Clone B (AvGn-B) on lung histology 5 days post-infection compared with lungs from uninfected hamsters. FIG. 7A: H&E stained whole lung lobe section from uninfected control (panel A), infected with no treatment (Untreated, panel B), infected treated with 2.5 mg control lgG1 (panel C), and infected treated with 1 mg Clone B (AvGn-B) (panel D). FIG. 7B: Quantification of bronchiointerstitial pneumonia within regions of interest delineated from each lung lobe of each animal. (*P< 0.05, **P<0.01,***P<0.001, ****P<0.0001). [0017] FIG. 8 illustrates the effect of Clone B (AvGn-B) on SARS-CoV-2 viral content of hamsters 5 days post infection (dpi). Staining for the nucleocapsid protein of SARS-CoV-2 in lungs of an infected, untreated (panel A) and control lgG1 treated (2.5 mg/dose) treated (panel C) compared with lungs from infected, clone B (AvGn- B) treated hamsters at 1 mg/dose (panel B) or 2.5 mg/dose (panel D). [0018] FIGS. 9A and 9B illustrate the effect of Clone B (AvGn-B) on macrophage activity within lungs of hamsters 5 days post infection with SARS-CoV-2 virus compared to uninfected hamsters. FIG. 9A: Macrophage content/pm determined using IBA1 staining to identify monocytes and macrophages within lung tissue measured using a scanning digital microscope and cellSens software. FIG. 9B: Colocalization of SARS-CoV-2 virus and monocytes/macrophages within the lung of infected hamsters determined using IBA1 staining for monocytes and macrophages and anti-SARS-CoV-2 nucleocapsid protein to stain for virus. (*P< 0.05,
**P<0.01 ,***P<0.001 , ****P<0.0001 ; N=2 animals/group).
[0019] FIGS. 10A and 10B illustrate the comparison of Clone B (AvGn-B) with an exemplary engineered variant. FIG. 10A: Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transfected 293 cells versus concentration. FIG. 10B: Neutralization activity of Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) in the CPE assay measured as percent of viable cells remaining 4 days after addition of virus plus the different concentrations of antibody as indicated to the confluent Vero-E6 cells in culture wells. KD and ICso values were determined using Prism software. [0020] FIGS. 11 A and 11 B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone G2 (AvGn-B-G2), Clone G4 (AvGn-B-G4), Clone H1 (AvGn-B-H1), Clone H2 (AvGn- B-H2), Clone A1 (AvGn-B-A1), Clone F2 (AvGn-B-F2), and Clone F11 (AvGn-B- F11 ), including consensus sequences for VFI CDR1 , VFI CDR2, VFI CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
[0021] FIGS. 12A and 12B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone C (AvGn-C), and Clone F (AvGn-F), including sequences for VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
DETAILED DESCRIPTION
[0022] The present disclosure provides SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such antibodies ( e.g ., monospecific or multispecific, including bispecific) may bind to a SARS-CoV-2 spike glycoprotein {e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. Such binding agents {e.g., antibodies) are useful in compositions and in methods of treating, preventing, or alleviating a coronavirus-mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
[0023] The present disclosure provides SARS-CoV-2 binding agents such as agents the bind to a SARS-CoV-2 spike glycoprotein, including agents that are antibodies or antibody fragments, and methods of using SARS-CoV-2 binding agents such as agents that bind to a SARS-CoV-2 spike glycoprotein, in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
For example, SARS-CoV-2 binding agents such as agents, including antibodies, that bind to a SARS-CoV-2 spike glycoprotein (e.g., monospecific or multispecific antibodies, including bispecific antibodies) are useful in such methods of treatment, prevention, or alleviation.
[0024] Provided herein are binding agents (e.g., antibodies) which bind to SARS- CoV-2, including agents (e.g., antibodies) that bind to a SARS-CoV-2 spike glycoprotein (e.g., with an amino acid sequence of SEQ ID NO:31). A SARS-CoV-2 binding agent (e.g., antibody) may bind to a SARS-CoV-2 spike glycoprotein or portion thereof such as an S1 domain (e.g., with an amino acid sequence of SEQ ID NO:28) or receptor binding domain (e.g., with an amino acid sequence of SEQ ID NO:27). An exemplary amino acid sequence of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 {see, e.g., amino acids 13-1273). An exemplary amino acid sequence of an S1 domain of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 {see, e.g., amino acids 13(Ser)-685(Arg)). An exemplary amino acid sequence of a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 {see.e.g., amino acids 319(Arg)-532(Asn)). An exemplary SARS-CoV-2 binding agent (e.g., antibody) is provided herein which comprises an amino acid sequence that is YYVGWGWFDV (SEQ ID NO:3). An exemplary anti-SARS-CoV-2 antibody is provided herein which comprises a heavy chain variable (VFI) region, for example, comprising a VFI CDR1 , VFI CDR2, and VFI CDR3, and a light chain variable (VL) region, for example, comprising a VL CDR1 ,
VL CDR2, and VL CDR3, wherein the VH CDR3 has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
[0025] The term “antibody,” “immunoglobulin,” or “Ig” is used interchangeably herein, and is used in the broadest sense and specifically covers, for example polyclonal antibodies, monoclonal antibodies (including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies), antibody compositions with polyepitopic or monoepitopic specificity, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), synthetic antibodies, chimeric antibodies, humanized antibodies, or human versions of antibodies having full length heavy and/or light chains.
Antibodies and fragments thereof as disclosed herein include antibodies and fragments thereof that bind to SARS-CoV-2, including, for example, a SARS-CoV-2 spike glycoprotein ( e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. Antibodies may be neutralizing antibodies. The present disclosure includes antibody fragments (and/or polypeptides that comprise antibody fragments) that retain SARS-CoV-2 binding characteristics. Non-limiting examples of antibody fragments include antigen-binding regions and/or effector regions of the antibody, e.g., F(ab)2, F(ab')2, Fab, Fab', Fd, Fc, and Fv fragments (e.g., fragments consisting of the variable regions of the heavy and light chains that are non-covalently coupled), disulfide-linked Fvs (dsFv), or single-domain antibodies {e.g., nanobodies). In general terms, a variable (V) region domain may be any suitable arrangement of immunoglobulin heavy (VH) and/or light (VL) chain variable domains. For example, the present disclosure also includes tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, and an antibody heavy chain monomer. Thus, for example, the V region domain may be dimeric and contain VH-VH, VH-VL, or VL-VL dimers that bind SARS CoV-2, including a SARS CoV-2 spike glycoprotein or portion thereof (e.g., S1 domain, receptor binding domain). If desired, the VH and VL chains may be covalently coupled either directly or through a linker to form a single chain Fv (scFv). For ease of reference, scFv proteins are referred to herein as included in the category “antibody fragments.” Antibody fragments (e.g., single-chain antibodies or other binding domains) can exist alone or in combination with one or more of the following: hinge region, CH1, CH2, CH3, or CH4 domains, J chain, or secretory component. Another form of an antibody fragment is a peptide comprising one or more complementarity determining regions (CDRs) of an antibody. CDRs (also termed "minimal recognition units" or "hypervariable region") can be obtained by constructing polynucleotides that encode the CDR of interest. Such polynucleotides are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA of antibody-producing cells as a template (see, for example, Larrick et al. , Methods: A Companion to Methods in Enzymology, 2:106 (1991); Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies," in Monoclonal Antibodies Production, Engineering and Clinical Application, Ritter et al. (eds.), page 166, Cambridge University Press (1995); and Ward et al., "Genetic Manipulation and Expression of Antibodies," in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), page 137, Wiley-Liss, Inc. (1995)). Antibody fragments may be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, variable domains of new antigen receptors (v-NAR), and bis-single chain Fv regions (see, e.g., Hollinger and Hudson, Nature Biotechnology, 23(9): 1126-1136, 2005). The binding agent, in some embodiments, contains a light chain and/or a heavy chain constant region, such as one or more constant regions, including one or more lgG1, lgG2, lgG3 and/or lgG4 constant regions. In some embodiments, antibodies can include epitope-binding fragments of any of the above. The antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., lgG1, lgG2, lgG3, lgG4, lgA1, and lgA2) of immunoglobulin molecule. Antibodies may be neutralizing antibodies.
[0026] The term "monospecific" antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen. The term "bispecific" means that the antibody is able to specifically bind to at least two distinct antigenic determinants, for example two binding sites each formed by a pair of an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL) binding to different antigens or to different epitopes on the same antigen. Such a bispecific antibody may have a 1+1 format. Other bispecific antibody formats may be 2+1 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding sites for a second antigen or epitope). When a bispecific antibody comprises two antigen binding sites, each may bind to a different antigenic determinant. Such a bispecific antibody may bind to two different epitopes on the same antigen (e.g., epitopes on a SARS-CoV-2 spike glycoprotein).
[0027] The terms “identical” or percent “identity” in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity can be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that can be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variants thereof. In some embodiments, two nucleic acids or polypeptides are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection. In some embodiments, identity exists over a region of the amino acid sequences that is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues in length or any integral value there between. In some embodiments, identity exists over a longer region than 60- 80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a target protein or an antibody. In some embodiments, identity exists over a region of the nucleotide sequences that is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases in length or any integral value there between. In some embodiments, identity exists over a longer region than 60-80 bases, such as at least about 80-1000 bases or more, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as a nucleotide sequence encoding a protein of interest. [0028] A “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a side chain with similar chemical characteristics. Families of amino acid residues having similar side chains have been generally defined in the art, including basic side chains ( e.g ., lysine, arginine, histidine), acidic side chains {e.g., aspartic acid, glutamic acid), uncharged polar side chains {e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains {e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains {e.g., threonine, valine, isoleucine) and aromatic side chains {e.g., tyrosine, phenylalanine, tryptophan, histidine). For example, substitution of a phenylalanine for a tyrosine is a conservative substitution. Generally, conservative substitutions in the sequences of the polypeptides, soluble proteins, and/or antibodies of the disclosure do not abrogate the binding of the polypeptide, soluble protein, or antibody containing the amino acid sequence, to the target binding site. Methods of identifying amino acid conservative substitutions which do not eliminate binding are well-known in the art. [0029] The terms “polypeptide” refers to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can include {e.g., be interrupted by) non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as linkage to or conjugation with (directly or indirectly) a moiety such as a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids), as well as other modifications known in the art. It is understood that, because the polypeptides of this disclosure can be based upon antibodies or other members of the immunoglobulin superfamily, in some embodiments, the polypeptides can occur as single chains.
[0030] As used herein, an “antigen” is a moiety or molecule that contains an epitope to which an antibody can bind. As such, an antigen is also is bound by an antibody. In some embodiments, the antigen, to which an antibody described herein binds is SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein), or a fragment thereof. [0031] As used herein, an “epitope” is a term in the art and refers to a localized region of an antigen to which an antibody can bind. An epitope can be a linear epitope or a conformational, non-linear, or discontinuous, epitope. In the case of a polypeptide antigen, for example, an epitope can be contiguous amino acids of the polypeptide (a “linear” epitope) or an epitope can comprise amino acids from two or more non-contiguous regions of the polypeptide (a “conformational,” “non-linear” or “discontinuous” epitope), e.g., a SARS-CoV-2 spike glycoprotein. It will be appreciated by one of skill in the art that, in general, a linear epitope may or may not be dependent on secondary, tertiary, or quaternary structure. For example, in some embodiments, an antibody binds to a group of amino acids regardless of whether they are folded in a natural three dimensional protein structure. In other embodiments, an antibody requires amino acid residues making up the epitope to exhibit a particular conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
[0032] As used herein, the terms “specifically binds,” “specifically recognizes,” “immunospecifically binds,” “selectively binds,” “immunospecifically recognizes” and “immunospecific” are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., epitope) as such binding is understood by one skilled in the art. In some embodiments , “specifically binds” means, for instance that a polypeptide or molecule interacts more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including related and unrelated proteins. For example, a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, generally with lower affinity as determined by, e.g., immunoassays, Biacore™, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or Bio-Layer Interferometry (BLI) assays, Gator™ instrument (Probe Life, Inc., Palo Alto, CA), or other assays known in the art. In some embodiments, an antibody or antigen binding domain binds to or specifically binds to an antigen when it binds to an antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs). Typically, a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed.,
2d ed. 1989) for a discussion regarding binding specificity. In some embodiments, the extent of binding of an antibody or antigen binding domain to a “non-target” protein is less than about 10% of the binding of the antibody or antigen binding domain to its particular target antigen, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA. In some embodiments, molecules that specifically bind to an antigen bind to the antigen with a Ka that is at least 2 logs, 2.5 logs, 3 logs, 4 logs or greater than the Ka when the molecules bind to another antigen. In some embodiments, molecules that specifically bind to an antigen do not cross react with other proteins. In some embodiments “specifically binds” means, for instance, that a polypeptide or molecule binds a protein or target with a KD of about 0.1 mM or less, but more usually less than about 1mM. In some embodiments, “specifically binds” means that a polypeptide or molecule binds a target with a KD of at least about 0.1 mM or less, at least about 0.01 mM or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include a polypeptide or molecule that recognizes a protein or target in more than one species. Likewise, because of homology within certain regions of polypeptide sequences of different proteins, specific binding can include a polypeptide or molecule that recognizes more than one protein or target. It is understood that, in some embodiments, a polypeptide or molecule that specifically binds a first target may or may not specifically bind a second target. As such, “specific binding” does not necessarily require (although it can include) exclusive binding, e.g., binding to a single target. Thus, a polypeptide or molecule can, in some embodiments, specifically bind more than one target. In some embodiments, multiple targets can be bound by the same antigen-binding site on the polypeptide or molecule. For example, an antibody can, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins. In certain alternative embodiments, an antibody can be bispecific and comprise at least two antigen-binding sites with differing specificities. Generally, but not necessarily, reference to “binding” means “specific binding”.
[0033] As used herein, the term “constant region” or “constant domain” is a well- known antibody term of art and refers to an antibody portion, e.g., for example, a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor. The term refers to a portion of an immunoglobulin molecule having a generally more conserved amino acid sequence relative to an immunoglobulin variable domain. The term “Fc region” or “Fc domain” is used herein to refer to a portion of a constant region or one or more constant regions.
[0034] As used herein, the term “heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino- terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy-terminal portion includes one or more constant regions. The “heavy chain” can refer to any distinct types, e.g., for example, alpha (a), delta (d), epsilon (e), gamma (y) and mu (m), based on the amino acid sequence of the constant domain, which give rise to IgA, IgD, IgE, IgG and IgM classes of antibodies, respectively, including subclasses of IgG, e.g., lgG1, lgG2, lgG3 and lgG4.
[0035] As used herein, the term “light chain” when used in reference to an antibody can refer to a polypeptide chain of about 25 kDa, wherein the amino- terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy-terminal portion includes a constant region. The approximate length of a light chain is 211 to 217 amino acids. There are two distinct types, e.g., kappa (K) of lambda (l) based on the amino acid sequence of the constant domains. Light chain amino acid sequences are well known in the art. As used herein, an “isolated” or “purified” antibody or antigen binding fragment is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the antibody or antigen binding fragment is derived, or substantially free of chemical precursors or other chemicals when the antibody or antigen binding fragment is chemically synthesized.
[0036] As used herein, the term “secretory component” refers to a protein that specifically binds to J-chain-containing antibody, and is related to, derivable from, or identical to an extracellular portion of the polymeric immunoglobulin receptor (plgR), preferably a human plgR. Preferably, the secretory component confers increased stability to the J-chain containing immunoglobulin. During secretion, the secretory component can become associated with an antibody (e.g., dimeric or polymeric IgA or pentameric IgM) comprising a J chain. The secretory component may confer increased stability to the J-chain containing antibody.
[0037] As used herein, the term “J-chain” refers to J-chain polypeptide of about 15kDa of IgM or IgA antibodies of any animal species, including mature human J- chain. The amino acid sequence of mature human J-chain is well known in the art. The J chain sequence may be modified, for example, to comprise a fragment or variant of the J chain native sequence or to comprise a heterologous moiety or peptide. The J chain may be a full-length native J chain, but may also contain amino acid alterations, such as substitutions, insertions, deletions, truncations, including J chain fragments. In some embodiments, the J-chain is modified to comprise a heterologous moiety or peptide. The heterologous moiety may be attached directly or indirectly (e.g., through a linker). In some embodiments, the J chain may comprise a moiety that is a binding domain. See, e.g., U.S. Patent Nos. 10,400,038 and 9,951 , 134. In some embodiments, the J chain may comprise a moiety that confers a desired characteristic to the antibody. For example, the J-chain may comprise a moiety that affects the absorption, distribution, metabolism, or excretion (ADME) characteristics of an antibody. See, e.g., U.S. Patent No. 10,618,978. In certain embodiments, the heterologous moiety does not affect polymerization of the antibody (e.g., pentamerization of IgM and dimerization of IgA) and binding of the antibody to a target.
[0038] The terms “antigen binding fragment,” “antigen binding domain,” “antigen binding region,” and similar terms refer to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding fragment, domain, or region its specificity and affinity for the antigen (e.g., the CDRs). “Antigen binding fragment” as used herein include “antibody fragment,” which comprise a portion of an intact antibody including one or more CDRs, such as the antigen binding or variable region of the intact antibody. Examples of antibody fragments include, without limitation, Fab, Fab’, F(ab’)2, and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger et al., Proc Natl Acad Sci 1993, 90:6444-48; Lu et al., J Biol Chem, 2005, 280:19665-72; Hudson et al., Nat Med, 2003, 9:129-34; WO 93/11161; and U.S. Pat. Nos. 5,837,242 and 6,492,123); single-chain antibody molecules (see, e.g., U.S. Pat. Nos. 4,946,778; 5,260,203; 5,482,858; and 5,476,786); dual variable domain antibodies (see, e.g., U.S. Pat. No. 7,612,181); single variable domain antibodies (sdAbs) (see, e.g., Woolven etal., Immunogenetics, 1999, 50: 98-101 ; and Streltsov et al., Proc Natl Acad Sci USA. 2004, 101:12444-49); and multispecific antibodies formed from antibody fragments. [0039] As used herein, the terms “antibody” and “immunoglobulin” and “Ig” are terms of art and can be used interchangeably herein and refer to a molecule with one or more antigen binding sites that bind an antigen. [0040] In some embodiments, a SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein can bind to a SARS-CoV-2 spike glycoprotein ( e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
[0041] In some embodiments, an SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein {e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. Such a SARS-CoV-2 binding agent includes an antibody, antibody fragment, or other peptide-based molecule.
Antibodies provided herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab’) fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-ld) antibodies, and epitope binding fragments of any of the above.
[0042] In some embodiments, antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, including molecules that contain one or more antigen binding sites that bind to a SARS-CoV-2 antigen.
[0043] Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA or IgY), any class, (e.g., lgG1, lgG2, lgG3, lgG4, lgA1 or lgA2), or any subclass (e.g., lgG2a or lgG2b) of immunoglobulin molecule. Antibodies may be neutralizing antibodies. In some embodiments, antibodies described herein are IgG antibodies (e.g., human IgG), or a class (e.g., human lgG1 , lgG2, lgG3 or lgG4) or subclass thereof. In some embodiments, antibodies described herein are IgA antibodies (e.g., human IgA), or a class (e.g., human lgA1 or lgA2) or subclass thereof. Antibody classes and subclasses, including lgG1, lgG2, lgG3, lgG4, lgA1, lgA2, are well known in the art and are known to confer functional specialization. Modified versions of each of these classes and subclasses may be prepared by those skilled in the art. In some embodiments, antibodies are hybrid antibodies with properties of more than one class or subclass of antibody. Methods for making hybrid antibodies (e.g., IgA/lgG and IgM/lgG) are known in the art. Antibodies include those of all isotypes, sub- classes and forms, including their fragments, for example, SARS-CoV-2 binding fragments. An antibody can include a J-chain and/or a secretory component. Antibodies may be modified to include sequences from other isotypes, such as IgG to produce chimeric antibodies. An antibody encompasses anything ranging from a small binding fragment of an antibody to a full sized antibody, including a multimeric antibody, for example, an IgA antibody that includes four complete heavy chains and four complete light chains and optionally includes a J chain and/or a secretory component, or an IgM antibody that includes ten or twelve complete heavy chains and ten or twelve complete light chains and, optionally, includes a J-chain and/or a secretory component.
[0044] In some embodiments, an antibody is a 4-chain antibody unit comprising two heavy (H) chain / light (L) chain pairs, wherein the amino acid sequences of the H chains are identical and the amino acid sequences of the L chains are identical. In some embodiments, the H and L chains comprise constant regions, for example, human constant regions. In some embodiments, the L chain constant region of such antibodies is a kappa or lambda light chain constant region, for example, a human kappa or lambda light chain constant region. In some embodiments, the H chain constant region of such antibodies comprise a gamma heavy chain constant region, for example, a human gamma heavy chain constant region. In some embodiments, such antibodies comprise IgG constant regions, for example, human IgG constant regions ( e.g lgG1, lgG2, lgG3, and/or lgG4 constant regions).
[0045] An antibody or fragment thereof may preferentially bind to SARS-CoV-2 meaning that the antibody or fragment thereof binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein and/or binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein. For example, the antibody or fragment thereof may specifically recognize and bind a SARS-CoV-2 spike glycoprotein or a portion thereof. “Specific binding” means that the antibody or fragment thereof binds to SARS-CoV-2 with an affinity that is at least 5, 10, 15, 20, 25, 50, 100, 250, 500, 1000, or 10,000 times greater than the affinity for an unrelated control protein (e.g., hen egg white lysozyme). In some embodiments, the antibody or fragment thereof may bind SARS-CoV-2 substantially exclusively (e.g., is able to distinguish SARS-CoV-2 from other known polypeptides such other SARS-CoV-2, for example, by virtue of measurable differences in binding affinity). The term “hypervariable region”, “HVR”, or “HV”, when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six hypervariable regions; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3). A number of hypervariable region delineations are in use and are encompassed herein. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (see, e.g., Kabat etal., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The end of the Chothia CDR- H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag). The “contact” hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions or CDRs are noted below.
[0046] A universal numbering system has been developed and widely adopted, ImMunoGeneTics (IMGT) Information System® (Lefranc etal., Dev. Comp. Immunol. 27(1 ):55-77 (2003)). IMGT is an integrated information system specializing in immunoglobulins (IG), T cell receptors (TR) and major histocompatibility complex (MHC) of human and other vertebrates. Herein, the CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain. As the “location” of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues and are readily identified. This information can be used in grafting and replacement of CDR residues from immunoglobulins of one species into an acceptor framework from, typically, a human antibody. An additional numbering system (AHon) has been developed by Honegger and Pltickthun, J. Mol. Biol. 309: 657-670 (2001). Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT unique numbering system, is well known to one skilled in the art (see, e.g., Kabat, supra ; Chothia and Lesk, supra ; Martin, supra ; Lefranc etai, supra) and is also illustrated below. An Exemplary system, shown herein, combines Kabat and Chothia.
Figure imgf000021_0001
[0047] Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 or 26-35A (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH. As used herein, the terms “HVR” and “CDR” are used interchangeably. [0048] In some embodiments, a SARS-CoV-2 binding agent ( e.g ., antibody), including an agent {e.g., antibody) that binds to a SARS-CoV-2 spike glycoprotein, comprises a VH region which comprises VH CDR1 , VH CDR2, and/or VH CDR3, and a VL region which comprises VL CDR1 , VL CDR2, and/or VL CDR3 of any one of the binding agents described herein (see, e.g., Tables 1-8). In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody), including an agent (e.g., antibody) that binds to a SARS-CoV-2 spike glycoprotein, comprises a VH region and/or a VL region, wherein the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, the SARS-CoV-2 binding agent (e.g., antibody) provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8. In some embodiments, the SARS-CoV-2 binding agent (e.g., antibody) provided herein is bispecific and comprises a first binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8 and a second binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from another antibody, including, for example, another antibody that binds to SARS-CoV-2 and/or SARS-CoV-1. Table 1 : Antibody Clone B (AvGn-B)
Figure imgf000022_0001
Figure imgf000022_0002
Table 2: AvGn-B-H2
Figure imgf000023_0001
Figure imgf000023_0002
Table 3: AvGn-B-F11
Figure imgf000024_0001
Figure imgf000024_0002
Table 4: AvGn-B-H1
Figure imgf000025_0001
Figure imgf000025_0002
Table 5: AvGn-B-G4
Figure imgf000026_0001
Figure imgf000026_0002
Table 6: AvGn-B-F2
Figure imgf000027_0001
Figure imgf000027_0002
Table 7: AvGn-B-G2
Figure imgf000028_0001
Figure imgf000028_0002
Table 8: AvGn-B-A1
Figure imgf000029_0001
Figure imgf000029_0002
Table 9: Antibody Clone C (AvGn-C)
Figure imgf000030_0001
Figure imgf000030_0002
Table 10: Antibody Clone F (AvGn-F)
Figure imgf000031_0001
Figure imgf000031_0002
[0049] In some embodiments, SARS-CoV-2 binding agents ( e.g ., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VH region or VH domain. In other embodiments, SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VL region or VL chain. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein have a combination of (i) a VH domain or VH region and (ii) a VL domain or VL region.
[0050] In some embodiments, the CDRs disclosed herein include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-8). As described herein, a “consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and/or variable amino acids that vary within a given amino acid sequence. The CDR consensus sequences provided include CDRs corresponding to VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2 and/or VL CDR3. Consensus sequences of CDRs of SARS-CoV-2 binding agents, including an agent that binds to a SARS-CoV-2 spike glycoprotein, are shown in FIGS. 11A and 11 B. Accordingly, in some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region and/pr (b) a light chain variable (VL) region, wherein the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; and/or (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, a SARS-CoV-2 binding agent ( e.g ., antibody) described herein comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, a SARS-CoV-2 binding agent {e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, a SARS- CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; (2) a VL CDR2 having the amino acid sequence of XiAX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, the VL CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid. In some embodiments, the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of Xi AX2SRAT (SEQ ID NO: 111) wherein Xi and X2 are each independently a naturally occurring amino acid. In some embodiments, the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X2 A, I, L orV, and X3 is Q or R; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:115) wherein Xi is S, G or D; and/or (2) a VL CDR2 having the amino acid sequence of Xi AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S or T; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F. In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X2 A, I, L orV, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:115) wherein Xi is S, G or D; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S orT; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F. In some embodiments, a SARS-CoV-2 binding agent ( e.g ., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VFI CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X2 A, I, L orV, and X3 is Q or R; and (3) a VFI CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S orT; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F. In some embodiments, the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H. In some embodiments, the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R. In some embodiments, the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, the VL CDR1 of a SARS- CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D. In some embodiments, the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T. In some embodiments, the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
[0051] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Tables 1-8. In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, provided herein comprise a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
[0052] In some embodiments, SARS-CoV-2 binding agents ( e.g ., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8. In other embodiments, SARS-CoV-2 binding agents {e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six CDRs, VL CDRs listed in Tables 1-8. In yet other embodiments, SARS-CoV-2 binding agents (e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8 and one or more CDRs, including six VL CDRs listed in Tables 1-8.
[0053] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58- 64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32- 48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises four or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises five or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises six or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
[0054] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24. In some embodiments, the SARS- CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23.
[0055] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20. [0056] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0057] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18; and/or (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable region (VL) comprising
(i) a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21; and/or
(ii) a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22; and/or (iii) a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0058] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0059] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0060] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0061] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[0062] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[0063] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0064] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:1, 7, 12, 13, and 18; (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and (b) a light chain variable region (VL) comprising (i) a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21; (ii) a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22; and (iii) a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0065] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0066] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO: 11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0067] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0068] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17.
[0069] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent (. e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23.
[0070] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0071] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and/or a VL comprising an amino acid sequence of SEQ ID NO:26. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and a VL comprising an amino acid sequence of SEQ ID NO:26.
[0072] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35,
36, 39, 40, 42, 43, 45, 46, and 47. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35, 36, 39, 40, 42, 43, 45, 46, and 47.
[0073] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 32, 37, and 41. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 33, 38, 44, and 48. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[0074] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:34, 39, 42, and 45. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:36, 43, and 47.
[0075] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
[0076] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0077] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0078] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0079] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
[0080] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
[0081] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0082] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
[0083] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. [0084] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0085] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0086] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
[0087] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
[0088] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0089] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and/or a VL comprising an amino acid sequence of SEQ ID NO:50. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and a VL comprising an amino acid sequence of SEQ ID NO:50.
[0090] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
[0091] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 38, 44, 48, and 51. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[0092] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0093] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [0094] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0095] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0096] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0097] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[0098] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[0099] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00100] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 38,
44, 48, and 51 ; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [00101] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00102] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00103] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00104] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00105] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00106] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00107] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and/or a VL comprising an amino acid sequence of SEQ ID NO:57. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and a VL comprising an amino acid sequence of SEQ ID NO:57.
[00108] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
[00109] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 58, 60, and 62. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 59, 61, 63, and 64. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00110] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[00111] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [00112] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00113] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00114] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00115] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[00116] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00117] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00118] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00119] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. [00120] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00121] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00122] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00123] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00124] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00125] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and/or a VL comprising an amino acid sequence of SEQ ID NO:57. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and a VL comprising an amino acid sequence of SEQ ID NO:57.
[00126] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53,
54, 55, 67, 68, 70, 71, 73, and 74. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53, 54, 55, 67, 68, 70, 71, 73, and 74.
[00127] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00128] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:67, 70, and 73. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a selected from a group consisting group consisting of SEQ ID NO:68, 71, and 74.
[00129] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71 , and 74. [00130] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00131] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00132] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00133] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
[00134] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
[00135] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00136] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 66,
69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71 , and 74.
[00137] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00138] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. [00139] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00140] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
[00141] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
[00142] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00143] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and/or a VL comprising an amino acid sequence of SEQ ID NO:77. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and a VL comprising an amino acid sequence of SEQ ID NO:77.
[00144] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21, 23, 35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21 , 23, 35, 40, and 46.
[00145] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:78, 79, 80, 81 , and 82. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15 and 20.
[00146] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[00147] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00148] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00149] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00150] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00151] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[00152] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00153] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00154] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00155] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. [00156] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00157] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00158] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00159] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00160] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00161] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and/or a VL comprising an amino acid sequence of SEQ ID NO:84. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and a VL comprising an amino acid sequence of SEQ ID NO:84.
[00162] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95.
[00163] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:85, 88, 91 , 92, and 93. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 86, 89, 94, and 96. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00164] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:87, 90, and 95. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[00165] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [00166] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00167] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00168] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00169] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[00170] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00171] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00172] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [00173] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00174] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00175] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00176] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00177] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00178] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00179] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and/or a VL comprising an amino acid sequence of SEQ ID NO:98. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and a VL comprising an amino acid sequence of SEQ ID NO:98.
[00180] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104.
[00181] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 14, 99, 101, 103, and 105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00182] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 100, 102, and 104. [00183] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101 , 103, and 105; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104. [00184] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00185] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00186] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00187] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
[00188] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
[00189] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00190] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 99, 101 , 103, and 105; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
[00191] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00192] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 101 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00193] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. [00194] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102.
[00195] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
[00196] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00197] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and/or a VL comprising an amino acid sequence of SEQ ID NO: 107. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and a VL comprising an amino acid sequence of SEQ ID NO: 107.
[00198] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:118, 119, 120, 124, 125, 126, 129, 130, 131 , 132, 135, 136, 137, and 141. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 118, 119, 120, 124, 125, 126, 129, 130, 131, 132, 135, 136, 137, and 141 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140.
[00199] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 118, 124, 129, 130, and 135. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 119, 125, 131, 136, and 141. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:120, 126, 132, and 137.
[00200] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 121, 127, 133, and 138. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 122, 128, and 139. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 123, 134, and 140. [00201] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:119, 125, 131, 136, and 141; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
[00202] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00203] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 126; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00204] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. [00205] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 130; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
[00206] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 135; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 137; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140.
[00207] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00208] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131 , 136, and 141 ; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
[00209] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00210] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00211] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00212] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
[00213] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
[00214] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00215] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and/or a VL comprising an amino acid sequence of SEQ ID NO: 143. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and a VL comprising an amino acid sequence of SEQ ID NO: 143.
[00216] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165.
[00217] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 144, 150, 154, 155, and 160. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 145, 151 , 156, 161 , and 166. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 146, 152, 157, and 162.
[00218] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 147, 153, 158, and 163. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:90, 148, and 164. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 149, 159, and 165. [00219] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165. [00220] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
[00221] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 150; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 151 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00222] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 154; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
[00223] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 157; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
[00224] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 160; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 162; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165.
[00225] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
[00226] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165. [00227] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00228] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149. [00229] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00230] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 159. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159. [00231] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
[00232] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149. [00233] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and/or a VL comprising an amino acid sequence of SEQ ID NO: 168. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and a VL comprising an amino acid sequence of SEQ ID NO:168.
[00234] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and a light chain variable region having an amino acid sequence of SEQ ID NO:77; (vi) a heavy chain variable region having an amino acid sequence of SEQ ID NO:83 and a light chain variable region having an amino acid sequence of SEQ ID NO:84; (vii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:97 and a light chain variable region having an amino acid sequence of SEQ ID NO:98; and/or (viii) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 106 and a light chain variable region having an amino acid sequence of SEQ ID NO: 107; and/or (B)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and a light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (C)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:167 and a light chain variable region having an amino acid sequence of SEQ ID NO:168.
[00235] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO:167 and the light chain variable region having an amino acid sequence of SEQ ID NO: 168.
[00236] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 107; (ix) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 142, and/or a VL CDR1 , a VL CDR2, and a VL
CDR3 as set forth in SEQ ID NO: 143; or (x) a VH CDR1 , a VH CDR2, and a VH
CDR3 as set forth in SEQ ID NO: 167, and/or a VL CDR1 , a VL CDR2, and a VL
CDR3 as set forth in SEQ ID NO: 168.
[00237] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; or (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:107.
[00238] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143.
[00239] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
[00240] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies), including SARS-CoV-2 binding agents, are provided that compete with one of the exemplified SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein. Such binding agents may also bind to the same or essentially the same epitope as one of the herein exemplified SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, or an overlapping epitope. SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, that compete with or bind to the same or essentially the same epitope as the exemplified SARS-CoV-2 binding agents are expected to show similar functional properties. The exemplified SARS-CoV-2 binding agents (e.g., antibodies) include those with the VH and VL regions, and CDRs provided herein (see, e.g., Tables 1-8). Thus, as a specific example, the SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, that are provided include those that compete with an antibody comprising: (a) 1, 2, 3, 4, 5 or all 6 of the VH and VL CDRs identified in Tables 1-8; (b) a VH and a VL identified in Tables 1-8; or (c) two light chains each comprising a VL and two heavy chains each comprising a VH, including the VL and VH identified in Tables 1-8.
[00241] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the Kabat system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
[00242] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the Chothia system, which will be referred to herein as the “Chothia CDRs” (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al- Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1): 175-82; and U.S.
Patent No. 7,709,226).
[00243] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the ImMunoGeneTics (IMGT) system, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7:132-136 and Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212 (“IMGT CDRs”).
[00244] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the AbM system, which will be referred to herein as the “AbM CDRs,” for example as described in MacCallum et al., 1996, J. Mol. Biol., 262:732-745. See also, e.g., Martin, A., “Protein Sequence and Structure Analysis of Antibody Variable Domains,” in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001).
[00245] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the Contact system, which will be referred to herein as the “Contact CDRs” (see, e.g., MacCallum RM et al. , 1996, J Mol Biol 5: 732-745). The Contact CDRs are based on an analysis of the available complex crystal structures. [00246] In some embodiments, the position of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1 , CDR2, or CDR3) region of a SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary by one, two, three, four, five, or six amino acid positions so long as binding to SARS-CoV-2 (e.g., a SARS- CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). For example, in some embodiments, the position defining a CDR as identified in Tables 1-8 may vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the current CDR position, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the length of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). For example, in some embodiments, a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99- 105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78- 82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ( e.g ., a SARS-CoV-2 spike glycoprotein) is maintained {e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51- 55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained {e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In some embodiments, the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained {e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). Any method known in the art can be used to ascertain whether binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained, for example, the binding assays and conditions described in the Examples provided herein. For example, Examples 1 and 2 provided herein describe assays for measuring binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein).
[00247] In other embodiments, the SARS-CoV-2 binding agents (e.g., antibodies), including an agent that binds to a SARS-CoV-2 spike glycoprotein, presented herein that bind to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) comprise conservative sequence modifications as described herein. With respect to polypeptides that are SARS-CoV-2 binding agents ( e.g ., antibodies), including agents that binds to a SARS-CoV-2 spike glycoprotein, conservative sequence modifications include conservative amino acid substitutions that include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains {e.g., aspartic acid, glutamic acid), uncharged polar side chains {e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains {e.g., threonine, valine, isoleucine) and aromatic side chains {e.g., tyrosine, phenylalanine, tryptophan, histidine). In some embodiments, a predicted nonessential amino acid residue is replaced with another amino acid residue from the same side chain family. Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art {see, e.g., Brummell et al. , Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)). In some embodiments, the conservative sequence modifications described herein modify the amino acid sequences of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, by 50%, or 55%, or 60%, or 65%, or 70%, or 75%, or 80%, or 85%, or 90%, or 95%, or 98%, or 99%. In some embodiments, the nucleotide and amino acid sequence modifications refer to at most 1 , 2, 3, 4, 5, or 6 amino acid substitutions to the CDRs described in Tables 1-8. Thus, for example, each such CDR may contain up to 5 conservative amino acid substitutions, for example up to (not more than) 4 conservative amino acid substitutions, for example up to (not more than) 3 conservative amino acid substitutions, for example up to (not more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution.
[00248] The present disclosure also provides conjugates, including immunoconjugates comprising any one of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD), of the present disclosure, including those directly or indirectly linked another agent. For example, SARS-CoV-2 binding agents ( e.g ., antibodies), such agents that bind to a SARS- CoV-2 spike glycoprotein or a fragment thereof {e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD), of the present disclosure may be covalently bound by a synthetic linker to one or more agents.
[00249] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, described herein which bind to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein), may be linked or conjugated (directly or indirectly) to a polypeptide. In some embodiments, an SARS-CoV-2 binding agent (e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, is linked or conjugated (directly or indirectly) to an agent.
[00250] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein are conjugated or recombinantly linked (directly or indirectly) to a therapeutic agent or to a diagnostic or detectable agent. The conjugated or recombinantly linked antibodies can be useful, for example, for treating or preventing a disease or disorder such as an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition. The conjugated or recombinantly linked SARS-CoV-2 binding agents (e.g., antibodies) can be useful, for example, for monitoring or prognosing the onset, development, progression, and/or severity of an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
[00251] Such diagnosis and detection can be accomplished, for example, by coupling the SARS-CoV-2 binding agent (e.g., an antibody) to detectable substances including, for example: enzymes, including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, including, but not limited to, streptavidin/biotin or avidin/biotin; fluorescent materials, including, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; luminescent materials, including, but not limited to, luminol; bioluminescent materials, including, but not limited to, luciferase, luciferin, or aequorin; chemiluminescent material, including, but not limited to, an acridinium based compound or a HALOTAG; radioactive materials, including, but not limited to, iodine (1311, 1251, 1231, and 1211), carbon (14C), sulfur (35S), tritium (3H), indium (1151h, 1131h, 1121h, and 1111h), technetium (99Tc), thallium (201 Ti), gallium (68Ga and 67Ga), palladium (103Pd), molybdenum (99Mo), xenon (133Xe), fluorine (18F), 153Sm, 177Lu, 159Gd, 149Pm, 140La, 175Yb, 166Ho, 90Y, 47Sc, 186Re, 188Re, 142Pr, 105Rh, 97Ru, 68Ge, 57Co, 65Zn, 85Sr, 32P, 153Gd, 169Yb, 51 Cr, 54Mn, 75Se, 113Sn, or 117Sn; positron emitting metals using various positron emission tomographies; and non-radioactive paramagnetic metal ions.
[00252] Also provided herein are SARS-CoV-2 binding agents ( e.g ., antibodies) that are recombinantly linked or conjugated (covalent or non-covalent conjugations, directly or indirectly) to a heterologous protein or polypeptide (or fragment thereof, for example, to a polypeptide {e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids) to generate fusion proteins, as well as uses thereof. In particular, provided herein are fusion proteins comprising an antigen-binding fragment of SARS-CoV-2 binding agents (e.g., an antibody), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein (e.g., comprising CDR1 , CDR2, and/or CDR3 of VH and/or VL) and a heterologous protein, polypeptide, or peptide. In some embodiments, the heterologous protein, polypeptide, or peptide that the SARS-CoV-2 binding agent (e.g., antibody) is linked to is useful for targeting the SARS-CoV-2 binding agent to a particular cell.
[00253] Moreover, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein can be linked (directly or indirectly) to marker or “tag” sequences, such as a peptide, to facilitate purification. In some embodiments, the marker or tag amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (see, e.g., QIAGEN, Inc.), among others, many of which are commercially available. For example, as described in Gentz et al., 1989, Proc. Natl. Acad. Sci. USA 86:821-24, hexa-histidine provides for convenient purification of a fusion protein. Other peptide tags useful for purification include, but are not limited to, the hemagglutinin (‘ΉA”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767-78), and the “FLAG” tag.
[00254] Fusion proteins may be generated, for example, through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”). DNA shuffling may be employed to alter the activities of the SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, as provided herein, including, for example, SARS-CoV-2 binding agents with higher affinities and lower dissociation rates (see, e.g., U.S. Pat. Nos. 5,605,793; 5,811,238; 5,830,721; 5,834,252; and 5,837,458; Patten etal., 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol. 16(2):76- 82; Hansson etal., 1999, J. Mol. Biol. 287:265-76; and Lorenzo and Blasco, 1998, Biotechniques 24(2):308-13). In some embodiments, SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination. One or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., antibody) provided herein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
[00255] SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein can also be linked or conjugated (directly or indirectly) to a second antibody to form an antibody heteroconjugate (see, e.g., U.S. Pat. No. 4,676,980).
[00256] SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein may also be attached to solid supports, which are useful for immunoassays or purification of the target antigen. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene.
[00257] The linker may be a “cleavable linker” facilitating release of the linked or conjugated agent in a cell, but non-cleavable linkers are also contemplated herein. Linkers for use in conjugates of the present disclosure include, without limitation, acid labile linkers (e.g., hydrazone linkers), disulfide-containing linkers, peptidase- sensitive linkers (e.g., peptide linkers comprising amino acids, for example, valine and/or citrulline such as citrulline-valine or phenylalanine-lysine), photolabile linkers, dimethyl linkers (see, e.g., Chari etai, 1992, Cancer Res. 52:127-31; and U.S. Pat. No. 5,208,020), thioether linkers, or hydrophilic linkers designed to evade multidrug transporter-mediated resistance (see, e.g., Kovtun etai, 2010, Cancer Res. 70:2528-37).
[00258] Conjugates of an antibody and agent may be made using a variety of bifunctional protein coupling agents such as BMPS, EMCS, GMBS, HBVS, LC- SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo- GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate). The present disclosure further contemplates that conjugates of antibodies and agents may be prepared using any suitable methods as disclosed in the art (see, e.g., Bioconjugate Techniques (Hermanson ed., 2d ed. 2008)).
[00259] Conventional conjugation strategies for antibodies and agents have been based on random conjugation chemistries involving the e-amino group of Lys residues or the thiol group of Cys residues, which results in heterogeneous conjugates. Recently developed techniques allow site-specific conjugation to antibodies, resulting in homogeneous loading and avoiding conjugate subpopulations with altered antigen-binding or pharmacokinetics. These include engineering of “thiomabs” comprising cysteine substitutions at positions on the heavy and light chains that provide reactive thiol groups and do not disrupt immunoglobulin folding and assembly or alter antigen binding (see, e.g., Junutula et at., 2008, J. Immunol. Meth. 332: 41-52; and Junutula etai, 2008, Nature Biotechnol. 26:925- 32). In another method, selenocysteine is cotranslationally inserted into an antibody sequence by recoding the stop codon UGA from termination to selenocysteine insertion, allowing site specific covalent conjugation at the nucleophilic selenol group of selenocysteine in the presence of the other natural amino acids (see, e.g., Hofer etai, 2008, Proc. Natl. Acad. Sci. USA 105:12451-56; and Hofer et a/., 2009, Biochemistry 48(50): 12047-57).
[00260] SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein may be monospecific, bispecific, trispecific or of greater multispecificity. Such agents may include antibodies. Multispecific antibodies such as bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens (e.g., SARS-CoV-2 and SARS-CoV-1) or two different epitopes on the same antigen (e.g., a SARS-CoV-2 spike glycoprotein). In some embodiments, the multispecific antibodies can be constructed based on the sequences of the antibodies provided herein, e.g., the CDR sequences listed in Tables 1-8. In some embodiments, the multispecific antibodies provided herein are bispecific antibodies. In some embodiments, bispecific antibodies are mouse, chimeric, human or humanized antibodies. In some embodiments, multispecific antibody molecules can comprise more than one antigen-binding site, in which different sites are specific for different antigens. In some embodiments, multispecific antibody molecules can bind more than one ( e.g ., two or more) epitopes on the same antigen. In some embodiments, one of the binding specificities is for SARS-CoV-2 and the other is for any other antigen {e.g., SARS-CoV-1). Bispecific antibodies can be prepared in various antibody formats, including as full length antibodies or antibody fragments {e.g., F(ab’)2 bispecific antibodies).
[00261] Methods for making multispecific antibodies are known in the art, such as, by co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (see, e.g., Milstein and Cuello, 1983, Nature 305:537-40). For further details of generating multispecific antibodies (e.g., bispecific antibodies), see, for example, Bispecific Antibodies (Kontermann ed., 2011 ).
[00262] Exemplary structures of multispecific antibodies are known in the art and are further described in Weidle et a!., 2013, Cancer Genom ics & Proteom ics 10: 1- 18; Brinkman etal., 2017, MABS, 9:2, 182-212; Godar etal., 2018, Expert Opinion on Therapeutic Patents, 28:3, 251-276; and Spiess etai, 2015, Mol. Immunol. 67 95-106.
[00263] For example, bispecific antibody molecules can be classified into different structural groups: (i) bispecific immunoglobulin G (BslgG); (ii) IgG appended with an additional antigen-binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates. As a non-limiting example, BslgG formats can include crossMab, DAF (two-in-one), DAF (four-in-one),
DutaMab, DT-lgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair, Fab-arm exchange, SEEDbody, triomab, LUZ-Y, Fcab, kl-body, orthogonal Fab.
[00264] In some embodiments, BslgG comprises heavy chains that are engineered for heterodimerization. For example, heavy chains can be engineered for heterodimerization using a "knobs-into-holes" strategy, a SEED platform, a common heavy chain (e.g., in kl-bodies), and use of heterodimeric Fc regions. Strategies are known in the art to avoid heavy chain pairing of homodimers in BslgG, including knobs-into-holes, duobody, azymetric, charge pair, FIA-TF, SEEDbody, and differential protein A affinity.
[00265] Another bispecific antibody format is IgG appended with an additional antigen-binding moiety. For example, monospecific IgG can be engineered to have bispecificity by appending an additional antigen-binding unit onto the monospecific IgG, e.g., at the N- or C- terminus of either the heavy or light chain. Exemplary additional antigen-binding units include single domain antibodies {e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable domains {e.g., single chain variable fragments or variable fragments). Non-limiting examples of appended IgG formats include dual variable domain IgG (DVD-lg), lgG(H)-scFv, scFv-(H)lgG, lgG(L)-scFv, scFv-(L)lgG, lgG(L,H)-Fv, lgG(H)-V, V(H)-lgG, lgG(L)-V, V(L)-lgG, KIH IgG-scFab, 2scFv-lgG, lgG-2scFv, scFv4-lg, zybody, and DVI-lgG (four- in-one). See, Spiess et al. Mol. Immunol. 67(2015):95-106.
[00266] Bispecific antibody fragments (BsAb) are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region. In embodiments, bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell. Non-limiting examples of bispecific antibody fragments include, but are not limited to, nanobody, nanobody- FIAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CFI3, Diabody-CFI3, triple body, miniantibody, minibody, TriBi minibody, scFv-CFI3 KIH, Fab-scFv, scFv- CH-CL-scFv, F(ab')2, F(ab')2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody.
[00267] Bispecific fusion proteins include antibody fragments linked to other proteins. For example bispecific fusion proteins can be linked to other proteins to add additional specificity and/or functionality. In some embodiments, the dock-and- lock (DNL) method can be used to generate bispecific antibody molecules with higher valency. For example, bispecific antibody fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments. In embodiments, chemical conjugation, for example, chemical conjugation of antibodies and/or antibody fragments, can be used to create BsAb molecules. An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof. In embodiments, the conjugation improves the serum half-life.
[00268] Methods of production of multispecific antibodies, including bispecific antibodies, are known in the art. For example, multispecific antibodies, including bispecific antibodies can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly or by expression of the component antibodies in a single host cell. Purification of multispecific antibody molecules can be performed by various methods known in the art, such as affinity chromatography.
[00269] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, disclosed herein can be provided in any antibody format disclosed herein or known in the art. As a non limiting example, in some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, can be selected from Fabs-in-tandem-lg (FIT-lg); DVD-lg; hybrid hybridoma (quadroma or tetradoma); anticalin platform (Pieris); diabodies; single chain diabodies; tandem single chain Fv fragments; TandAbs, Trispecific Abs (Affimed); Darts dual affinity retargeting (Macrogenics); Bispecific Xmabs (Xencor); Bispecific T cell engagers (Bites; Amgen; 55kDa); Triplebodies; Tribody = Fab-scFv Fusion Protein multifunctional recombinant antibody derivates (CreativeBiolabs); Duobody platform (Genmab); dock and lock platform; knobs-into-holes (KIH) platform; Flumanized bispecific IgG antibody (REGN1979) (Regeneron); Mab2 bispecific antibodies (F- Star); DVD-lg = dual variable domain immunoglobulin (Abbott); kappa-lambda bodies; TBTI = tetravalent bispecific tandem Ig; and CrossMab (Roche).
[00270] In some embodiments, a multispecific {e.g., bispecific) antibody disclosed herein comprises an SARS-CoV-2 binding agent and a second binding agent, wherein the SARS-CoV-2 binding agent (e.g., antibody) comprises a VL and/or VH amino acid sequence of Tables 1 -8. In some embodiments, a bispecific antibody disclosed herein comprises an SARS-CoV-2 binding agent that comprises a VL and/or VH amino acid sequence of Tables 1-8 and further comprises a VL and/or VH amino acid sequence of another antibody.
[00271] In some embodiments, provided herein is a bispecific antibody which binds to SARS -CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) that comprises VL and VH CDRs (e.g., VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3), wherein at least one VH CDR3 of the bispecific antibody comprises the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
[00272] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 1 (SEQ ID NOS:1, 2, 3, 4, 5 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:7, 8, 9, 10, 11 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:12, 2, 3, 4, 5, and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 13, 14, 15, 16,
11 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 18, 19, 20, 21, 22 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 1 , 24, 3, 4, 5 and/or 6).
[00273] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 2 (SEQ ID NOS:32, 33, 3, 34, 35 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:37, 38, 9, 39, 40 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:12, 33, 3, 34, 35 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:41 , 14, 15, 42, 40 and/or 43). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS: 18, 44, 20, 45, 46 and/or 47). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:32, 48, 3, 34, 35 and/or 36). [00274] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 3 (SEQ ID NOS:1 , 51 , 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:7, 38, 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:12, 51, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 13, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 18, 44, 20, 55, 46 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:1 , 48, 3, 52, 35 and/or 6). [00275] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 4 (SEQ ID NOS:58, 59, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:60, 61 , 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:12, 59, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:62, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS: 18, 63, 20, 55, 46, and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:58, 64, 3, 52, 35 and/or 6). [00276] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 5 (SEQ ID NOS:1 , 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:7, 69, 9, 53, 70 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:12, 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS: 13, 14, 15, 54, 70 and/or 71). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:18, 72, 20, 55, 73 and/or 74). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:1 , 75, 3, 52, 67 and/or 68). [00277] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 6 (SEQ ID NOS:78, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:79, 69, 9, 10, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:80, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:81 , 14, 15, 16, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:82, 72, 20, 21 , 46 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:78, 75, 3, 4, 35 and/or 6). [00278] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 7 (SEQ ID NOS:85, 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:88, 89, 9, 53, 90 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:91 , 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:92, 14, 15, 54, 90 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:93, 94, 20, 55, 95 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:85, 96, 3, 52, 87 and/or 6). [00279] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 8 (SEQ ID NOS:1, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS:7, 101, 9, 10, 40 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 12, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 13, 14, 15, 16, 40 and/or 102). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 18, 103, 20, 21 , 46 and/or 104). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 1 , 105, 3, 4, 35 and/or 100).
[00280] Antibodies that bind SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be obtained by any suitable method, such as (but not limited to) immunization with whole cells expressing a SARS-CoV-2 spike glycoprotein or a fragment thereof and collection of antibodies, recombinant techniques, or screening libraries of antibodies or antibody fragments using a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD). Monoclonal antibodies may be generated using a variety of known techniques (see, for example, Coligan et al. (eds.), Current Protocols in Immunology, 1:2.5.12.6.7 (John Wiley & Sons 1991); Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol (eds.) (1980); Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press (1988); and Picksley et al., “Production of monoclonal antibodies against proteins expressed in E. coli," in DNA Cloning 2: Expression Systems, 2nd Edition, Glover et al. (eds.), page 93 (Oxford University Press 1995)). One exemplary technique for generating monoclonal antibodies comprises immunizing an animal with a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) and generating a hybridoma from spleen cells taken from the animal. A hybridoma may produce a monoclonal antibody or antibody fragment that binds SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD).
[00281] Likewise, human antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be generated by any of a number of techniques including, but not limited to, Epstein Barr Virus (EBV) transformation of human peripheral blood cells ( e.g ., containing B lymphocytes), in vitro immunization of human B cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein. Methods for obtaining human antibodies from transgenic animals are further described, for example, in Bruggemann et al. , Curr. Opin. Biotechnol., 8: 45558, 1997; Jakobovits et al., Ann. N. Y. Acad. Sci., 764: 52535, 1995; Green et al., Nature Genet., 7: 13- 21, 1994; Lonberg et al., Nature, 368: 856-859, 1994; Taylor et al., Int. Immun. 6: 579-591, 1994; and U.S. Patent No. 5,877,397.
[00282] For example, human antibodies that bind SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD) may be obtained from transgenic animals that have been engineered to produce specific human antibodies in response to antigenic challenge. For example, International Patent Publication No. WO 98/24893 discloses transgenic animals having a human Ig locus, wherein the animals do not produce functional endogenous immunoglobulins due to the inactivation of endogenous heavy and light chain loci. Transgenic non-primate mammalian hosts capable of mounting an immune response to an immunogen, wherein the antibodies have primate constant and/or variable regions, and wherein the endogenous immunoglobulin encoding loci are substituted or inactivated, also have been described. International Patent Publication No. WO 96/30498 discloses the use of the Cre/Lox system to modify the immunoglobulin locus in a mammal, such as to replace all or a portion of the constant or variable region to form a modified antibody molecule. International Patent Publication No.
WO 94/02602 discloses non-human mammalian hosts having inactivated endogenous Ig loci and functional human Ig loci. U.S. Patent No. 5,939,598 discloses methods of making transgenic mice in which the mice lack endogenous heavy chains, and express an exogenous immunoglobulin locus comprising one or more xenogeneic constant regions. Using a transgenic animal, such as a transgenic animal described herein, an immune response can be produced to a selected antigenic molecule, and antibody producing cells can be removed from the animal and used to produce hybridomas that secrete human-derived monoclonal antibodies. Immunization protocols, adjuvants, and the like are known in the art, and are used in immunization of, for example, a transgenic mouse as described in International Patent Publication No. WO 96/33735. The monoclonal antibodies can be tested for the ability to inhibit or neutralize the biological activity or physiological effect of the corresponding protein.
[00283] Humanized antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be produced using techniques known to those skilled in the art (Zhang et al., Molecular Immunology, 42(12): 1445-1451, 2005; Hwang et al., Methods, 36(1): 35- 42, 2005; Dall'Acqua et al., Methods, 36(1): 43-60, 2005; Clark, Immunology Today, 21(8): 397-402, 2000, and U.S. Patent Nos. 6,180,370; 6,054,927; 5,869,619; 5,861,155; 5,712,120; and 4,816,567.
[00284] Further provided are the materials for generating SARS-CoV-2 binding agents, including agents that bind a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD). For example, an isolated cell (e.g., a hybridoma) may produce an SARS-CoV-2 binding agent (e.g., antibody or antibody fragment). In this regard, a cell (e.g., an isolated cell) may produce an antibody or fragment thereof comprising a VH and a VL as shown in Tables 1 -8. In some embodiments, one or more polynucleotides comprising one or more nucleic acid sequences encoding a SARS-CoV-2 binding agent (e.g., antibody or antibody fragment) may be generated. In some embodiments, the one or more polynucleotides are isolated and/or recombinant polynucleotides. In some embodiments, the one or more isolated polynucleotides comprise one or more nucleotide sequences that encode an antibody heavy chain variable region (VH) and/or an antibody light chain variable region (VL), wherein the VH and the VL comprise complementarity determining regions (CDRs) as shown in Tables 1-8. [00285] In some embodiments, one or more vectors (e.g., expression vectors) may comprise one or more polynucleotides for expression of one or more polynucleotides in a suitable host cell. Such vectors are useful, e.g., for amplifying the polynucleotides in host cells to create useful quantities thereof, and for expressing binding agents, such as antibodies or antibody fragments, using recombinant techniques. Vectors also are useful in “gene therapy” treatment regimens, wherein, for example, one or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., an antibody, including a multispecific antibody such as a bispecific antibody), is introduced into a subject suffering from or at risk of suffering from a SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
[00286] In some embodiments, one or more vectors are expression vectors wherein one or more polynucleotides are operatively linked to one or more polynucleotides comprising expression control sequences. Autonomously replicating recombinant expression constructs such as plasmid and viral DNA vectors incorporating one or more polynucleotides encoding antibody sequences that bind SARS-CoV-2 are specifically contemplated. Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression construct is to be utilized. Promoter and enhancer sequences are generally selected for the ability to increase gene expression, while operator sequences are generally selected for the ability to regulate gene expression. Expression constructs may also include sequences encoding one or more selectable markers that permit identification of host cells bearing the construct. Expression constructs may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell. In some embodiments, expression constructs of the can also include sequences necessary for replication in a host cell.
[00287] Exemplary expression control sequences include promoter/enhancer sequences, e.g., cytomegalovirus promoter/enhancer (Lehner et al. , J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41: 521-530, 1985); Rous sarcoma virus promoter (Davis et al., Hum. Gene Then, 4: 151, 1993); Tie promoter (Korhonen et al., Blood, 86(5): 1828-1835, 1995); simian virus 40 promoter; DRA (downregulated in adenoma; Alrefai et al., Am. J. Physiol. Gastrointest. Liver Physiol., 293: G923-G934, 2007); MCT1 (monocarboxylate transporter 1 ; Cuff et al., Am. J. Physiol. Gastrointet. Liver Physiol., G977-G979. 2005); and Mathl (mouse atonal homolog 1; Shroyer et al., Gastroenterology, 132: 2477-2478, 2007), for expression in mammalian cells, the promoter being operatively linked upstream (e.g., 5’) of a polypeptide coding sequence. In another variation, the promoter is an epithelial-specific promoter or endothelial-specific promoter. Polynucleotides may also optionally include a suitable polyadenylation sequence (e.g., the SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (e.g., 3’) of the polypeptide coding sequence. [00288] If desired, the one or more polynucleotides also optionally comprise nucleotide sequences encoding secretory signal peptides fused in frame with the polypeptide sequences. The secretory signal peptides direct secretion of the antibody polypeptides by the cells that express the one or more polynucleotides, and are cleaved by the cell from the secreted polypeptides. The one or more polynucleotides may further optionally comprise sequences whose only intended function is to facilitate large scale production of the vector. One can manufacture and administer polynucleotides for gene therapy using procedures that have been described in the literature for a variety of transgenes. See, e.g., Isner et al. , Circulation, 91: 2687-2692, 1995; and Isner et al., Human Gene Therapy, 7: 989- 1011, 1996.
[00289] In some embodiments, polynucleotides may further comprise additional sequences to facilitate uptake by host cells and expression of the antibody or fragment thereof (and/or any other peptide). In some embodiments, a “naked” transgene encoding an antibody or fragment thereof described herein (e.g., a transgene without a viral, liposomal, or other vector to facilitate transfection) is employed.
[00290] Any suitable vectors may be used to introduce one or more polynucleotides that encode an antibody or fragment thereof into the host.
Exemplary vectors that have been described include replication deficient retroviral vectors, including but not limited to lentivirus vectors (Kim et al., J. Virol., 72(1): 811- 816, 1998; Kingsman & Johnson, Scrip Magazine, October, 1998, pp. 43-46); parvoviral vectors, such as adeno-associated viral (AAV) vectors (U.S. Patent Nos. 5,474,935; 5,139,941 ; 5,622,856; 5,658,776; 5,773,289; 5,789,390; 5,834,441; 5,863,541; 5,851 ,521 ; 5,252,479; Gnatenko et al., J. Invest. Med., 45: 87-98, 1997); adenoviral (AV) vectors (U.S. Patent Nos. 5,792,453; 5,824,544; 5,707,618; 5,693,509; 5,670,488; 5,585,362; Quantin et al., Proc. Natl. Acad. Sci. USA, 89: 2581-2584, 1992; Stratford Perricaudet et al., J. Clin. Invest., 90: 626-630, 1992; and Rosenfeld et al., Cell, 68: 143-155, 1992); an adenoviral adeno-associated viral chimeric (U.S. Patent No. 5,856,152) or a vaccinia viral or a herpesviral vector (U.S. Patent Nos. 5,879,934; 5,849,571; 5,830,727; 5,661,033; 5,328,688); Lipofectin mediated gene transfer (BRL); liposomal vectors (U.S. Patent No. 5,631,237); and combinations thereof. Any of these expression vectors can be prepared using recombinant DNA techniques as described in, e.g., Sambrook et al., Molecular Cloning, a Laboratory Manual, 2d edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989), and Ausubel et al. , Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New York, N.Y. (1994). Optionally, viral vectors are rendered replication-deficient by, e.g., deleting or disrupting select genes required for viral replication.
[00291] Other non-viral delivery mechanisms contemplated include calcium phosphate precipitation (Graham and Van Der Eb, Virology, 52: 456-467, 1973;
Chen and Okayama, Mol. Cell Biol., 7: 2745-2752, 1987; Rippe et al., Mol. Cell Biol., 10: 689-695, 1990) DEAE-dextran (Gopal, Mol. Cell Biol., 5: 1188-1190, 1985), electroporation (Tur-Kaspa et al., Mol. Cell Biol., 6: 716-718, 1986; Potter et al.,
Proc. Nat. Acad. Sci. USA, 81: 7161-7165, 1984), direct microinjection (Harland and Weintraub, J. Cell Biol., 101: 1094-1099, 1985, DNA-loaded liposomes (Nicolau and Sene, Biochim. Biophys. Acta, 721: 185-190, 1982; Fraley et al., Proc. Natl. Acad. Sci. USA, 76: 3348-3352, 1979; Feigner, Sci Am., 276(6): 102-6, 1997; Feigner,
Hum Gene Ther., 7(15): 1791-3, 1996), cell sonication (Fechheimer et al., Proc. Natl. Acad. Sci. USA, 84: 8463-8467, 1987), gene bombardment using high velocity microprojectiles (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990), and receptor-mediated transfection (Wu and Wu, J. Biol. Chem., 262: 4429-4432, 1987; Wu and Wu, Biochemistry, 27: 887-892, 1988; Wu and Wu, Adv. Drug Delivery Rev., 12: 159-167, 1993).
[00292] An expression vector (or the antibody or fragment thereof discussed herein) may be entrapped in a liposome. See, e.g., Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104 (1991); Radler et al., Science, 275(5301): 810-814, 1997). Also contemplated are various commercial approaches involving “Npofection” technology. In some embodiments, the liposome may be complexed with a hemagglutinating virus (HVJ). This has been shown to facilitate fusion with the cell membrane and promote cell entry of liposome-encapsulated DNA (Kaneda et al., Science, 243: 375-378, 1989). In other embodiments, the liposome is complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al., J. Biol. Chem., 266: 3361-3364, 1991). In some embodiments, the liposome are complexed or employed in conjunction with both HVJ and HMG-1. Such expression constructs have been successfully employed in transfer and expression of nucleic acid in vitro and in vivo. In some embodiments, an SARS-CoV-2 binding agent ( e.g ., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, is included in the liposome to target the liposome to cells.
[00293] A cell may comprise one or more polynucleotide or vectors, e.g., the cell is transformed or transfected with one or more polynucleotides encoding a SARS-CoV- 2 binding agent {e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, or one or more vectors comprising the one or more polynucleotides. In some embodiments, cells express a SARS-CoV-2 binding agent (e.g., antibody), containing one or more, including six CDRs having at least 75% identity to the CDRs identified in Tables 1-8. In some embodiments, the cells express a SARS-CoV-2 binding agent (e.g., antibody) containing a VH and/or a VL comprising CDRs as identified in Tables 1-8. The cells may be prokaryotic cells, such as Escherichia coli (see, e.g., Pluckthun et al. , Methods EnzymoL, 178: 497- SIS, 1989), or eukaryotic cells, such as an animal cell (e.g., a myeloma cell, Chinese Hamster Ovary cell, or hybridoma cell), yeast (e.g., Saccharomyces cerevisiae), or a plant cell (e.g., a tobacco, corn, soybean, or rice cell). Use of mammalian host cells may provide for translational modifications (e.g., glycosylation, truncation, lipidation, and phosphorylation) that may be desirable to confer optimal biological activity on recombinant expression products. Similarly, polypeptides (e.g., SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein) may be glycosylated or non-glycosylated and/or have been covalently modified to include one or more water soluble polymer attachments such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
[00294] Methods for introducing DNA or RNA into a host cell are well known and include transformation, transfection, electroporation, nuclear injection, or fusion with carriers such as liposomes, micelles, ghost cells, and protoplasts. Such host cells are useful for amplifying polynucleotides and also for expressing polypeptides encoded by the polynucleotides. In this regard, a process for the production of a SARS-CoV-2 binding agent (e.g., antibody) may comprise culturing a host cell as described herein and isolating the SARS-CoV-2 binding agent. Transferring a naked DNA expression construct into cells can be accomplished using particle bombardment, which depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327: 70-73, 1987). Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990). The microprojectiles used have consisted of biologically inert substances such as tungsten or gold beads. A host cell may be isolated and/or purified. A host cell also may be a cell transformed in vivo to cause transient or permanent expression of the polypeptide in vivo. A host cell may also be an isolated cell transformed ex vivo and introduced post-transformation, e.g., to produce the polypeptide in vivo for therapeutic purposes. The definition of host cell explicitly excludes a transgenic human being.
[00295] A variety of methods for producing antibodies from polynucleotides are generally well-known. For example, basic molecular biology procedures are described by Maniatis et al., Molecular Cloning, A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, New York, 1989 (see also Maniatis et al, 3rd ed., Cold Spring Harbor Laboratory, New York, 2001). Additionally, numerous publications describe techniques suitable for the preparation of antibodies by manipulation of DNA, creation of expression vectors, and transformation and culture of appropriate cells (see, e.g., Mountain and Adair, Chapter 1 in Biotechnology and Genetic Engineering Reviews, Tombs ed., Intercept, Andover, UK, 1992); and Current Protocols in Molecular Biology, Ausubel ed., Wiley Interscience, New York, 1999). [00296] A SARS-CoV-2 binding agent (e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2- S1, SARS-CoV-2-RBD), is produced using any suitable method, e.g., isolated from an immunized animal, recombinantly or synthetically generated, or genetically- engineered, including as described above. Antibody fragments derived from an antibody are obtained by, e.g., proteolytic hydrolysis of an antibody. For example, papain or pepsin digestion of whole antibodies yields a 5S fragment termed F(ab’)2 or two monovalent Fab fragments and an Fc fragment, respectively. F(ab)2 can be further cleaved using a thiol reducing agent to produce 3.5S Fab monovalent fragments. Methods of generating antibody fragments are further described in, for example, Edelman et al., Methods in Enzymology, 1 : 422 Academic Press (1967); Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244, 1960; Porter, Biochem. J., 73: 119-127, 1959; U.S. Patent No. 4,331 ,647; and by Andrews, S.M. and Titus, J.A. in Current Protocols in Immunology (Coligan et al. , eds), John Wiley & Sons, New York (2003), pages 2.8.1 2.8.10 and 2.10A.1 2.10A.5.
[00297] A SARS-CoV-2 binding agent (e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2- S1 , SARS-CoV-2-RBD), can be genetically engineered. For example, in various aspects, a SARS-CoV-2 binding agent or an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) comprises, e.g., a variable region domain generated by recombinant DNA engineering techniques. In this regard, a variable region is optionally modified by insertions, deletions, or changes in the amino acid sequence of the antibody to produce an antibody of interest, including as described above. Polynucleotides encoding complementarity determining regions (CDRs) of interest are prepared, for example, by using polymerase chain reaction to synthesize variable regions using mRNA of antibody producing cells as a template (see, for example, Courtenay Luck, “Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al. (eds.), page 166 (Cambridge University Press 1995); Ward et al., “Genetic Manipulation and Expression of Antibodies,” in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), page 137 (Wiley Liss, Inc. 1995); and Larrick et al., Methods: A Companion to Methods in Enzymology, 2: 106-110, 1991 ). Current antibody manipulation techniques allow construction of engineered variable region domains containing at least one CDR and, optionally, one or more framework amino acids from a first antibody and the remainder of the variable region domain from a second antibody. Such techniques are used, e.g., to humanize an antibody or to improve its affinity for a binding target.
[00298] “Humanized antibodies” are antibodies in which CDRs of heavy and light variable chains of non-human immunoglobulin are transferred into a human variable domain. Constant regions need not be present, but if they are, they optionally are substantially identical to human immunoglobulin constant regions, e.g., at least about 85-90%, about 95%, 96%, 97%, 98%, 99% or more identical, in some embodiments. Hence, in some instances, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences. For example, in one aspect, humanized antibodies are human immunoglobulins {e.g., host antibody) in which hypervariable region residues of the host antibody are replaced by hypervariable region residues from a non human species (donor antibody) such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
[00299] In some embodiments, the antibody is a human antibody, including, but not limited to, an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences as described, for example, in Kabat et al. (1991) Sequences of proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242. If the antibody contains a constant region, the constant region also preferably is derived from human germline immunoglobulin sequences. Human antibodies may comprise amino acid residues not encoded by human germline immunoglobulin sequences, for example, to enhance the activity of the antibody, but do not comprise CDRs derived from other species (e.g., a mouse CDR placed within a human variable framework region).
[00300] SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein, including agents that bind to a SARS-CoV-2 spike glycoprotein (e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein (e.g., SARS-CoV-2-S1), and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein (e.g., SARS- CoV-2-RBD), are useful in methods of treating, preventing, or alleviating a SARS- CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition.
[00301] In some embodiments, provided herein are methods of treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition, in a subject by administering to the subject an effective amount of a SARS CoV-2 binding agent (e.g., antibody) disclosed herein.
[00302] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) provided herein are used to prevent a SARS-CoV-2 related disease, disorder, or condition (e.g., infection). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are used for prevention as “prophylactics” or “prophylactic agents.” In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject prior to or at an early stage of disease (e.g., prior to infection). In some embodiments, SARS-CoV-2 binding agents ( e.g ., antibodies) disclosed herein are administered to a subject as a prophylactic to prevent a SARS-CoV-2 related disease {e.g., infection).
[00303] In some embodiments, administration of SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein can occur prior to SARS-CoV-2 related disease {e.g., infection) or prior to manifestation of symptoms characteristic of SARS-CoV-2 related disease {e.g., infection). For example, in some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject at risk for SARS-CoV-2 related disease (e.g., infection) (e.g., subjects who may have come into contact with a SARS-CoV-2 infected person, subjects exhibiting one or more symptoms of SARS-CoV-2 related disease (e.g., infection), or subjects who are at high risk of exposure to SARS-CoV-2, including, for example, medical professionals such as doctors, nurses, parmedics, medical technicians and assistants). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject at elevated risk for a SARS-CoV-2 related disease, including mortality from such disease. For example, subjects are at elevated risk for SARS-CoV-2 related mortality if one or more coexisting factors or disorders is present, including elevated age, elevated body mass index, history of smoking, chronic obstructive pulmonary disease, diabetes, hypertension, coronary heart disease, cerebrovascular disease, hepatitis B infection, cancer, chronic renal disease, and immunodeficiency. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject who may have come in contact with SARS-CoV-2 and is asymptomatic.
[00304] In some embodiments, SARS-CoV-2 agents (e.g., antibodies) disclosed herein are administered prior to a SARS-CoV-2 related disease (e.g., infection) or manifestation of symptoms such that SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition is prevented or delayed in its progression.
[00305] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to treat a subject diagnosed with a SARS-CoV-2 related disease (e.g., infection). A subject may be diagnosed with a SARS-CoV-2 related disease (e.g., infection) using any method known or developed in the art. For example, SARS-CoV-2 binding agents (e.g., antibodies) provided herein are used in treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition, in a subject who has undergone confirmatory testing for a SARS-CoV-2 related disease (. e.g ., infection), using any testing known in the art including molecular testing ( e.g ., PCR), serological testing (ELISA), and viral culture.
[00306] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) are useful in a method of treating, preventing or alleviating one or more symptoms of a SARS-CoV-2-related disease, disorder, or condition in a subject, wherein the method comprises administering a SARS-CoV-2 agent {e.g., antibody) disclosed herein to the subject.
[00307] Symptoms of a SARS-CoV-2-related disease, disorder, or condition can include cough, dyspnea, chest tightness, fever, adverse Gl effects, fatigue, myalgia, arthralgia, lymphocytopenia, conjunctival congestion, nasal congestion, headache, sore throat, sputum production, hemoptysis, shortness of breath, nausea, vomiting, diarrhea, chills, throat congestion, tonsil swelling, lymph node enlargement, rash, pain or pressure in the chest, difficulty in breathing, reduced clarity of vision, loss of taste or smell, and confusion. SARS-CoV-2 related diseases, disorders, or conditions related by SARS-CoV-2 include pneumonia (e.g., atypical pneumonia, acute respiratory distress syndrome (ARDS), multiple-organ failure, and cytokine storm). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject who has symptoms of a SARS-CoV-2 related disease, disorder, or condition (e.g., an infection such as a viral respiratory infection), for example, symptoms associated with SARS-CoV-2 related disease (e.g., infection) based on a clinical assessment (e.g., to distinguish an influenza infection or other pneumonia).
[00308] In some embodiments, one or more symptoms of a SARS-CoV-2 related disease, disorder, or condition are assessed using any methods known in the art.
For example, symptoms are assessed using radiologic assessments including chest radiography or computed tomography (CT) and/or using laboratory assessments known in the art, including complete blood count, blood chemical analysis, coagulation testing, assessment of liver and renal function, and measures of electrolytes, C-reactive protein, procalcitonin, lactate dehydrogenase, and creatine kinase.
[00309] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces morbidity and/or mortality in subjects with a SARS-CoV-2 related disease, disorder, or condition. In some embodiments, administration of SARS-CoV-2 binding agents ( e.g antibodies) provides neutralizing activity against SARS-CoV-2 {e.g., in vitro and/or in vivo). In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein bind with high affinity {e.g., in vitro and/or in vivo) to SARS-CoV-2 {e.g., SARS-CoV- 2 receptor binding domain (RBD)).
[00310] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein bind to SARS-CoV-2 {e.g., SARS-CoV-2 receptor binding domain (RBD)) and neutralize SARS-CoV-2 {e.g., in vitro and/or in vivo). As a non-limiting example, in some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein bind to SARS-CoV-2 {e.g., SARS-CoV-2 RBD) with an in vitro ICso of less than about 1 pg/mL, about 0.1 pg/mL, about 0.01 pg/mL, about 1 ng/mL, about 0.1 ng/ml, or about 0.01 ng/ml as assessed by methods described herein or known to one of skill in the art.
[00311] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease burden in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein provides disease ameliorating effects in vivo, for example, on viral load (e.g., lung viral load) and/or body weight as a clinical symptom. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease severity, including, for example, at a histological level in vivo, in SARS-CoV-2 infected subjects.
[00312] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces susceptibility to and/or pathogenesis of SARS-CoV-2 infection in a subject. As a non-limiting example, in some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces pulmonary monocyte-macrophage infiltration, decreases viral load, and/or decreases pulmonary pathology in SARS-CoV-2 infected subjects. [00313] Without being bound by theory, extensive pulmonary surface area may be exposed to SARS-CoV-2 in infected subjects and result in the generation of reactive oxygen species (ROS), such that phospholipid peroxidation results in extensive damage to the lungs. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces generation of ROS and/or phospholipid peroxidation. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces oxidative stress in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents ( e.g ., antibodies) disclosed herein prevents or reduces signaling associated with oxidative stress in SARS-CoV-2 infected subjects. As a non-limiting example, in some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) prevents or reduces induction of Toll-like receptor 4 expression and signaling in SARS-CoV-2 infected subjects, including, for example, by macrophages that in turn upregulate pro-inflammatory cytokine production. [00314] Without being bound by theory, in vulnerable groups of subjects, such as subjects with atherosclerosis, subsets of hyperactive macrophages may play a more significant role in heightening the severity of SARS-CoV-2 infection. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the amount of oxidized lipids in macrophage-rich inflammatory exudates from SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of pro-atherogenic cytokines and/or chemokines, including, for example, upon their stimulation with oxidized low-density lipoprotein (oxLDL), in SARS-CoV-2 infected subjects. As a non-limiting example, in some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of TNF, IL-6, IL-8 and/or CD36 in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the interaction of CD36 with oxidized low-density lipoprotein (oxLDL) in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces CD36-mediated signaling cascades for inflammatory responses in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the recognition and/or internalization of oxLDL by CD36 in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces macrophage activation in affected tissues of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces macrophage activation in non-affected tissues of SARS-CoV-2 infected subjects, including, for example, where pro-atherogenic stimuli have induced a population of long-lasting inflammatory monocytes in the circulation of subjects producing a “trained innate immune response”.
[00315] In some embodiments, administration of SARS-CoV-2 binding agents (. e.g ., antibodies) disclosed herein decreases the number of activated monocytes, for example, in microcirculation of infected tissues including in the pulmonary circulation of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein ameliorates disease severity, including, for example, in the pulmonary parenchyma of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein modify the immunometabolism of monocyte/macrophage populations in subjects (e.g., in atherosclerotic subjects) with SARS-CoV-2 infection.
[00316] Without being bound by theory, severe morbidity and mortality in subjects infected with SARS-CoV-2 who mount cytokine storm responses may involve hyperactivation of the monocyte-macrophage system. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject who has a cytokine storm associated with or in response to SARS-CoV-2 infection. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or suppresses a cytokine storm, including, for example, by preventing or suppressing the monocyte-macrophage system (e.g., by reducing viral load and/or accumulation with macrophages such as lung macrophages) in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces release of cytokines, including, for example, cytokines that directly or indirectly lead to vascular endothelial damage (e.g., inflammatory and coagulation sequelae of SARS-CoV-2 infection including within parenchymatous organs such as lung, hear, kidneys, and liver). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to subjects (e.g., children) with Kawasaki-like disease associated with or in response to SARS-CoV-2 infection.
[00317] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to subjects predisposed to atherosclerosis, including, for example, atherosclerosis due to underlying conditions of hypertension and/or diabetes mellitus. In some embodiments, administration of SARS-CoV-2 binding agents ( e.g ., antibodies) disclosed herein prevents or reduces inflammation associated with or in response to SARS-CoV-2 infection in a subject. In some embodiments, administration of SARS-CoV-2 binding agents {e.g., antibodies) reduces the number of infiltrating macrophages in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces a hyperinflammatory response (e.g., cytokine storm) in subjects with a SARS-CoV-2 related disease, disorder, or condition, such as SARS-CoV-2 infected subjects.
[00318] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the contribution of hyperactivated monocytes to coagulation and/or activation of polymorph nuclear leukocytes (PMN), including, for example, in affected lungs of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces microthrombi of the lungs, brain, heart, kidneys, liver and/or limbs of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces intravascular coagulation, including, for example, disseminated intravascular coagulation (DIC) that primarily or secondarily takes place in microcirculation (e.g., in the lungs) associated with or in response to SARS-CoV-2 infection. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces inflammatory and coagulation sequelae associated with or in response to SARS-CoV-2 infection, including, for example, cytokine storm, fever, intravascular coagulation (e.g., DIC), cardiac ischemia, stroke, neuropsychological effects, acute lung injury, acute respiratory distress syndrome, septic shock, sepsis, multi-organ dysfunction or failure.
[00319] An administration regimen of SARS-CoV-2 binding agents (e.g., antibodies) for a particular subject will depend, in part, upon the agent used, the amount of agent administered, the route of administration, and the cause and extent of any side effects. The amount of agent administered to a subject (e.g., a mammal, such as a human) should be sufficient to effect the desired response over a reasonable time frame. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) are administered once, but more preferably are administered multiple times, e.g., from three times daily to once every six months or longer. In some embodiments, the administration is on a schedule such as three times daily, twice daily, once daily, once every two days, once every three days, once weekly, once every two weeks, once every month, once every two months, once every three months, and once every six months, nine months, 12 months, 15 months, 18 months, 21 months, two years, or more. In some embodiments, the antibody is administered continuously, e.g., via a minipump.
[00320] Suitable routes of administering a composition, such as a physiologically- acceptable composition, comprising a SARS-CoV-2 binding agent (e.g., antibody), are well known in the art. Although more than one route are used to administer an agent, a particular route can provide a more immediate and more effective reaction than another route. Depending on the circumstances, a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) is applied or instilled into body cavities, absorbed through the skin or mucous membranes, ingested, inhaled, and/or introduced into circulation. For example, it may be desirable to deliver a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) through injection by intravenous, subcutaneous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems, or by implantation devices. The antibody may be administered locally or systemically. If desired, a SARS-CoV-2 binding agent (e.g., antibody) is administered regionally via intraarterial or intravenous administration feeding the region of interest. Alternatively, a SARS-CoV-2 binding agent (e.g., antibody) may be administered locally via implantation of a membrane, sponge, or another appropriate material on to which the desired agent has been absorbed or encapsulated. Where an implantation device is used, the device is, one aspect, implanted into any suitable tissue or organ, and delivery of a SARS-CoV-2 binding agent (e.g., antibody) is for example, via diffusion, timed-release bolus, or continuous administration.
[00321] Any delivery route known to those skilled in the art may be used, and other delivery routes for SARS-CoV-2 binding agents (e.g., antibodies) include via the pulmonary route using a powder inhaler or metered dose inhaler, via the buccal route formulated into a tablet or a buccal patch, via the rectal route formulated into suppositories; and via the oral route in the form of a tablet, a capsule or a pellet. [00322] The SARS-CoV-2 binding agents ( e.g ., antibodies) may be administered once, at least twice or for at least the period of time until the SARS-CoV-2 related disease, disorder, or condition is treated, prevented, alleviated, or cured. The SARS-CoV-2 binding agents {e.g., antibodies) may be administered as part of a composition as described herein. The dosage of antibody may be in the range of 0.1-100 mg/kg, alternatively 0.5-50 mg/kg, 1-20 mg/kg, or 1-10 mg/kg. The serum concentration of the antibody may be measured by any method known in the art. [00323] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject in combination with one or more additional agents. In some embodiments, the one or more additional agents are independently useful in treating, preventing or alleviating a SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition (e.g., resulting from infection). In some embodiments, the effect of the one or more additional agents may synergize with the effect of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein. The one or more additional agents may be selected by one skilled in the art.
[00324] In some embodiments, the method further comprises administering one or more additional agents, which may be present in a composition comprising a SARS- CoV-2 binding agent (e.g., antibody) or provided in a separate composition using the same or a different route of administration. Co-administration of SARS-CoV-2 binding agents (e.g., antibodies) with one or more additional agents (combination therapy) may encompass administering a composition comprising SARS-CoV-2 binding agents (e.g., antibodies) and the one or more additional agents as well as administering two or more separate compositions, one comprising the SARS-CoV-2 binding agents (e.g., antibodies) and the other(s) comprising the additional agent(s). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at the same time as one another. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at different times. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) may be administered, for example, once every three days, while an additional agent is administered once daily. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) are administered prior to or subsequent to treatment with the one or more additional agents, for example after a subject has failed therapy with the additional agent.
[00325] The SARS-CoV-2 binding agents ( e.g ., antibodies) and one or more additional agents {e.g., combination therapy) may be administered once, twice or at least the period of time until the SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition {e.g., resulting from infection) is treated, prevented, alleviated, or cured. In some embodiments, the SARS-CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered multiple times. In some embodiments, SARS- CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered via any routes of administration disclosed herein or known in the art. [00326] In some embodiments, the one or more additional agents may comprise agents for influenza (e.g., Favipiravir, Fujifilm Toyama Chemical), H IV-1 protease inhibitor (e.g., ritonavir (Abbvie), prezcobix, ASC09 (Ascletis)), FI IV-1 nucleoside analog reverse transcriptase inhibitor (e.g., emtricitabine and tenofovir), hepatitis C virus protease inhibitor (e.g., danoprevir), a neuraminiase inhibitor.
[00327] In some embodiments, the one or more additional agents are remdesivir (Gilead), galidesivir (BioCryst Pharma), umifenovir, vicromax, ISR-50, oseltamivir (Tamiflu), virazole (Bausch Health), EIDD-2801 (Ridgeback Biotherapeutics), clevudine (Levovir), AB001 (Agastiya Biotech), BTL-tml (Beech Tree Labs), DAS181 (Ansun Biopharma), emetine hydrochloride (Acer Therapeutics), AT-527 (Atea Pharma), ruxolitinib (Novartis), transmembrane protease serine 2 (TMPRSS2) inhibitor (e.g., camostat mesylate), an NMDA receptor glutamate receptor antagonist targeting Glu2NB (e.g., ifenprodil (Algernon Pharma)), soluble human angiotensin converting enzyme 2 (e.g., APN01 (Apeiron Biologies)), a defensin mimetic (e.g., Brilacidin (Innovation Pharma)), BXT-25 (Bioxytran), peptide targeting NP protein, Bio-1106 (BioMarck Pharma), sphingosine 1 -phosphate receptor modulator (e.g., fingolimod (Novartis), glucose decoy prodrug (e.g., WP1122 (Moleculin Biotech), nafamostat (University of Tokyo), nanoviride drug, angiotensin II receptor blocker (e.g., valsartan), telmisartan (Boehringer Ingelheim), tissue plasminogen activator (e.g., alteplase (Genentech)), rhu-granulocyte macrophage colony stimulating factor (e.g., sargramostim (Partner Therapeutics)), interleukin-1 receptor antagonist (e.g., anakinra (Swedish Orphan Biovitrum)), aldose reductase inhibitor (e.g., AT-001 (Applied Therapeutics)), multiple myeloma therapies (e.g., plitidepsn (PharmaMar)), anticoagulant ( e.g ., persantine (dipyridamole)), human plasma gelsolin (rhu-pGSN (Bio-Aegis Therpautics)), molecule based on lectin-like domain of human TNF-alpha {e.g., solnatide (Apeptico)), nitric oxide, P-001 (Panoptes Pharma)), AMRS-1 (ARMS Pharmaceutical)), PUL-042 (Pulmotect), Janus kinase (JAK) inhibitor (e.g., Olumiant (baricitinib, NIAID) and Xeljanz (tofacitinib, Pfizer)), colchicine, anticoagulant (e.g., heparin), glycosaminoglycan derivative of heparin (e.g., dociparstat sodium (Chimerix)), LAU-7b (fenretinide, Laurent Pharma), fenretinide (SciTech), selective inhibitor of nuclear export (SINE) compound (e.g., Xpovio (selinexor) Karyopharm Therapeutics), synthetic small molecule inhibitor of calpain (CAPN 1, 2, and 9, e.g., BLD-2660 (Blade Therapeutics)), Calquence (acalabrutinib), Bruton's tyrosine kinase (BTK) inhibitor, biological immunomodulator (nonpolymorphic regions of CD24 attached to the Fc region of human lgG1 , e.g., CD24Fc (Oncolmmune)), synthetic form of Vasoactive Intestinal Polypeptide (e.g., Aviptadil (NeuroRx)), CGRP receptor antagonist (e.g., vazegepant (Biohaven)), calcium release-activated calcium (CRAC) channel inhibitor (e.g., CM4620-IE (CalciMedica)), ivermectin, nitazoxanide, antiprotozoal, oral formulation of highly purified eicosapentaenoic acid free fatty acid (EPA-FFA) (e.g., EPAspire (KD Pharma)), niclosamide reactive aldehyde species (RASP) inhibitor (e.g., ADX-629 (Aldeyra Therapeutics)), FISP 90 inhibitor (e.g., ADX-1612 (Aldeyra Therapeutics)), IL-15 "superagonist" (e.g., N-803 (ImmuntyBio)), A3 adenosine receptor agonist (e.g., piclidenoson (Can-Fite BioPharma)), skeletal muscle relaxant (e.g., Ryanodex (dantrolene sodium) (Eagle Pharma)), Veyonda (NoxoPharm), MRx-4DP0004 (4D Pharma), EDP1815 (Evelo BioSciences), cyclin- dependent kinase (CDK)2/9 inhibitor (e.g., roscovitine seliciclib (Cyclacel Pharma)), cyclin-dependent kinase (CDK)2/9 inhibitor (e.g., fadraciclib (CYC065) (Cyclacel Pharma)), modulator of neuropilin-2 (e.g., ATYR1923 (aTyr)), sodium-glucose cotransporter 2 (SGLTs) inhibitor (e.g., Farxiga (dapagliflozin) (AstraZeneca)), recombinant human C1 esterase inhibitor (e.g., Ruconest (Pharming)), DIBI iron binding polymer (Chelation Partners), reversible inhibitor of dipeptidyl peptidase 1 (DPP1, e.g., brensocatib (Insmed)), histamine-2 (H2) receptor antagonist (e.g., Pepcid/famotidine), neurokinin-1 receptor antagonista (e.g., tradipitant (Vanda Pharma)), small molecule inhibitor of cytokine release (e.g., GP1681 (Quotient Sciences)), Metablok (Arch Biopartners), kinase inhibitor with specificity for JAK2, IRAKI and CSFIR (e.g., pacritinib (CTI BioPharma)), microbiome therapeutic, transepithelial nebulized alkaline treatment, Coronzot (Silkim Pharma), multivalent carbohydrate binding molecules ( e.g ., Neumifil (Pneumagen)), AXL kinase inhibitor (. e.g ., bemcentinib (BerGenBio)), inhibitor of phosphodiesterase 4 (PDE4) {e.g., Otezla/apremilast (Amgen)), small molecule macrophase migration inhibitory factor (MIF) inhibitor and phosphodiesterase (PDE) -4 and -10 inhibitor {e.g., MN- 166/ibudilast (MediciNova)), oral sphingosine kinase-2 (SK2) selective inhibitor (opaganib/ABC294640 (RedHill Biopharma)), serine protease inhibitor {e.g., RHB- 107 (RedHill BioPharma)), free biologic made from anti-inflammatory proteins secreted by placental cells {e.g., ST266 (Noveome Biotherapeutics)), an antifibrinolytic {e.g., Lysteda/Cyklokapron (University of Alabama)), senicapoc (Aarhus University), a selective serotonin reuptake inhibitor {e.g., Luvox/fluvoxamine (Washington University), Gleevac (imatinib (Exvastat Limited), ABX464 (Abivax), selective oral dihydroorotate dehydrogenase (DHODH) inhibitor {e.g., IMU-838 (Immunic, Inc.)), and sPIF (synthetic pre implantation factor (Biolncept)).
[00328] In some embodiments, the one or more additional agents comprise an anti-viral compound {e.g., an anti-coronaviral compound). Non-limiting examples of anti-viral agents include an antibody, an inhibitor of viral RNA-dependent RNA polymerase, an inhibitor of a virus-encoded protease (e.g., a protease that affects processing of a viral RNA-dependent RNA polymerase), an inhibitor of viral budding from host cells, an inhibitor of vial release from host cells (e.g., by altering the activity of hemagglutinin-esterase), an inhibitor of viral binding to a cell surface receptor, an inhibitor of receptor-induced conformational changes in virus spike glycoprotein, or an inhibitor of viral entry into cells. In some embodiments, the anti-viral compound is a nucleoside/nucleotide reverse transcriptase inhibitor. In some embodiments, the anti-viral compound is a protease inhibitor. In some embodiments, any anti-viral compounds or anti-viral drug combination disclosed herein or known in the art may be used as an additional agent.
[00329] In some embodiments, the one or more additional agents comprise a cell- based therapy. For example, the cell based therapy may include placenta-based cell therapy (e.g., PLX cell product (PlurStem Therapeutics), mesenchymal stem cells, autologous adipose-tissue derived mesenchymal stem cells (ADMSs), allogenic mesenchymal stem cells (e.g., remestemcel-L (Ryoncil), bone marrow stem cells, allogenic T-cell therapies, natural killer cell-based therapy (e.g., CYNK-001 (Celularity), haNK (ImmunityBio)), allogenic cardiosphere-derived cell therapy (e.g., CAP-1002 (Capricor)), bone marrow-derived mesenchymal stem cells (BM-Allo- MSC), adipose-derived mesenchymal stem cells, ( e.g ., Astrostem-V (NatureCell)), MSCs and cytokines derived from amniotic fluid {e.g., AmnioBoost Lattice Biologies)), and chimeric antigen receptor (CAR)/T cell receptors (TCR)-T cell therapy.
[00330] In some embodiments, the one or more additional agents comprise a RNA-based treatment. For example, the RNA based therapy may include RNAi, siRNA (e.g., VIR-2703 (Vir Biotech)), rintatolimod (AIM ImmunoTech), TGF-beta antisense drug (e.g., OT-101 (Mateon Therapeutics)), inhaled mRNA, and antisense oligonucleotides.
[00331] In some embodiments, the one or more additional agents comprise a previously identified agent for coronavirus (e.g., agents for a SARS-CoV-1 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition). For example, in some embodiments, the one or more additional agents is an antibody against SARS-CoV-1, e.g., CR022 (Tian et al. , Emerg Microbes Infect. 20209:382-385). In some embodiments, the one or more additional agents is a SARS-associated inflammatory cytokine inhibitor or a tumor necrosis factor (TNF) inhibitor (e.g., a TNF pathway antagonist), nonsteroidal anti inflammatory drugs (NSAIDs), disease-modifying antirheumatic drugs (DMARDs, e.g., hydroxychloroquine, leflunomide, methotrexate, mycophenolate, sulfasalazine), analgesics, topical steroids, systemic steroids (e.g., prednisone), other cytokines, antagonists of inflammatory cytokines (e.g., IL-1, TNF-a, IL-6, IL-12, and IFN-y), antibodies against T cell surface proteins, oral retinoids, salicylic acid, and hydroxyurea.
[00332] In some embodiments, the SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and/or one or more additional agents may be used to treat, prevent, or alleviate a SARS-CoV-2 related disease, disorder, or condition, including a symptom thereof, for example, a cytokine storm, by inhibiting or suppressing the onset or progression of a cytokine storm. Mechanisms of cytokine storm by pathogenic SARS-CoV are known in the art, and the one or more additional agents may suppress any pathway or mechanism known in the art (see, e.g., Ye Q, Wang B, Mao J. J Infect. 2020;80(6):607-613.) For example, in some embodiments, the SARS-CoV-2 binding agents and/or one or more additional agents may affect high levels of inflammatory cytokines (e.g., IL-1 B, IFN-g, IP-10, and monocyte chemoattractant protein 1 (MCP-1), activation of T-helper type 1 (Th1) cell response, elevated levels of Th2 cell-secreted cytokines ( e.g ., IL-4 and IL-10), elevated serum levels of IL-2R, IL-6, granulocyte colony-stimulating factor, IP-10, MCP-1, macrophage inflammatory protein-1 A, and TNF-a.
[00333] In some embodiments, the one or more additional agents is an interferon {e.g., IFN-l). In some embodiments, one or more additional agents may activate epithelial cells, reduce the mononuclear macrophage-mediated proinflammatory activity of IFN-ab, inhibit recruitment of neutrophils to the sites of inflammation, and/or activate the anti-viral genes in epithelial cells. In some embodiments, the additional agent is interferon alpha-2b {e.g., Peglntron (Zydus Cadila)), novaferon (Flu’nan Flaiyao hongxingtan Pharmacueticals), interferon beta 1-a {e.g., traumakine (Faron Pharma) and SNG001 (Synairgen)), interferon alpha-1 b, abd peginterferon lambda (Eiger BioPharma).
[00334] In some embodiments, the SARS-CoV-2 binding agents and/or one or more additional agents may affect dysregulated and excessive immune responses, elevated serum cytokine and chemokine levels, elevated number of neutrophils and monocytes in lung tissues and peripheral blood, delayed release of interferons in the early stages of SARS-CoV infection, thereby reducing excessive infiltration of inflammatory cells into lung tissue that leads to lung injury.
[00335] In some embodiments, the one or more additional agents have anti inflammatory functions (e.g., corticosteroids). In some embodiments, the one or more additional agents inhibit excessive inflammation (e.g., during cytokine storm), prevent or inhibit ARDS, and/or protect organ function. Any corticosteroid therapy known in the art is used. For example, in some embodiments, the corticosteroid therapy is methylprednisolone.
[00336] In some embodiments, the one or more additional agents includes an immune substitution and/or immunomodulation therapy (e.g., administration of intravenous immunoglobulin (IVIG)).
[00337] In some embodiments, the one or more additional agents is an inhibitor of IL-1 family cytokines (e.g., IL-1 b, IL-18, and IL-33). In some embodiments the additional agent is an antagonist of IL-1 b (e.g., Anakinra).
[00338] In some embodiments, the one or more additional agents is an inhibitor of IL-6 (e.g., Tocilizumab), a TNF blocker, an IFN-ab inhibitor, chloroquine (e.g., hydroxychloroquine, chloroquine phosphate), ulinastatin, an oxidized phospholipid inhibitor (e.g., eritoran), a sphingosine-1 -phosphate receptor 1 agonist, or an inhibitors of mononuclear macrophage recruitment and function ( e.g ., small interfering RNA (siRNA)-mediated silencing of C-C chemokine receptor type 2 (CCR2) or TLR7 agonists).
[00339] In some embodiments, the one or more additional agents include stem cell therapy. In some embodiments, the one or more additional agents include a medical device (e.g., blood purification system, respiratory assist systems, cytokine adsorber). In some embodiments, the one or more additional agents include a blood purification system (e.g., plasma exchange, adsorption, perfusion, blood/plasma filtration). In some embodiments, the one or more additional agents strengthen the vascular barrier (e.g., by activation of the endothelial Slit-Robo4 pathway).
[00340] In some embodiments, the one or more additional agents comprise a vaccine. For example, the additional agent may be a replicating bacterial vector vaccine, virus-like particle (VLP) vaccine, RNA-based vaccine, replicating viral vector vaccine (e.g., viral vector expressing RBD or spike), protein subunit vaccine (e.g., RBD-based, S protein subunit, peptide-derived from spike protein), non-replicating viral vector, live attenuated virus, inactivated virus, or DNA-based vaccine.
[00341] In some embodiments, the one or more additional agents comprise an antibody. For example, the one or more additional agents are antibodies that target a coronavirus spike protein, potential mutations of SARS-CoV-2, vascular endothelial growth factor inhibitor (e.g., bevacizumab), programmed cell death protein (PD-1) or PD-L1, CCR5, interleukin-6 receptor (e.g., sarilumab or tocilizumab), granulocyte- macrophage colony stimulating factor, complement, interleukin-1 -beta, interferon gamma, CD147, angiopoietin-2, C5a, granulocyte macrophage colony-stimulating factor (GM-CSF), TLR4, CXC10, CD14, and interleukin 33. In some embodiments, the one or more additional agents comprise hyperimmune globulin (H-IG) or hyperimmune gammaglobulin. In some embodiments, the one or more additional agents may comprise antibodies from recovered COVID-19 patients or an antibody cocktail.
[00342] In some embodiments, the one or more additional agents comprise one or more antibodies (e.g., monospecific or multispecific, including bispecific) with different binding specificities than the SARS-CoV-2 binding agents (e.g., antibodies) as disclosed herein. In some embodiments, one or more additional antibodies may be used in combination with SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein to simultaneously target one or more epitopes and prevent the emergence of viral escape mutants. For example, one or more epitopes may include regions of SARS-CoV-2 spike glycoprotein ( e.g ., homotrimer, protomer), S1 or S2 domain of SARS-CoV-2 spike glycoprotein, other SARS-CoV proteins, S protein receptors, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. [00343] In some embodiments, one or more additional antibodies (e.g., monospecific or multispecific, including bispecific) with binding specificities to a plurality of viral strains (e.g., SARS-CoV-2 strains) may be used in combination with SARS-CoV-2 binding agents disclosed herein to simultaneously target multiple viral strains. In some embodiments, SARS-CoV-2 binding agents disclosed herein and/or one or more additional therapeutic antibodies may bind to a single strain or multiple strains of SARS-CoV-2.
EXAMPLES
EXAMPLE 1. GENERATION OF ANTIBODY CLONES [00344] Recombinant receptor binding domain (RBD) of SARS-CoV-2 spike protein encompassing residues Arg319 to Asn532 (SARS-CoV-2-RBD; SEQ ID NO:27) and carrying a His tag and Avi-tag at the C-terminus and the spike-S1 domain encompassing residues Gln14 to Arg 683 (SEQ ID NO:28) both in biotinylated format (Kactus BioSystems, Woburn MA) were used to screen synthetic fully human antibody libraries displayed on yeast (see, e.g., US Patent No.
10,011 ,829) for antibody clones that bound the RBD. Recombinant SAR-CoV-1 RBD encompassing residues Arg306-Phe527 (SEQ ID NO:29) (Kactus Biosystems) and recombinant human ACE2 extracellular domain encompassing residues Gln18- Ser760 (SEQ ID NO:30) fused to human Fc (Kactus BioSystems) were also used during fluorescence-activated cell sorting (FACS).
[00345] Library screening: The human antibody libraries used for screening were based on five different VH families each combined with four VK libraries and one M library which together in total consist of 100 billion independent antibody clones. Consequently, libraries were split into 6 pools: 1) the VH1-69 combined with all 4 VK libraries (V1-39, 3-15, 3-20 [9 aa in CDR3], 3-20 [10 aa in CDR3]), 2) the VH3-15 combined with all the VK libraries, 3) the VH3-23 combined with the VK libraries, 4) the VH3-30 combined with the VK libraries, 5) the VH4-39 combined with the VK libraries and 6) each of the VH libraries combined with the MX 1-40 library. The six library pools were grown up to 3-fold of the original library titer and induced for antibody expression and screened in parallel. The screening process involved a preliminary enrichment for antigen-binding antibody clones using magnetic bead activated cell sorting (MACS) followed by FACS. For the initial magnetic bead sorting step, yeast cells were grown and induced to express antibodies culturing in induction medium (0.74 g amino acids without tryptophan, 7 g yeast nitrogen base with ammonium sulfate, 2 g glucose, 20 raffinose, 20 g galactose, 8.4 g NaFI2P04-7FI20 and 7.3 g Na2FIP04, pH 6.25) at 20°C for 16 hours to induce the expression of the scFab. Biotinylated SARS-CoV-2-RBD plus biotinylated SARS-CoV-2-S1 was added in binding buffer (PBS plus 5g/l BSA, but without Ca2+ or Mg2+) to a final concentration of 100 nM each. After incubation with the yeast libraries at room temperature for 1 hr, the cells were incubated on ice for 10 min, washed 3 times with 50 ml binding buffer, followed by incubation with streptavidin-magnetic beads for 10 min on ice. The cells were then washed once with binding buffer and resuspended in binding buffer, before being passed through a magnetic sorting column. After all the cells were had passed through the column, the column was washed 3 times with 7 ml binding buffer. Captured cells were eluted in 10 ml of binding buffer per column by turning off the magnetic field, then pelleted and resuspended in selective medium. The collected cells were grown up and induced for Fab expression as described above and used for a second round of magnetic bead sorting using the same conditions.
[00346] The selected cells were then grown up for further selection by FACS. Fab- expressing yeast cells was were incubated with 100 nM biotinylated SARS-CoV-2- RBD plus 100 nM biotinylated SARS-CoV-2-S1 and bound SARS-CoV-2-RBD and SARS-CoV-2-S1 antigens were detected with phycoerythrin (PE)-conjugated streptavidin, while the displayed Fab was detected with goat anti-human Kappa or Lambda followed by APC-conjugated donkey anti-goat antibody. Double positive cells were identified and collected using a FACSAria II (Becton Dickenson) sorter at a rate of 20,000 events per second. The harvested cells were expanded and used for the next round of sorting that included a presort using biotinylated baculovirus detected with PE-conjugated streptavidin to remove polyspecific (or non-specific, sticky) antibody clones, then taking the antibody-only positive cells and subjecting them to a positive sort in the presence of 100 nM biotinylated SARS-CoV-2-RBD.
The antigen (biotin) and Fab positive cells were collected and then used for a 3rd round of FACS, which was designed to select for the subset of SARS-CoV-2-RBD- positive antibody clones that could block binding of the human ACE2 receptor to SARS-CoV-2-RBD antigen captured by the antibody clone displayed at the yeast cell surface. For this sort, cells were incubated in the presence of 50 nM biotinylated SARS-CoV-2-RBD detected with PE-conjugated streptavidin and 100 nM human ACE2-FC (ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc) detected with Dylight 647-conjugated goat anti-human Fc (Jackson ImmunoResearch, West Grove PA). Those antibody clones that were positive for SARS-CoV-2-RBD binding (PE) and negative for ACE2-Fc binding (Dylight 647) were collected (FIG. 1).
[00347] The harvested cells were then subjected to a fourth round of FACS using 50 nM biotinylated SARS-CoV-2-S1 detected with PE-conjugated streptavidin and 100 nM human ACE2-Fc (ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc) detected with Dylight 647-conjugated goat anti-human Fc. Those antibody clones that were positive for SARS-CoV-2-RBD binding (PE) and negative for ACE2-FC binding (Dylight 647) were collected.
[00348] A final round of FACS was performed to separate the subset of antibody clones expressing antibody that was specific to SARS-CoV-2 RBD from those that expressed antibody that could also bind biotinylated SARS-CoV-1-RBD (residues Arg306 - Phe 537-Avi tag; Kactus Biosystems) at a concentration of 100 nM.
EXAMPLE 2. SELECTION OF ANTIBODY CLONES [00349] The yeast antibody clones isolated from the final two rounds of FACS were plated on selective media plates and incubated at 30°C for 2 days. Individual colonies were randomly picked from the agar plates and grown in selective medium overnight at 30°C. The medium was replaced with induction medium and cells cultured at 20°C overnight to induce the expression of Fab antibodies. In this yeast display system, a significant amount of Fab antibody is secreted into the culture medium in addition to those displayed Fab antibodies on the yeast cell surface. The secreted Fab in the culture medium can be used directly for binding assays.
[00350] A preliminary ELISA was performed to determine binding activity of individual antibody clones to SARS-CoV-1 RBD, SARS-CoV-2 RBD and to baculovirus to identify antibody clones that bound antigen but did not show background binding to baculovirus. A total of 2124 antibody clones were analyzed for SARS-CoV-2 RBD binding and 490 antibody clones from the subset of antibody clones from the harvested pool that bound SARS-CoV-1 RBD were also analyzed. Only 2 of the antibody clones exhibited non-specific binding to baculovirus.
[00351] To identify antibody clones with potential neutralizing activity, a competition ELISA was performed to determine the ability of the secreted Fab from individual antibody clones to block SARS-CoV-2 RBD binding to immobilized ACE2 receptor. For this assay, 100 ng of human ACE2-Fc in 100 pi PBS was used to coat the wells of Immulon 2 HB ELISA plates at 4°C overnight. The next day, unbound ACE2 receptor was removed, and the wells were blocked with PBS containing 3% BSA for 1 hour at room temperature then washed. The secreted Fab antibodies in 50 mI culture media were mixed with 2 ng of biotinylated SARS-COV-2-RBD or SAR- CoV-1-RBD in 2x binding buffer (0.5 M HEPES, 0.5 M NaCI, 5% BSA, pH 7.5) in a final volume of 100, mI for 30 mins at room temperature, then added to washed ACE2-coated wells. The plates were incubated at 30°C for 1 hr, and the bound biotinylated SARS-RBD detected with HRP-labeled streptavidin (FIG. 2). Inhibition of binding was determined by assessing the ratio of the signal for antigen binding in the presence of the Fab-containing culture media compared to the signal for antigen binding in the presence of yeast culture media alone in the absence of Fab. Antibody clones that yielded a >50% decrease in signal were considered to be inhibitory antibody clones. From a total of 2122 yeast antibody clones tested, 667 expressed Fab that blocked SARS-CoV-2-RBD binding to ACE2-coated wells by >50%. Of these, 205 antibody clones also bound to SARS-CoV-1 RBD. In addition, antibody clones were also tested by ELISA for binding to baculovirus to eliminate those antibody clones exhibiting non-specific binding.
[00352] Yeast antibody clones expressing specific antibody clones that exhibited > 70% inhibition of SARS-CoV-2-RBD binding to ACE2-coated wells were then combined into 5 new plates and the culture media tested for the ability of the secreted Fab to bind to full-length spike protein expressed as a spike-green- fluorescent protein (GFP) fusion in 293 cells, which should more faithfully represent the conformation of native trimeric spike protein on the virus particle than the isolated RBD domain. A vector encoding a full-length spike protein sequence encompassing residues 13-1273 of UniProtKB accession number P0DTC2 (SEQ ID NO:31), that was coupled to green fluorescent protein (GFP) as a reporter (Sino Biologicals, Beijing, China) was used to transiently transfect 293 cells using the Freestyle™ 293 Expression System (ThermoFisher Scientific). [00353] After 2 days, when a robust GFP signal was observed, aliquots of 80,000 cells per well were transferred to wells of a 96 well plate, pelleted by centrifugation, resuspended in ice cold phosphate-buffered saline containing EDTA and 0.5% BSA, pH 7.4 (PBSM) and blocked for 45 mins at 4°C. After washing, the cells were then incubated in 50 pi Fab-containing culture supernatant from individual yeast antibody clones for 45 mins with rotation at 4°C, washed 3 times in ice-cold PBSM and then bound Fab detected with either goat anti-human kappa-A647 (SouthernBiotech cat# 2060-31) or goat anti-human lambda-A647 (SouthernBiotech cat# 2070-31) The cells were then washed three times with ice cold PBSM, the washed cell pellet resuspended in ice-cold PBSM and the cell-bound Dylight-647 analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius). Both the mean fluorescence intensity (MFI) and percent of positive cells were measured. Of the 394 antibody clones tested, 65 bound to native spike protein. Representative examples of an individual clone with binding activity compared to controls is shown in FIG. 3. [00354] In parallel, a total of 310 antibody clones were selected for sequencing, including the above-referenced 65 antibody clones; 91 unique sequences were identified.
EXAMPLE 3. VIRAL NEUTRALIZATION ACTIVITY [00355] The sixty-three (63) antibody clones that represented the unique antibody clones in the set of 65 testing positive for binding to spike glycoprotein expressed by 293F cells were selected for production as full-length IgGl The light and heavy chains were separately cloned into different expression vectors carrying the constant regions of human lgG1 heavy chain and either the kappa or lambda chain (depending of the VL identity of the isolated antibody clone). The heavy and light chain plasmids were co-transfected into Expi293 suspension cells. Secreted antibody was then purified from the culture supernatants by Protein A chromatography, buffer-exchanged into PBS pH 7.4 and its concentration determined by Nanodrop A280 assay. The quality of each IgG was assessed by SDS-PAGE and by HPLC.
[00356] A viral cytopathic effect (CPE) assay was performed to assess the ability of the 63 selected antibody clones to inhibit cell death of Vero E6 epithelial cells, which naturally express ACE2, upon viral infection in the presence of SARS-CoV-2. For this assay, Vero E6 cells are seeded into wells of a 96-well plate and grown to confluence then infected with SARS-CoV-2 virus (Washington state SARS-CoV-2 isolate WA1 -F6/2020). After 4 days culture, the cytopathic effect of the virus is clearly visible by microscopy (FIG. 4A).
[00357] First all the antibody clones were screened for neutralizing effect at a concentration of 10 pg/ml. In a fresh plate, each test antibody clone was diluted into DMEM (FlyClone Characterized) with routine antibiotics and supplements (pen/strep, sodium pyruvate, L-glutamine) to give 20 pg/ml in 100 pi. Then 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was added to each well, thus diluting the antibody in each well to 10 pg/ml. The plates were incubated at 37°C with 5% CO2 in a humidified incubator for 1 hour then the media in the wells with the Vero E6 cell monolayers was removed and the antibody- virus mixtures transferred to the corresponding Vero E6 cell wells. One well on the plate had control irrelevant IgG with virus and one well served as the non-virus control well. The plates were incubated for 48 hrs at 37°C with 5% CO2 in a humidified incubator then each well scored by microscopic analysis for the presence of live cells. Out of the 63 antibody clones tested, 12 showed neutralizing activity at 10 pg/ml.
[00358] Next, the assay was repeated with the 12 antibody clones that exhibited neutralizing activity, this time using a log3 dilution series ranging from 10 to 0.0045 pg/ml in triplicate of each of the 12 antibody clones that had exhibited neutralizing activity at 10 pg/ml to determine the lowest concentration that could provide protection from cell death, the IC100 value. After 2 days, the wells were scored for absence or presence of viral-induced cell death. The lowest concentration providing protection from cell death for each of the antibody clones is shown in Table 11. Five antibody clones, clone A, B, C, D and E conferred full protection from cell death at concentrations below 0.4 pg/ml.
Table 11
Figure imgf000149_0001
Figure imgf000150_0001
[00359] The assay was repeated with the more potent antibody clones using 5 replicates to better define the assay standard error; the data are shown in Table 12. [00360] To define an ICso value for the neutralization activity of each clone, a variation of the assay whereby the effect of cell viability was quantified using a cell viability tracer was performed with antibody clones B, C, F, H and K. For this a colorimetric MTS cell viability assay, CellTitreAq (Promega, Madison, Wl) was performed. Vero E6 were seeded in 96 well plates and grown to confluency. Then 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was mixed with test antibody in DMEM at concentrations ranging from 10 pg/ml to 0.0005 pg/ml and pre-incubated together for 1 hr. The mixture was then added to the wells with confluent Vero E6 cells and the plates cultured for 4 days. A separate set of wells were cultured in the presence of antibody alone. Each condition was run in 5 replicate wells. Then 3 days later the number of viable cells in each well was measured using the CellTitreAq assay according to the manufacturer’s protocol. The ratio of the viable cell signal in the virus+antibody treated wells to the corresponding antibody-only treated wells at each dilution was plotted and the ICso determined using Prism software. The curve fit plots are shown in FIGS. 4B-4D and the ICso values in Table 12, which indicated that antibody clones B, C and F had ICso values in the 10 to 20 ng/ml range.
Table 12
Figure imgf000150_0002
EXAMPLE 4. ANTIBODY AFFINITY AND ACTIVITY DETERMINATION
[00361] The apparent affinity of the most potent antibody clones exhibiting neutralizing activity was determined by ELISA. For the ELISA, wells were coated with 100 ng/well of the test antibody clones overnight at 4°C, washed then blocked in PBS plus 3% BSA. Serial dilutions of biotinylated SARS-CoV-2-RBD, SARS-CoV-1- RBD or irrelevant antigen were added to the relevant wells and incubated for 1 hr at room temperature. Wells were then washed and bound biotinylated antigen detected with HRP-labeled streptavidin. Specific binding (subtracting OD450 values for BSA from OD450 values for the SARS-CoV-2-RBD or SARS-CoV-1-RBD antigen at the same concentration) was plotted and curve fitted using Prism software. The binding curve for Clone B (AvGn-B) is shown in FIG. 5A. The KD values for 11 clones assessed in this assay were determined to range from 0.15 to 0.98 nM (Table 13).
[00362] To assess the apparent avidity effect of the bivalent IgG, the monomeric antigen was coated on the wells and a dilution series of the test antibody clone as lgG1 was added to the wells and incubated for 1 hr at room temperature. Bound IgG was detected with FIRP-labeled goat anti-human IgG (Jackson ImmunoResearch). Specific binding was measured from the OD values adjusted for background signals and plotted as described above. The apparent KD values (apparent avidity) values are summarized in Table 13.
Table 13
Figure imgf000151_0001
Figure imgf000152_0001
[00363] The ability of the selected antibody clones to inhibit the interaction of the SARS-CoV-2 spike protein RBD with its ACE2 receptor was evaluated by ELISA. For this, wells of a 96-well plate were coated with human-ACE2-Fc as described above. Then, in a separate plate a serial dilution series of each test antibody was pre-mixed with a 2 nM concentration of either biotinylated SARS-CoV-1 RBD or SARS-CoV2-RBD and incubated for 30 mins. The contents were then transferred to the washed ACE-2-Fc coated wells. Wells with plain buffer served as the negative control wells. The plates were incubated at room temperature for 1 hr, washed and bound antigen detected with HRP-labeled streptavidin. The OD values versus test antibody concentration were plotted and curve fitted using Prism software. The ICso curve for Clone B (AvGn-B) is shown in FIG. 5C. The ICso values for 4 clones assessed in this assay ranged from 2.2 nM to 23 nM (Table 13).
[00364] Next the binding kinetics of select antibody clones were assessed by Bio- Layer Interferometry (BLI) assays carried out using a Gator™ instrument (Probe Life, Inc., Palo Alto, CA) with filtered Q-buffer (PBS with 0.2% BSA and 0.02% Tween-20) at a temperature of 30°C. After establishing a baseline, test lgG1 antibodies at 1pg/ml (200mI per well) were captured onto six ProtG probes until a wavelength shift of approximately 1 nm were observed on the Gator sensorgram. After reestablishing baseline, binding of captured antibody to biotinylated SARS-CoV-2 RBD (Kactus Biosystems; Lot #030201) analyte (200mI per well) were measured via separate association (Six concentrations (1 per well) consisting of a 3-fold serial dilution range of 138.9 - 0.57 nm) and dissociation steps. Non-specific binding events, to probe or an irrelevant control antibody, were monitored in two separate wells and reference subtracted from each test antibody sensorgram. Antibody Kon, Koff and KD values were determined using Gator software through global fitting of the data to a 1:1 binding model. The data are shown in Table 14.
Table 14
Figure imgf000153_0001
[00365] To assess the affinity to native spike protein, the binding affinity to full- length native spike protein expressed on transiently transfected 293 cells expressing spike-GFP protein was determined as follows. Following transfection as described above, cells were harvested and washed with ice cold PBSM (phosphate-buffered saline containing EDTA and 0.5% BSA). The cells were blocked in PBSM for 45 min at 4°C with rotation. The cells were transferred to a 96-well plate (80,000 cells/well) and pelleted by centrifugation. Anti-SARS-CoV-2-RBD, control IgGs or ACE2-Fc were each serially diluted in ice cold PBSM, and the cell pellets were resuspended and incubated in these IgG/PBSM solutions for 45 min at 4°C with rotation. After the incubation, the cells were washed three times with ice cold PBSM by centrifugation then resuspended in fresh buffer. The washed cell pellets were then resuspended and incubated in the dark, at 4 °C with rotation in PBSM containing goat anti-hlgG- Fc-APC (Jackson ImmunoResearch Laboratories, Inc.cat# 109-135-098) or goat anti-hlgG-Fc-A647 (Jackson ImmunoResearch Laboratories, cat# 109-605-008). The cells were then washed three times with ice cold PBSM and the washed cell pellet resuspended in ice cold PBSM and analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius). The data was then fitted to a one-site binding algorithm to calculate the apparent KD using Prism software (GraphPad, San Diego, CA). The curves of Clone B (AvGn-B) compared to ACE2-Fc binding to 293- cells expressing SARS-CoV-2 measured as mean fluorescence intensity (MFI) are shown in FIG. 5B. As shown in FIG. 5B and Table 15, ACE2-Fc bound to the Spike expressing cells with a KD value of 4.7nM, similar to the reported affinity of ACE2 for the SARS-CoV-2 spike protein, indicating that the expressed spike protein had adopted a functional conformation. All the antibody clones evaluated exhibited KD values ranging from 0.04 to 4.86, with the majority <0.6 nM as shown in Table 15. However, two antibody clones exhibited some slight background binding to irrelevant antigen transfected cells, and one clone, clone E, exhibited clear cut binding to non- transfected cells with a measurable KD of 6.8 mM. This and clone D had also shown non-specific binding in ELISA.
Table 15
Figure imgf000154_0001
EXAMPLE 5. BIOPHYSICAL PROPERTIES [00366] HPLC analysis of 6 antibody clones indicated that they showed a single discrete peak consistent with monomeric IgG. Thermostability analysis of the 6 antibody clones was performed using by differential scanning fluorimetry (DSF). All DSF assays were carried out using the LightCycler 480 II Real-Time PCR instrument (Roche Applied Science, (Pleasanton, CA)) with filtered PBS buffer. Each test antibody was mixed with 100x SYPRO Orange solution (Invitrogen) to give a final concentration of 1.6mM protein and 20x SYPRO Orange. Twenty-five microliters of this mixture were then added to each well of a white LightCycler 48096-well plate. The plate was heated from 20°C to 99°C at a rate of 2.4°C/min, and the resulting fluorescence data were collected. The negative first derivative of the melt curve was calculated, and the minima values were defined as melting temperatures (Tm). Where multiple unfolding transitions were observed, the first (lowest) melting transition was reported as Tm1 , the next lowest as Tm2 and in some cases the third as Tm3. Data collection and derivative calculation were carried out using the LightCycler software. The values obtained for the selected antibody clones, shown in Table 16, indicated that the selected antibody clones had stable thermostability profiles, with 5 of the 6 antibody clones analyzed showing two melting transition temperatures and 1 of the 6 antibody clones showing 3; Tm1 is assumed to be associated with the dissociation of CH2, and Tm2 to be associated with Fab/CH3 dissociation. Tm3 for clone C most likely represents Fab dissociation.
Table 16
Figure imgf000155_0001
EXAMPLE 6. IN VIVO EFFICACY
[00367] A large scale preparation of Clone B (AvGn-B) was generated as described in Example 3. An aliquot of the purified Clone B (AvGn-B) lgG1 was then tested for endotoxin levels using a Limulus Amoebocyte Lysate (LAL) assay (ThermoFisher Scientific, catalogue # A39552) to ensure endotoxin content per dose was well below the threshold that could trigger untoward effects in vivo.
[00368] Syrian hamsters were chosen to test the effects of Clone B (AvGn-B) on a SARS-CoV-2 related disease, disorder, or condition as they are regarded as suitable models because of the close resemblance of their response (e.g., susceptibility, pathogenesis, pulmonary pathology, clinical features) to SARS-CoV-2 infection and the response of SARS-Cov-2 infected subjects (e.g., human SARS-CoV-2 infected patients). In these experiments, male Syrian hamsters (n=20, 10 weeks of age, obtained from Charles River Laboratory) were held in the animal facility and provided access to standard pelleted feed and water ad libitum prior to being moved into the biosafety-level 3 facility for experimental challenge with SARS-CoV-2. Of the 20 hamsters, 18 were intranasally infected with 2.5x104 TCID50/mL equivalents of SARS-CoV-2 (strain 2019-nCoV/USA-WA1/2020) and divided into treatment groups as follows: “Clone B (AvGn-B) High” (2.5mg Clone B (AvGn-B)) (n=5), “Clone B (AvGn-B) Low” (1 mg Clone B (AvGn-B)) (n=5), “Untreated” (no antibody) (n=6), and “Ab Control” (2.5 mg isotype control lgG1) (n=2). Two uninfected hamsters received 2.5 mg Clone B (AvGn-B) (termed “Uninfected”). Each animal was dosed intraperitoneally with corresponding treatment at 24 and 72 hours post-infection (hpi). At 24, 48, 72, 96, and 120 hpi, each hamster was weighed and assessed for presence of clinical signs (lethargy, ruffled fur, hunched back posture, nasolacrimal discharge, and rapid breathing). At 120 hpi (5 days post-infection [dpi]), each hamster was anesthetized with isoflurane and then euthanized via cardiac exsanguination and blood was collected.
[00369] At 2 dpi, infected hamsters appeared quiet and began to progressively lose weight over the course of the study (up to ~13% reduction in untreated animals compared to uninfected controls). There was significantly less weight loss associated with Clone B (AvGn-B) treatment (P<0.0001) (FIG. 6A). None of the hamsters in the study died or met euthanasia criteria prior to study termination at 5 dpi. There was a significant reduction in viral RNA measured by qPCR in lung lavage samples from hamsters treated with Clone B (AvGn-B) (both 2.5 mg and 1 mg doses) compared to the samples from infected hamsters that were untreated (p = 0.0173 and 0.0303, respectively) (FIG. 6B).
[00370] The lungs were then extirpated en bloc and fixed whole in 10% neutral buffered formalin for at least 3 days to ensure virus inactivation before processing for histological analysis. Four transverse whole-lung sections per animal were stained with fast red and slides were counterstained with hematoxylin or processed for IHC. [00371] All lung sections were digitalized using a Nikon Eclipse 80i microscope and Nikon Digital Sight DS-FI1 camera (Nikon instruments, USA). Quantitative and qualitative microscopic analysis was determined using micrographs and morphological methods to quantify pulmonary lesions with the use of NIS-Elements (Nikon, Americas, USA).
[00372] Lungs from the two (2) uninfected AvGn-B treated hamsters did not show significant bronchiolar or parenchymal inflammation. Distal trachea and main stem bronchi contained microscopic hemorrhages and there were variable degrees of iatrogenic atelectasis, especially in cranial and middle portions of the lungs. Occasional peribronchiolar lymphoid follicles of moderate cellularity were present around bronchioles. Other organs, namely, tracheobronchial and hilar lymph nodes, heart and kidneys were within normal histologic limits. In virus-infected and untreated hamsters, approximately 50-75% of lung parenchyma, especially the inner parenchyma (i.e. , peribronchial lung tissue), was consolidated, dark red and heavier than outer inflated lung parenchyma. Massive cellular infiltrates of predominantly macrophages, 60-70%, intermixed with neutrophils, lymphocytes and plasma cells partially filled the lumina of terminal bronchioles and adjacent alveolar and perivascular spaces to varying degrees. In the most affected lobes, there was near complete obliteration of air spaces ( FIG 7A, panel B) compared to lungs from uninfected hamsters (FIG. 7A, panel A). The lungs from hamsters dosed with 1 mg Clone B (AvGn-B) (FIG. 7A, panel D) showed much less area with consolidation and cellular infiltrates compared to the untreated viral infected hamster or hamster treated with 2.5 mg isotype control IgG (FIG. 7A, panel C). In lungs of hamsters treated with Clone B (AvGn-B), the consolidated areas with cellular infiltrates were greatly reduced, focused mainly around the major bronchi and bronchioles with normal areas of alveolar spaces towards the periphery (FIG. 7A, panel D).
[00373] To better quantitate the differences observed visually, FI&E sections were manually screened for pattern recognition of affected versus unaffected pulmonary parenchyma. At least 6 representative regions of interest (ROI) were defined (1088 x 816 pm) and subjectively delineated (annotated) by a trained single veterinary pathologist based upon hypercellularity and consolidation of alveolar spaces. Manual annotation was compiled for digital quantification of affected areas of the lung to compare individual hamsters. Data were expressed as mean (±SEM). Statistical analyses were performed using one-way ANOVA multiple comparison test p values less than 0.05 were considered significant. Florizontal whole-lung slides of consecutive planes of SARS-CoV-2-infected and antibody-treated lungs were digitalized by Olympus histoslide scanner to create image data files that can be used for further digital image analysis (DIA). Analysis of the ROIs for bronchiointerstitial pneumonia confirmed that there was a statistically significant dose dependent decrease in the SARS-CoV-2 viral infected lungs from animals treated with Clone B (AvGn-B) compared to untreated infected animals (FIG. 7B).
[00374] When lung sections were stained for SARS-CoV-2 nucleocapsid protein, the lungs from infected untreated animals or animals treated with control lgG1 (Ab Control) had extensive immunoreactivity throughout the lung (FIG. 8, panels A and C) while infected animals treated with 1 mg/hamster of Clone B (AvGn-B) showed markedly reduced levels of immunostaining (FIG. 8, panel B) and in infected animals treated with 2.5 mg/hamster the parenchyma of the lungs was essentially clear of staining for virus, with the staining that was present occurring around the bronchi and blood vessels (FIG. 8, panel D).
[00375] To assess the effect of Clone B (AvGn-B) treatment on infiltrating macrophages and SARS-CoV-2 virus, paraffin embedded tissue sections were co stained for SARS-CoV-2 nucleocapsid protein (1:500) and ionized calcium binding adaptor molecule 1 (IBA1 , Abeam catalogue number ab5076; at a dilution of 1 :50), a marker for monocytes and macrophages using a Leica Bond RXm automated staining instrument following permeabilization using 0.01% Triton X diluted in Tris- buffered saline (TBS). Blocking was performed with 1% donkey serum diluted in TBS. Sections were stained for DAP I (Sigma) and images were captured using an Olympus BX63 fluorescence microscope equipped with a motorized stage and Flamamatsu ORCA-flash 4.0 LT CCD camera. Images were collected with Olympus cellSens software (v 1.18). Regions of interest (ROIs) were drawn around the perimeter of each tissue section and intensity thresholds were kept constant across groups analyses were performed blinded. Co-localization and intensity measurements were obtained using the Count and Measure feature of cellSens. [00376] Lungs were examined for the extent of macrophage infiltration and SARS- CoV-2 viral load at 5 days post infection by histopathological examination and by immunofluorescence imaging. High-resolution scans of whole mount lungs revealed pan-lobular replication of SARS-CoV-2 and largely centrilobular infiltration of IBA-1 + macrophages. Treatment with Clone B (AvGn-B) resulted in a dose dependent reduction, and treatment with 2.5 mg resulted in a dramatic decrease in the presence of IBA-1+ macrophages throughout the lung. The percent of total lung area displaying macrophage hypercellularity was quantified (FIG. 9A) and reflected the observed decrease in total hypercellular lung area in animals infected with SARS- CoV-2 and treated with increasing concentrations of Clone B (AvGn-B) (FIG. 8). [00377] These findings were confirmed by co-immunofluorescence imaging for macrophages (IBA-1+ cells) and SARS-CoV-2. Quantification of the number of IBA- 1+ cells co-localizing with SARS-CoV-2 (FIG. 9B), revealed similar trends and indicated that animals infected with SARS-CoV-2 and treated with 1 or 2.5 mg Clone B (AvGn-B) had a marked decrease in infiltration of IBA-1+ macrophages and a corresponding decrease in lung tissue pathology. EXAMPLE 7. GENERATION OF VARIANT ANTIBODIES
[00378] To generate variants of Clone B (AvGn-B), an antibody engineering campaign was performed. For this, a focused library of Clone B (AvGn-B) was built whereby changes were introduced at key CDR residues, 1 mutation per CDR per antibody clone, based on the CDR amino acid usage observed in a large database of naturally occurring human antibody sequences for the specific VH and VL subfamilies from which Clone B (AvGn-B) is derived . While any one clone will have a maximum of 6 mutations, the focused library as a whole covers more than 1 billion variants. The library was displayed on yeast, screened as described above in Example 1 and individual clone supernatants analyzed as described in Example 2. Selected clones were then produced as full-length IgG from Expi-293 cell cultures and tested in the cytopathic effect assay as described in Example 3.
[00379] The seven clones analyzed exhibited an approximately 1.5 to 2-fold improvement in affinity for the recombinant SARS-CoV-2-RBD antigen but a 5.6 to 8.5-fold improvement in ICso values for their ability to inhibit SARS-CoV-2-RBD- binding to ACE2-Fc compared to the parental Clone B (AvGn-B) clone (Table 17). Four of the clones were tested for their ability to block SARS-CoV-2 viral infection and cell death in the Vero-E6 CPE assay. Two of the four clones, B-H 1 and B-H2, showed a 5-fold improvement in ICso values, similar to the improvement in their ability to block SARS-CoV-2-RBD binding to ACE2-Fc receptor, while Clone AvGn- B-G4 exhibited an approximately 8-fold increase and Clone B-G2 (AvGn-B-G2) exhibited an almost 30-fold increase in potency in the CPE viral neutralization assay compared to the parental Clone B (AvGn-B) clone (Table 18) despite both clones having a similar ICso values for their ability to block the RBD-ACE2 interaction as clones B-H 1 and B-FI2. The apparent affinity of Clone B-G2 (AvGn-B-G2) binding to native SARS-CoV-2 spike protein expressed by transfected 293 cells was determined. Despite the increased potency of Clone B-G2 (AvGn-B-G2) in the CPE assay, it exhibited a similar affinity for native SARS-CoV-2 spike protein to that of the parental Clone B (AvGn-B) for the native spike protein expressed by 293 cells (Table 17). Neither clone exhibited binding to non-transfected 293 cells. In this experiment the apparent affinity of the ACE2-Fc protein binding to spike protein was 10.9 nM. Table 17
Figure imgf000160_0001
Table 18
Figure imgf000160_0002
EXAMPLE 8. AVIDITY FOR SARS-CoV-2 RBD MUTANTS
[00380] Several new strains of the SARS-CoV-2 virus have been identified with mutations in the RBD region. The following recombinant RBD domains (Arg306 - Phe527 of SARS-CoV-2 spike protein) of five such mutant strains were obtained from AcroBiosystems: N354D (cat.# SPD-S52H5), V367F (cat.# SPD-S52H4), R408I (cat.# SPD-S52H8), W436R (cat.# SPD-S52H7) and N354D + D364Y (cat.# SPD- S52H3). The apparent avidity of Clone B (AvGn-B) and the optimized variants of Clone B (AvGn-B) for these variant RBDs antigens compared to the original SARS- CoV-2 RBD was determined by ELISA. The different RBD proteins were coated onto separate wells of 96-well plates and serial dilutions of purified IgG were added to the relevant wells and bound antibody detected with HRP-labeled goat-anti-human IgG as described above. The apparent KD values (apparent avidity) are summarized in Table 19. There were no meaningful differences in avidity either between clones or for any given clone to the different mutant SARS-CoV-2 RBD proteins. TABLE 19
Figure imgf000161_0001
[00381] Additional new strains of the SARS-CoV-2 virus have been identified with mutations in the RBD region. These include the SARS-CoV-2 B.1.1.7, B.1.427 and P.1 variants which carry mutations that have been linked to increased transmissibility, namely the N501Y, K417N and E484K mutations. Therefore, antibody clones were tested for their apparent avidity for recombinant RBD domains carrying either N501Y (Sino Biological, cat.# 40592-V08H82), K417N (Sino Biological, cat.# 40592-V08H59) and E484K (Sino Biological, cat.# SPD-S52H3) mutations compared to the original RBD by ELISA as described above. Serial dilutions of antibody ranging from 20 nM to 0.00026 nM were added to the relevant wells and bound antibody detected with HRP-labeled goat-anti-human IgG as described above. The apparent KD values (apparent avidity) of the different antibody clones are summarized in Table 20. All the antibody clones tested bound with similar affinity to the N501Y and K417N mutant RBDs as to the original RBD. In the case of the E484K variant RBD, the Clone B (AvGn-B) family of clones exhibited a slight decrease in avidity to the E484K mutant RBD, although the apparent KD was still in the sub-nM to nM range. In contrast, Clone C (AvGn-C) showed weak binding and Clone F (AvGn-F) showed no detectable binding above background to the E484K variant RBD. These results indicate that the E484 residue within the RBD is important for Clone C (AvGn-C) and Clone F (AvGn-F) binding. TABLE 20
Figure imgf000162_0001
EXAMPLE 9. EPITOPE BINNING
[00382] To determine whether antibody clones, for example, Clone B (AvGn-B), Clone C (AvGn-C), and Clone F (AvGn-F), bound to distinct or overlapping epitopes within the 221 amino acid SARS-CoV-2 RBD, a competition ELISA was performed. For this, wells of a 96-well plate were coated with 150 ng/well of each clone, 4 wells per antibody to create a 3 by 4 matrix. Then a separate aliquot of each antibody clone (final concentration 100 nM) was incubated in the presence of 10 nM biotinylated SARS-CoV-2 RBD for 1 hour at room temperature, then added to wells and incubated for a further hour. The binding in the absence of inhibitor, was determined using buffer plus the biotinylated antigen alone. After washing, biotinylated SARS-CoV-2 RBD bound to the coated antibody in the well was detected with FIRP-labeled streptavidin. The percent inhibition was determined by comparing the OD reading in the presence of the competing antibody clone to the OD reading obtained in the absence of competitor. As shown in Table 21, all three antibody clones tested could compete effectively for antigen binding to each other, indicating that the antibody clones recognized overlapping epitopes within the RBD. TABLE 21
Figure imgf000163_0001
EMBODIMENTS
1. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
2. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
3. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
4. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
5. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRX1 TYLA (SEQ ID NO: 115) wherein Xi is S, G or D; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
6. The antibody or fragment thereof of embodiment 5, wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
7. The antibody or fragment thereof of embodiment 5, wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
8. The antibody or fragment thereof of embodiment 5, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
9. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
10. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
11. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
12. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
13. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
14. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
15. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
16. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
17. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
18. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
19. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
20. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
21. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
22. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
23. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
24. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
25. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. 26. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:10;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
27. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. 28. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:16;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
29. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:19; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. 30. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
31. The antibody or fragment thereof of any one of embodiments 17-30, wherein the VH region comprises an amino acid sequence of SEQ ID NO:25 and the VL region comprises an amino acid sequence of SEQ ID NO:26.
32. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
33. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
34. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
35. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
36. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
37. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
38. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
39. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
40. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
41. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
42. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
43. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
44. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
45. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
46. The antibody or fragment thereof of any one of embodiments 32-45, wherein the VH region comprises an amino acid sequence of SEQ ID NO:49 and the VL region comprises an amino acid sequence of SEQ ID NO:50.
47. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
48. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
49. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
50. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
51. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
52. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
53. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
54. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
55. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
56. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
57. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
58. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
59. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
60. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. 61. The antibody or fragment thereof of any one of embodiments 47-60, wherein the VH region comprises an amino acid sequence of SEQ ID NO:56 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
62. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
63. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
64. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
65. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
66. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
67. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
68. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
69. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
70. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
71. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
72. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
73. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:62;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
74. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
75. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
76. The antibody or fragment thereof of any one of embodiments 62-75, wherein the VH region comprises an amino acid sequence of SEQ ID NO:65 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
77. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
78. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
79. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
80. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
81. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
82. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
83. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
84. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
85. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
86. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
87. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
88. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
89. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
90. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
91. The antibody or fragment thereof of any one of embodiments 77-90, wherein the VH region comprises an amino acid sequence of SEQ ID NO:76 and the VL region comprises an amino acid sequence of SEQ ID NO:77.
92. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
93. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
94. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
95. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
96. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
97. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
98. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
99. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
100. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
101. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:10;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
102. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
103. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:81;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:16;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
104. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:82;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NQ:20; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
105. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
106. The antibody or fragment thereof of any one of embodiments 92-105, wherein the VH region comprises an amino acid sequence of SEQ ID NO:83 and the VL region comprises an amino acid sequence of SEQ ID NO:84.
107. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
108. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
109. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
110. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
111. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
112. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
113. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
114. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
115. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
116. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
117. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
118. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:92;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
119. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:93;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
120. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. 121. The antibody or fragment thereof of any one of embodiments 107-120, wherein the VH region comprises an amino acid sequence of SEQ ID NO:97 and the VL region comprises an amino acid sequence of SEQ ID NO:98.
122. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
123. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
124. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 101; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
125. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
126. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
127. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NQ:20; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
128. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
129. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
130. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
131. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:10;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
132. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
133. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:16;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
134. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
135. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
136. The antibody or fragment thereof of any one of embodiments 122-135, wherein the VH region comprises an amino acid sequence of SEQ ID NO: 106 and the VL region comprises an amino acid sequence of SEQ ID NO: 107.
137. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131, 136, and 141 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121, 127, 133, and 138; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
138. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
139. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 127; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
140. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
141. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 130; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
142. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 135; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
143. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
144. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:118, 124, 129, 130, 135;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131 , 136, 141 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, 137; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:121 , 127, 133, 138;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:122, 128, 139; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, 140.
145. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:118;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:122; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
146. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:124;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:125; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:128; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
147. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:129;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:122; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
148. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:130;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:133;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:128; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
149. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:135;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:138;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
150. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:122; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
151. The antibody or fragment thereof of any one of embodiments 137-150, wherein the VH region comprises an amino acid sequence of SEQ ID NO:142 and the VL region comprises an amino acid sequence of SEQ ID NO: 143.
152. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151 , 156, 161 , and 166; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
153. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 147; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
154. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 150; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 151; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
155. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 154; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 147; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
156. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
157. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 160; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 163; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
158. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
159. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151, 156, 161 , and 166; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
160. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
161. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:150;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:153;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
162. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 154;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
163. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:155;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:158;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
164. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:160;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:161 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or (b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
165. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
166. The antibody or fragment thereof of any one of embodiments 152-165, wherein the VH region comprises an amino acid sequence of SEQ ID NO:167 and the VL region comprises an amino acid sequence of SEQ ID NO: 168.
167. An antibody or fragment thereof that competes for binding to SARS-CoV- 2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and a light chain variable region having an amino acid sequence of SEQ ID NO:77; (vi) a heavy chain variable region having an amino acid sequence of SEQ ID NO:83 and a light chain variable region having an amino acid sequence of SEQ ID NO:84; (vii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:97 and a light chain variable region having an amino acid sequence of SEQ ID NO:98; and/or (viii) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 106 and a light chain variable region having an amino acid sequence of SEQ ID NO: 107; and/or (B)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and a light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (C)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and a light chain variable region having an amino acid sequence of SEQ ID NO: 168.
168. The antibody or fragment thereof of embodiment 167 that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO:143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and the light chain variable region having an amino acid sequence of SEQ ID NO:168.
169. An antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 107; (ix) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143; or (x) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
170. The antibody or fragment thereof of embodiment 169 that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; or (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:107.
171. The antibody or fragment thereof of embodiment 169 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 143.
172. The antibody or fragment thereof of embodiment 169 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 168. 173. The antibody or fragment thereof of any one of embodiments 1 -172, wherein the VH region and/or VL region further comprises human framework sequences.
174. The antibody or fragment thereof of any one of embodiments 1 -172, wherein the VH region and/or VL region further comprises a framework 1 (FR1). a framework 2 (FR2), a framework 3 (FR3) and/or a framework 4 (FR4) sequence.
175. The antibody or fragment thereof of any one of embodiments 1 -174, wherein the antibody is a monoclonal antibody.
176. The antibody or fragment thereof of any one of embodiments 1-175, wherein the monoclonal antibody is a humanized, human or chimeric antibody.
177. The antibody or fragment thereof of any one of embodiments 1 -176, wherein the antibody or fragment thereof is a Fab, Fab’, F(ab’)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable region antibody, single variable region antibody, linear antibody, V region, or a multispecific antibody formed from antibody fragments.
178. The antibody or fragment thereof of any one of embodiments 1 -177, wherein the antibody or fragment thereof is conjugated to a detectable marker.
179. The antibody or fragment thereof of embodiment 178, wherein the detectable marker is selected from a radioisotope, a metal chelator, an enzyme, a fluorescent compound, a bioluminescent compound and a chemiluminescent compound.
180. The antibody or fragment thereof of any one of embodiments 1 -173, wherein the binding to SARS-CoV-2 blocks the interaction of SARS CoV and an ACE-2 receptor.
181. One or more vectors comprising one or more polynucleotides encoding the antibody or fragment thereof of any one of embodiments 1 -179.
182. A composition that comprises the antibody or fragment thereof of any one of embodiments 1 -180.
183. An antibody or fragment thereof that binds to essentially the same epitope as the antibody or fragment thereof of any one of embodiments 1 -180 or that competes for the binding of the antibody or fragment thereof of any one of embodiments 1-180 to SARS-CoV-2.
184. A method treating, preventing, or ameliorating a SARS-CoV-2 related disease, disorder, or condition comprising administering to a subject in need thereof an effective amount of the antibody or fragment thereof of any one of embodiments 1-174.
185. The method of embodiment 184, wherein the method further comprises administering to the subject an additional agent.
[00383] While example embodiments have been particularly shown and described, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the embodiments encompassed by the appended claims.
[00384] From the foregoing, it will be appreciated that, although specific embodiments have been described herein for the purpose of illustration, various modifications may be made without deviating from the spirit and scope of what is provided herein. All of the references referred to above are incorporated herein by reference in their entireties.
ADDITIONAL SEQUENCES
SARS-CoV-2 spike protein sequence (UniProt P0DTC2) receptor binding domain (RBD) (residues Arg319 to Asn532):
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFS TFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTG CVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFN CYFPLQSYGFQPTNGVGYQPYRVWLSFELLHAPATVCGPKKSTN (SEQ ID NO:27)
Bolded and underlined amino acids represent mutations sites (N354D, D364Y, V367F, R408I, W436R, N501Y, K417N, E484K) within the RBD {see, e.g., Example 8, including Tables 19-20).
SARS-CoV-2 spike protein sequence (UniProt P0DTC2) S1 domain; residues Gln14 to Arg683:
QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIH
VSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNV
VIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG
KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPL
SETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAW
NRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQI
APGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFER
DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVWLSFELLHAPA
TVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRD
PQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRV
YSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR (SEQ ID
NO:28)
SARS-CoV-1 spike protein sequence (UniProt P59594) receptor binding domain (RBD) (residues Arg306-Phe527):
RWPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFF STFKCYGVSATKLNDLCFSNVYADSFWKGDDVRQIAPGQTGVIADYNYKLPDDFM GCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALN C YWP L N D YG FYTTTG I GYQ P YR WVLS F E L L N AP ATVC GPKLSTDLIKNQCVNF (SEQ ID NO:29) Human ACE2 sequence (UniProt Q9BYF1) (residues Gln18 -Ser740):
QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAF
LKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYST
GKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEY
WLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYE
HLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVT
DAM VD QAWDAQ R I F KEAE KF FVSVG LP NMTQGFWE N SM LTD PG N VQ KAVC H PTA
WDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEA
VGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRW
MVFKGEIPKDQWMKKWWEMKREIVGWEPVPHDETYCDPASLFHVSNDYSFIRYY
TRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALEN
WGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSA
LGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFN
FFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
(SEQ ID NO:30)
SARS-CoV-2 spike protein sequence (UniProt P0DTC2) residues 13 to 1273:
SQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAI
HVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATN
WIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQ
TLLALHRSYLTPGDSSSGWFAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDP
LSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVR
QIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPF
ERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRWVLSFELLHA
PATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV
RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTW
RVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVAS
QSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTE
CSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQI
LPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPP
LLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQ
KLIANQFNSAIGKIQDSLSSTASALGKLQDWNQNAQALNTLVKQLSSNFGAISSVLN
DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQ
SKRVDFCGKGYHLMSFPQSAPHGWFLHVTYVPAQEKNFTTAPAICHDGKAHFPR
EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDWIGIVNNTVYDPLQPELDSF
KEELDKYFKNHTSPDVDLGDISGINASWNIQKEIDRLNEVAKNLNESLIDLQELGKY
EQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE
PVLKGVKLHYT (SEQ ID NO:31 )

Claims

WHAT IS CLAIMED IS:
1. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and/or
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
2. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
3. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
4. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
5. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and/or
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
6. The antibody or fragment thereof of claim 5, wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
7. The antibody or fragment thereof of claim 5, wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
8. The antibody or fragment thereof of claim 5, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
9. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
10. The antibody or fragment thereof of claim 9, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
11. The antibody or fragment thereof of claim 9 or 10, wherein the VH region comprises an amino acid sequence of SEQ ID NO:25 and the VL region comprises an amino acid sequence of SEQ ID NO:26.
12. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
13. The antibody or fragment thereof of claim 12, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
14. The antibody or fragment thereof of claim 12 or 13, wherein the VH region comprises an amino acid sequence of SEQ ID NO:49 and the VL region comprises an amino acid sequence of SEQ ID NO:50.
15. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
16. The antibody or fragment thereof of claim 15, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
17. The antibody or fragment thereof of claim 15 or 16, wherein the VH region comprises an amino acid sequence of SEQ ID NO:56 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
18. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
19. The antibody or fragment thereof of claim 18, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
20. The antibody or fragment thereof of claim 18 or 19, wherein the VH region comprises an amino acid sequence of SEQ ID NO:65 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
21. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
22. The antibody or fragment thereof of claim 21 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
23. The antibody or fragment thereof of claim 21 or 22, wherein the VH region comprises an amino acid sequence of SEQ ID NO:76 and the VL region comprises an amino acid sequence of SEQ ID NO:77.
24. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
25. The antibody or fragment thereof of claim 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
26. The antibody or fragment thereof of claim 24 or 25, wherein the VH region comprises an amino acid sequence of SEQ ID NO:83 and the VL region comprises an amino acid sequence of SEQ ID NO:84.
27. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
28. The antibody or fragment thereof of claim 27, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
29. The antibody or fragment thereof of claim 27 or 28, wherein the VH region comprises an amino acid sequence of SEQ ID NO:97 and the VL region comprises an amino acid sequence of SEQ ID NO:98.
30. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
31. The antibody or fragment thereof of claim 30, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
32. The antibody or fragment thereof of claim 30 or 31 , wherein the VH region comprises an amino acid sequence of SEQ ID NO: 106 and the VL region comprises an amino acid sequence of SEQ ID NO: 107.
33. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131, 136, and 141 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or
(b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121, 127, 133, and 138; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
34. The antibody or fragment thereof of claim 33, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:118, 124, 129, 130, 135;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:119, 125, 131 , 136, 141 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, 137; and
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:121 , 127, 133, 138;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:122, 128, 139; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, 140.
35. The antibody or fragment thereof of claim 33 or 34, wherein the VH region comprises an amino acid sequence of SEQ ID NO: 142 and the VL region comprises an amino acid sequence of SEQ ID NO: 143.
36. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151, 156, 161 , and 166; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
37. The antibody or fragment thereof of claim 36, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151, 156, 161 , and 166; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
38. The antibody or fragment thereof of claim 36 or 37, wherein the VH region comprises an amino acid sequence of SEQ ID NO:167 and the VL region comprises an amino acid sequence of SEQ ID NO: 168.
39. An antibody or fragment thereof that competes for binding to SARS-CoV- 2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and a light chain variable region having an amino acid sequence of SEQ ID NO:77; (vi) a heavy chain variable region having an amino acid sequence of SEQ ID NO:83 and a light chain variable region having an amino acid sequence of SEQ ID NO:84; (vii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:97 and a light chain variable region having an amino acid sequence of SEQ ID NO:98; and/or (viii) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 106 and a light chain variable region having an amino acid sequence of SEQ ID NO: 107; and/or (B)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and a light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (C)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and a light chain variable region having an amino acid sequence of SEQ ID NO: 168.
40. The antibody or fragment thereof of claim 39 that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and the light chain variable region having an amino acid sequence of SEQ ID NO: 168.
41. An antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 107; (ix) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143; or (x) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
42. The antibody or fragment thereof of claim 41 that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; or (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:107.
43. The antibody or fragment thereof of claim 41 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 143.
44. The antibody or fragment thereof of claim 41 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 168.
45. The antibody or fragment thereof of any one of claims 1 -44, wherein the VH region and/or VL region further comprises human framework sequences.
46. The antibody or fragment thereof of any one of claims 1 -44, wherein the VH region and/or VL region further comprises a framework 1 (FR1 ). a framework 2 (FR2), a framework 3 (FR3) and/or a framework 4 (FR4) sequence.
47. The antibody or fragment thereof of any one of claims 1 -44, wherein the antibody is a monoclonal antibody.
48. The antibody or fragment thereof of any one of claims 1 -47, wherein the monoclonal antibody is a humanized, human or chimeric antibody.
49. The antibody or fragment thereof of any one of claims 1 -48, wherein the antibody or fragment thereof is a Fab, Fab’, F(ab’)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable region antibody, single variable region antibody, linear antibody, V region, or a multispecific antibody formed from antibody fragments.
50. The antibody or fragment thereof of any one of claims 1 -49, wherein the antibody or fragment thereof is conjugated to a detectable marker.
51 The antibody or fragment thereof of claim 50, wherein the detectable marker is selected from a radioisotope, a metal chelator, an enzyme, a fluorescent compound, a bioluminescent compound and a chemiluminescent compound.
52. The antibody or fragment thereof of any one of claims 1 -51 , wherein the binding to SARS-CoV-2 blocks the interaction of SARS CoV and an ACE-2 receptor.
53. One or more vectors comprising one or more polynucleotides encoding the antibody or fragment thereof of any one of claims 1-51.
54. A composition that comprises the antibody or fragment thereof of any one of claims 1-52.
55. An antibody or fragment thereof that binds to essentially the same epitope as the antibody or fragment thereof of any one of claims 1 -52 or that competes for the binding of the antibody or fragment thereof of any one of claims 1- 52 to SARS-CoV-2.
56. A method treating, preventing, or ameliorating a SARS-CoV-2 related disease, disorder, or condition comprising administering to a subject in need thereof an effective amount of the antibody or fragment thereof of any one of claims 1-52.
57. The method of claim 56, wherein the method further comprises administering to the subject an additional agent.
PCT/US2021/034810 2020-05-28 2021-05-28 Sars-cov-2 binding agents and uses thereof WO2021243185A2 (en)

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US202063031565P 2020-05-28 2020-05-28
US202063031564P 2020-05-28 2020-05-28
US202063031560P 2020-05-28 2020-05-28
US63/031,560 2020-05-28
US63/031,565 2020-05-28
US63/031,564 2020-05-28
US202063081893P 2020-09-22 2020-09-22
US63/081,893 2020-09-22

Publications (3)

Publication Number Publication Date
WO2021243185A2 WO2021243185A2 (en) 2021-12-02
WO2021243185A3 WO2021243185A3 (en) 2021-12-23
WO2021243185A9 true WO2021243185A9 (en) 2022-01-27

Family

ID=78722876

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/034810 WO2021243185A2 (en) 2020-05-28 2021-05-28 Sars-cov-2 binding agents and uses thereof

Country Status (1)

Country Link
WO (1) WO2021243185A2 (en)

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10131704B2 (en) * 2014-04-25 2018-11-20 Dana-Farber Cancer Institute, Inc. Middle east respiratory syndrome coronavirus neutralizing antibodies and methods of use thereof

Also Published As

Publication number Publication date
WO2021243185A2 (en) 2021-12-02
WO2021243185A3 (en) 2021-12-23

Similar Documents

Publication Publication Date Title
CN111690058B (en) Antibodies with neutralizing activity against coronaviruses and uses thereof
JP7171809B2 (en) Antibodies that potently neutralize hepatitis B virus and uses thereof
JP5800809B2 (en) TLR3 binding agent
CN113544148B (en) Antibody for neutralizing hepatitis B virus and use thereof
WO2021218879A1 (en) Sars-cov-2 neutralizing antibody and preparation and use thereof
JP2023534923A (en) Antigen-binding molecule targeting SARS-CoV-2
KR20230016186A (en) Method for treating inflammatory diseases by galectic-3 blockade
KR20230035217A (en) 2019 Novel Coronavirus Humanized Monoclonal Antibodies and Uses Thereof
WO2021063352A1 (en) Anti-pd-l1 antigen binding protein, and application thereof
JP2023534922A (en) Antigen-binding molecule targeting SARS-CoV-2
WO2013184200A1 (en) Human monoclonal antibodies against human chemokine receptor ccr7
US20220380441A1 (en) Antibody compositions and methods for treating hepatitis b virus infection
WO2021237516A1 (en) Sars-cov-2 antibody and application thereof
US20240092872A1 (en) Compositions and methods for treating hepatitis b virus infection
WO2021244601A1 (en) Neutralizing antibody of sars-cov-2 virus and application thereof
JP2024518335A (en) Human neutralizing monoclonal antibodies against SARS-CoV-2 and their uses
WO2021243185A9 (en) Sars-cov-2 binding agents and uses thereof
EP4164673A2 (en) Methods and compositions related to neutralizing antibodies against human coronavirus
TW202102204A (en) Pharmaceutical composition comprising anti-il-5 antibody and uses thereof
WO2021190500A1 (en) Preparation and application of cross-neutralizing antibody of sars-cov-2 and sars-cov
CN113164601B (en) Isolated antigen binding proteins and uses thereof
CN113166264B (en) Isolated antigen binding proteins and uses thereof
TW202229333A (en) Coronavirus-binding molecules and methods of use thereof
KR20230123477A (en) Methods for treating or preventing acute respiratory distress syndrome
WO2022051223A1 (en) Use of sars-cov-2 receptor binding motif (rbm)-reactive monoclonal antibodies to treat covid-19

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21812449

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21812449

Country of ref document: EP

Kind code of ref document: A2