WO2021243185A9 - Sars-cov-2 binding agents and uses thereof - Google Patents
Sars-cov-2 binding agents and uses thereof Download PDFInfo
- Publication number
- WO2021243185A9 WO2021243185A9 PCT/US2021/034810 US2021034810W WO2021243185A9 WO 2021243185 A9 WO2021243185 A9 WO 2021243185A9 US 2021034810 W US2021034810 W US 2021034810W WO 2021243185 A9 WO2021243185 A9 WO 2021243185A9
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- antibody
- cdr3
- Prior art date
Links
- 239000011230 binding agent Substances 0.000 title abstract description 520
- 241001678559 COVID-19 virus Species 0.000 claims abstract description 681
- 239000003795 chemical substances by application Substances 0.000 claims abstract description 137
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 73
- 238000000034 method Methods 0.000 claims abstract description 65
- 208000035475 disorder Diseases 0.000 claims abstract description 45
- 208000037750 SARS-CoV-2-related disease Diseases 0.000 claims abstract description 34
- 239000000203 mixture Substances 0.000 claims abstract description 23
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 1932
- 239000012634 fragment Substances 0.000 claims description 236
- 230000027455 binding Effects 0.000 claims description 149
- 150000001413 amino acids Chemical class 0.000 claims description 89
- 108091033319 polynucleotide Proteins 0.000 claims description 29
- 239000002157 polynucleotide Substances 0.000 claims description 29
- 102000040430 polynucleotide Human genes 0.000 claims description 29
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 28
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 28
- 239000013598 vector Substances 0.000 claims description 22
- 229910052727 yttrium Inorganic materials 0.000 claims description 20
- 241000315672 SARS coronavirus Species 0.000 claims description 15
- 229910052731 fluorine Inorganic materials 0.000 claims description 13
- 229910052739 hydrogen Inorganic materials 0.000 claims description 11
- 229910052717 sulfur Inorganic materials 0.000 claims description 11
- 230000003993 interaction Effects 0.000 claims description 10
- 150000001875 compounds Chemical class 0.000 claims description 9
- 230000009977 dual effect Effects 0.000 claims description 5
- 239000003550 marker Substances 0.000 claims description 5
- 102000004190 Enzymes Human genes 0.000 claims description 2
- 108090000790 Enzymes Proteins 0.000 claims description 2
- 229910052751 metal Inorganic materials 0.000 claims description 2
- 239000002184 metal Substances 0.000 claims description 2
- 239000002738 chelating agent Substances 0.000 claims 1
- 239000007850 fluorescent dye Substances 0.000 claims 1
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 abstract description 127
- 201000010099 disease Diseases 0.000 abstract description 28
- 208000024891 symptom Diseases 0.000 abstract description 26
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 589
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 277
- 210000004027 cell Anatomy 0.000 description 124
- 235000001014 amino acid Nutrition 0.000 description 83
- 239000000427 antigen Substances 0.000 description 82
- 108091007433 antigens Proteins 0.000 description 82
- 102000036639 antigens Human genes 0.000 description 82
- 229940024606 amino acid Drugs 0.000 description 73
- 108091005634 SARS-CoV-2 receptor-binding domains Proteins 0.000 description 57
- 108090000765 processed proteins & peptides Proteins 0.000 description 55
- 108090000623 proteins and genes Proteins 0.000 description 51
- 210000004072 lung Anatomy 0.000 description 45
- 102000004169 proteins and genes Human genes 0.000 description 44
- 102000004196 processed proteins & peptides Human genes 0.000 description 42
- 229920001184 polypeptide Polymers 0.000 description 41
- 235000018102 proteins Nutrition 0.000 description 41
- 239000003112 inhibitor Substances 0.000 description 31
- 241000699800 Cricetinae Species 0.000 description 30
- 108060003951 Immunoglobulin Proteins 0.000 description 30
- 230000014509 gene expression Effects 0.000 description 30
- 102000018358 immunoglobulin Human genes 0.000 description 30
- 102000005962 receptors Human genes 0.000 description 30
- 108020003175 receptors Proteins 0.000 description 30
- 208000015181 infectious disease Diseases 0.000 description 28
- 241001465754 Metazoa Species 0.000 description 27
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 27
- 238000003556 assay Methods 0.000 description 27
- 230000003612 virological effect Effects 0.000 description 27
- 210000002540 macrophage Anatomy 0.000 description 25
- 230000000694 effects Effects 0.000 description 24
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 23
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 23
- 101000840258 Homo sapiens Immunoglobulin J chain Proteins 0.000 description 20
- 102100029571 Immunoglobulin J chain Human genes 0.000 description 20
- 241000494545 Cordyline virus 2 Species 0.000 description 18
- 108091005609 SARS-CoV-2 Spike Subunit S1 Proteins 0.000 description 18
- 238000012360 testing method Methods 0.000 description 18
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 description 17
- -1 homotrimer Proteins 0.000 description 17
- 238000006467 substitution reaction Methods 0.000 description 17
- 238000002965 ELISA Methods 0.000 description 16
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 16
- 241000700605 Viruses Species 0.000 description 15
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 14
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 14
- 238000011282 treatment Methods 0.000 description 14
- 102000004127 Cytokines Human genes 0.000 description 13
- 108090000695 Cytokines Proteins 0.000 description 13
- 102000044437 S1 domains Human genes 0.000 description 13
- 108700036684 S1 domains Proteins 0.000 description 13
- 125000000539 amino acid group Chemical group 0.000 description 13
- 239000003814 drug Substances 0.000 description 13
- 239000001963 growth medium Substances 0.000 description 13
- 210000001519 tissue Anatomy 0.000 description 12
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 11
- 208000025721 COVID-19 Diseases 0.000 description 11
- 229940096437 Protein S Drugs 0.000 description 11
- 101710198474 Spike protein Proteins 0.000 description 11
- 108010090804 Streptavidin Proteins 0.000 description 11
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 11
- 239000005090 green fluorescent protein Substances 0.000 description 11
- 230000001404 mediated effect Effects 0.000 description 11
- 230000003472 neutralizing effect Effects 0.000 description 11
- 230000004044 response Effects 0.000 description 11
- 241000283707 Capra Species 0.000 description 10
- 206010050685 Cytokine storm Diseases 0.000 description 10
- 108010004729 Phycoerythrin Proteins 0.000 description 10
- 108010001267 Protein Subunits Proteins 0.000 description 10
- 102000002067 Protein Subunits Human genes 0.000 description 10
- 208000037847 SARS-CoV-2-infection Diseases 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 10
- 206010052015 cytokine release syndrome Diseases 0.000 description 10
- 230000007423 decrease Effects 0.000 description 10
- 108020001507 fusion proteins Proteins 0.000 description 10
- 230000002998 immunogenetic effect Effects 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 238000004519 manufacturing process Methods 0.000 description 10
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 10
- 230000021615 conjugation Effects 0.000 description 9
- 230000000120 cytopathologic effect Effects 0.000 description 9
- 102000037865 fusion proteins Human genes 0.000 description 9
- 239000002953 phosphate buffered saline Substances 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 8
- 102400001107 Secretory component Human genes 0.000 description 8
- 239000002502 liposome Substances 0.000 description 8
- 210000001616 monocyte Anatomy 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 230000002685 pulmonary effect Effects 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 7
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 7
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 7
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 7
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 7
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 7
- 239000012148 binding buffer Substances 0.000 description 7
- 210000004408 hybridoma Anatomy 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 230000009870 specific binding Effects 0.000 description 7
- 238000010186 staining Methods 0.000 description 7
- 230000009261 transgenic effect Effects 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 230000030833 cell death Effects 0.000 description 6
- 238000005345 coagulation Methods 0.000 description 6
- 230000015271 coagulation Effects 0.000 description 6
- PHTXVQQRWJXYPP-UHFFFAOYSA-N ethyltrifluoromethylaminoindane Chemical compound C1=C(C(F)(F)F)C=C2CC(NCC)CC2=C1 PHTXVQQRWJXYPP-UHFFFAOYSA-N 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 230000002757 inflammatory effect Effects 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 239000004474 valine Substances 0.000 description 6
- 210000005253 yeast cell Anatomy 0.000 description 6
- 108091035707 Consensus sequence Proteins 0.000 description 5
- 241000711573 Coronaviridae Species 0.000 description 5
- 101710114810 Glycoprotein Proteins 0.000 description 5
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 5
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 101710167605 Spike glycoprotein Proteins 0.000 description 5
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 230000000840 anti-viral effect Effects 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 238000010790 dilution Methods 0.000 description 5
- 239000012895 dilution Substances 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 238000010353 genetic engineering Methods 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 230000008595 infiltration Effects 0.000 description 5
- 238000001764 infiltration Methods 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 230000005291 magnetic effect Effects 0.000 description 5
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 5
- 238000006386 neutralization reaction Methods 0.000 description 5
- 150000007523 nucleic acids Chemical class 0.000 description 5
- 108010071584 oxidized low density lipoprotein Proteins 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 5
- 238000013207 serial dilution Methods 0.000 description 5
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 5
- 241000701447 unidentified baculovirus Species 0.000 description 5
- 102000049320 CD36 Human genes 0.000 description 4
- 108010045374 CD36 Antigens Proteins 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 4
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- 206010061218 Inflammation Diseases 0.000 description 4
- 102000000589 Interleukin-1 Human genes 0.000 description 4
- 108010002352 Interleukin-1 Proteins 0.000 description 4
- 102000004889 Interleukin-6 Human genes 0.000 description 4
- 108090001005 Interleukin-6 Proteins 0.000 description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- 206010035664 Pneumonia Diseases 0.000 description 4
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 4
- 108091008874 T cell receptors Proteins 0.000 description 4
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 239000005557 antagonist Substances 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 238000012575 bio-layer interferometry Methods 0.000 description 4
- 238000004422 calculation algorithm Methods 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 238000002659 cell therapy Methods 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000006872 improvement Effects 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000004054 inflammatory process Effects 0.000 description 4
- 206010022000 influenza Diseases 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- 230000009871 nonspecific binding Effects 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 238000011002 quantification Methods 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- 230000003362 replicative effect Effects 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 229910052720 vanadium Inorganic materials 0.000 description 4
- FDKWRPBBCBCIGA-REOHCLBHSA-N (2r)-2-azaniumyl-3-$l^{1}-selanylpropanoate Chemical compound [Se]C[C@H](N)C(O)=O FDKWRPBBCBCIGA-REOHCLBHSA-N 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 3
- 102100040121 Allograft inflammatory factor 1 Human genes 0.000 description 3
- 201000001320 Atherosclerosis Diseases 0.000 description 3
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 3
- 102000000018 Chemokine CCL2 Human genes 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 101000890626 Homo sapiens Allograft inflammatory factor 1 Proteins 0.000 description 3
- 101000929928 Homo sapiens Angiotensin-converting enzyme 2 Proteins 0.000 description 3
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 3
- 108020004459 Small interfering RNA Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 108700019146 Transgenes Proteins 0.000 description 3
- 108020000999 Viral RNA Proteins 0.000 description 3
- 210000000628 antibody-producing cell Anatomy 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 210000000621 bronchi Anatomy 0.000 description 3
- 210000003123 bronchiole Anatomy 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 229910052799 carbon Inorganic materials 0.000 description 3
- 230000003833 cell viability Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000004087 circulation Effects 0.000 description 3
- 239000003246 corticosteroid Substances 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000002022 differential scanning fluorescence spectroscopy Methods 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 230000003511 endothelial effect Effects 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 230000001747 exhibiting effect Effects 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 102000048657 human ACE2 Human genes 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 229940127121 immunoconjugate Drugs 0.000 description 3
- 238000002513 implantation Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 238000002844 melting Methods 0.000 description 3
- 230000008018 melting Effects 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 210000000440 neutrophil Anatomy 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 3
- 150000003904 phospholipids Chemical class 0.000 description 3
- 210000002381 plasma Anatomy 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 239000003642 reactive oxygen metabolite Substances 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 239000006152 selective media Substances 0.000 description 3
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 3
- 235000016491 selenocysteine Nutrition 0.000 description 3
- 229940055619 selenocysteine Drugs 0.000 description 3
- 239000004055 small Interfering RNA Substances 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 238000011830 transgenic mouse model Methods 0.000 description 3
- 230000007704 transition Effects 0.000 description 3
- 239000003656 tris buffered saline Substances 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 230000004580 weight loss Effects 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- HMLGSIZOMSVISS-ONJSNURVSA-N (7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-(2,2-dimethylpropanoyloxymethoxyimino)acetyl]amino]-3-ethenyl-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound N([C@@H]1C(N2C(=C(C=C)CSC21)C(O)=O)=O)C(=O)\C(=N/OCOC(=O)C(C)(C)C)C1=CSC(N)=N1 HMLGSIZOMSVISS-ONJSNURVSA-N 0.000 description 2
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical class C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 2
- DEVSOMFAQLZNKR-RJRFIUFISA-N (z)-3-[3-[3,5-bis(trifluoromethyl)phenyl]-1,2,4-triazol-1-yl]-n'-pyrazin-2-ylprop-2-enehydrazide Chemical compound FC(F)(F)C1=CC(C(F)(F)F)=CC(C2=NN(\C=C/C(=O)NNC=3N=CC=NC=3)C=N2)=C1 DEVSOMFAQLZNKR-RJRFIUFISA-N 0.000 description 2
- MSYGAHOHLUJIKV-UHFFFAOYSA-N 3,5-dimethyl-1-(3-nitrophenyl)-1h-pyrazole-4-carboxylic acid ethyl ester Chemical compound CC1=C(C(=O)OCC)C(C)=NN1C1=CC=CC([N+]([O-])=O)=C1 MSYGAHOHLUJIKV-UHFFFAOYSA-N 0.000 description 2
- CAOTVXGYTWCKQE-UHFFFAOYSA-N 3-(4-chlorophenyl)-N-(pyridin-4-ylmethyl)-1-adamantanecarboxamide Chemical compound C1=CC(Cl)=CC=C1C1(C2)CC(C3)(C(=O)NCC=4C=CN=CC=4)CC2CC3C1 CAOTVXGYTWCKQE-UHFFFAOYSA-N 0.000 description 2
- AKJHMTWEGVYYSE-AIRMAKDCSA-N 4-HPR Chemical compound C=1C=C(O)C=CC=1NC(=O)/C=C(\C)/C=C/C=C(C)C=CC1=C(C)CCCC1(C)C AKJHMTWEGVYYSE-AIRMAKDCSA-N 0.000 description 2
- 102000010565 Apoptosis Regulatory Proteins Human genes 0.000 description 2
- 108010063104 Apoptosis Regulatory Proteins Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 description 2
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 description 2
- 102100033620 Calponin-1 Human genes 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- 102100031673 Corneodesmosin Human genes 0.000 description 2
- 101710139375 Corneodesmosin Proteins 0.000 description 2
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 2
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- JVHXJTBJCFBINQ-ADAARDCZSA-N Dapagliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)=CC=C1Cl JVHXJTBJCFBINQ-ADAARDCZSA-N 0.000 description 2
- 108010052167 Dihydroorotate Dehydrogenase Proteins 0.000 description 2
- 102100032823 Dihydroorotate dehydrogenase (quinone), mitochondrial Human genes 0.000 description 2
- 102100029921 Dipeptidyl peptidase 1 Human genes 0.000 description 2
- 208000000059 Dyspnea Diseases 0.000 description 2
- 206010013975 Dyspnoeas Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000283074 Equus asinus Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 102100037907 High mobility group protein B1 Human genes 0.000 description 2
- 101710168537 High mobility group protein B1 Proteins 0.000 description 2
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 2
- 101000945318 Homo sapiens Calponin-1 Proteins 0.000 description 2
- 101000674278 Homo sapiens Serine-tRNA ligase, cytoplasmic Proteins 0.000 description 2
- 101000674040 Homo sapiens Serine-tRNA ligase, mitochondrial Proteins 0.000 description 2
- 101000652736 Homo sapiens Transgelin Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 2
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108700021006 Interleukin-1 receptor antagonist Proteins 0.000 description 2
- 108010067003 Interleukin-33 Proteins 0.000 description 2
- 102000017761 Interleukin-33 Human genes 0.000 description 2
- 108010024121 Janus Kinases Proteins 0.000 description 2
- 102000015617 Janus Kinases Human genes 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 2
- 241000699673 Mesocricetus auratus Species 0.000 description 2
- 102100034068 Monocarboxylate transporter 1 Human genes 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 2
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 2
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 2
- 108091006197 SARS-CoV-2 Nucleocapsid Protein Proteins 0.000 description 2
- 229940124639 Selective inhibitor Drugs 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102100040516 Serine-tRNA ligase, cytoplasmic Human genes 0.000 description 2
- 102100020888 Sodium/glucose cotransporter 2 Human genes 0.000 description 2
- 101710103228 Sodium/glucose cotransporter 2 Proteins 0.000 description 2
- 102000011011 Sphingosine 1-phosphate receptors Human genes 0.000 description 2
- 108050001083 Sphingosine 1-phosphate receptors Proteins 0.000 description 2
- 102100027662 Sphingosine kinase 2 Human genes 0.000 description 2
- 101710156532 Sphingosine kinase 2 Proteins 0.000 description 2
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 2
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 2
- 239000004012 Tofacitinib Substances 0.000 description 2
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 2
- 102100031989 Transmembrane protease serine 2 Human genes 0.000 description 2
- 101710081844 Transmembrane protease serine 2 Proteins 0.000 description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 description 2
- 102000011017 Type 4 Cyclic Nucleotide Phosphodiesterases Human genes 0.000 description 2
- 108010037584 Type 4 Cyclic Nucleotide Phosphodiesterases Proteins 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 229960004238 anakinra Drugs 0.000 description 2
- 230000003110 anti-inflammatory effect Effects 0.000 description 2
- 239000003146 anticoagulant agent Substances 0.000 description 2
- 229940127219 anticoagulant drug Drugs 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- IMOZEMNVLZVGJZ-QGZVFWFLSA-N apremilast Chemical compound C1=C(OC)C(OCC)=CC([C@@H](CS(C)(=O)=O)N2C(C3=C(NC(C)=O)C=CC=C3C2=O)=O)=C1 IMOZEMNVLZVGJZ-QGZVFWFLSA-N 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 229950000971 baricitinib Drugs 0.000 description 2
- XUZMWHLSFXCVMG-UHFFFAOYSA-N baricitinib Chemical compound C1N(S(=O)(=O)CC)CC1(CC#N)N1N=CC(C=2C=3C=CNC=3N=CN=2)=C1 XUZMWHLSFXCVMG-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229940126587 biotherapeutics Drugs 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 210000004271 bone marrow stromal cell Anatomy 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 230000008045 co-localization Effects 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 238000002591 computed tomography Methods 0.000 description 2
- 238000007596 consolidation process Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- LTWQNYPDAUSXBC-CDJGKPBYSA-L dantrolene sodium hemiheptahydrate Chemical compound O.O.O.O.O.O.O.[Na+].[Na+].C1=CC([N+](=O)[O-])=CC=C1C(O1)=CC=C1\C=N\N1C(=O)[N-]C(=O)C1.C1=CC([N+](=O)[O-])=CC=C1C(O1)=CC=C1\C=N\N1C(=O)[N-]C(=O)C1 LTWQNYPDAUSXBC-CDJGKPBYSA-L 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 238000011496 digital image analysis Methods 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- IZEKFCXSFNUWAM-UHFFFAOYSA-N dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 2
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- XUFQPHANEAPEMJ-UHFFFAOYSA-N famotidine Chemical compound NC(N)=NC1=NC(CSCCC(N)=NS(N)(=O)=O)=CS1 XUFQPHANEAPEMJ-UHFFFAOYSA-N 0.000 description 2
- 229950003662 fenretinide Drugs 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 210000002216 heart Anatomy 0.000 description 2
- 238000005734 heterodimerization reaction Methods 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 229960004171 hydroxychloroquine Drugs 0.000 description 2
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 2
- 230000000521 hyperimmunizing effect Effects 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000010569 immunofluorescence imaging Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000001361 intraarterial administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 229940043355 kinase inhibitor Drugs 0.000 description 2
- 230000029226 lipidation Effects 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 230000004089 microcirculation Effects 0.000 description 2
- 238000007431 microscopic evaluation Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- 230000036542 oxidative stress Effects 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 238000005502 peroxidation Methods 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000000207 pro-atherogenic effect Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000007115 recruitment Effects 0.000 description 2
- 230000029058 respiratory gaseous exchange Effects 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 2
- RMMXLENWKUUMAY-UHFFFAOYSA-N telmisartan Chemical compound CCCC1=NC2=C(C)C=C(C=3N(C4=CC=CC=C4N=3)C)C=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C(O)=O RMMXLENWKUUMAY-UHFFFAOYSA-N 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- 229960003989 tocilizumab Drugs 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- JKHVDAUOODACDU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCN1C(=O)C=CC1=O JKHVDAUOODACDU-UHFFFAOYSA-N 0.000 description 1
- PVGATNRYUYNBHO-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(2,5-dioxopyrrol-1-yl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCN1C(=O)C=CC1=O PVGATNRYUYNBHO-UHFFFAOYSA-N 0.000 description 1
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 1
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 description 1
- VLARLSIGSPVYHX-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-(2,5-dioxopyrrol-1-yl)hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O VLARLSIGSPVYHX-UHFFFAOYSA-N 0.000 description 1
- WCMOHMXWOOBVMZ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCN1C(=O)C=CC1=O WCMOHMXWOOBVMZ-UHFFFAOYSA-N 0.000 description 1
- GLXYOFXNKBTMQL-YKCHQESGSA-N (2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-1-[(2S)-6-amino-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylpentanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]propanoyl]amino]-4-oxobutanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]butanedioic acid Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N1[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O)CCC1 GLXYOFXNKBTMQL-YKCHQESGSA-N 0.000 description 1
- DLPIYBKBHMZCJI-WBVHZDCISA-N (2r,3s)-3-[[6-[(4,6-dimethylpyridin-3-yl)methylamino]-9-propan-2-ylpurin-2-yl]amino]pentan-2-ol Chemical compound C=12N=CN(C(C)C)C2=NC(N[C@@H](CC)[C@@H](C)O)=NC=1NCC1=CN=C(C)C=C1C DLPIYBKBHMZCJI-WBVHZDCISA-N 0.000 description 1
- ALBODLTZUXKBGZ-JUUVMNCLSA-N (2s)-2-amino-3-phenylpropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CC1=CC=CC=C1 ALBODLTZUXKBGZ-JUUVMNCLSA-N 0.000 description 1
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 1
- HUEYSSLYFJVUIS-MRFSYGAJSA-N (2s,3r,11bs)-2-[[(1r)-6,7-dimethoxy-1,2,3,4-tetrahydroisoquinolin-1-yl]methyl]-3-ethyl-9,10-dimethoxy-2,3,4,6,7,11b-hexahydro-1h-benzo[a]quinolizine;hydron;chloride Chemical compound Cl.N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@@H]1CC HUEYSSLYFJVUIS-MRFSYGAJSA-N 0.000 description 1
- AMFDITJFBUXZQN-KUBHLMPHSA-N (2s,3s,4r,5r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-(hydroxymethyl)pyrrolidine-3,4-diol Chemical compound C=1NC=2C(N)=NC=NC=2C=1[C@@H]1N[C@H](CO)[C@@H](O)[C@H]1O AMFDITJFBUXZQN-KUBHLMPHSA-N 0.000 description 1
- LKVFMOMQYXIFRK-KSVAIKAXSA-N (3S,6S,9S,12S,18S,21S,27S,30S,33S,36S,42R,47R,50S,53S,56S)-42-amino-3-(4-aminobutyl)-36-(3-amino-3-oxopropyl)-33-(3-carbamimidamidopropyl)-9,18,30-tris(2-carboxyethyl)-27-[(1R)-1-hydroxyethyl]-50-[(4-hydroxyphenyl)methyl]-53-(1H-indol-3-ylmethyl)-6,12-dimethyl-2,5,8,11,14,17,20,26,29,32,35,38,41,49,52,55-hexadecaoxo-44,45-dithia-1,4,7,10,13,16,19,25,28,31,34,37,40,48,51,54-hexadecazatricyclo[54.3.0.021,25]nonapentacontane-47-carboxylic acid Chemical compound C[C@@H](O)[C@@H]1NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](N)CSSC[C@H](NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H]2CCCN2C(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]2CCCN2C1=O)C(O)=O LKVFMOMQYXIFRK-KSVAIKAXSA-N 0.000 description 1
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 1
- KXMZDGSRSGHMMK-VWLOTQADSA-N 1-(6,7-dihydro-5h-benzo[2,3]cyclohepta[2,4-d]pyridazin-3-yl)-3-n-[(7s)-7-pyrrolidin-1-yl-6,7,8,9-tetrahydro-5h-benzo[7]annulen-3-yl]-1,2,4-triazole-3,5-diamine Chemical compound N1([C@H]2CCC3=CC=C(C=C3CC2)NC=2N=C(N(N=2)C=2N=NC=3C4=CC=CC=C4CCCC=3C=2)N)CCCC1 KXMZDGSRSGHMMK-VWLOTQADSA-N 0.000 description 1
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 1
- CULQNACJHGHAER-UHFFFAOYSA-N 1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 CULQNACJHGHAER-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- XPRDUGXOWVXZLL-UHFFFAOYSA-N 2-[[2-fluoro-4-(3-methoxyphenyl)phenyl]carbamoyl]cyclopentene-1-carboxylic acid Chemical compound COC1=CC=CC(C=2C=C(F)C(NC(=O)C=3CCCC=3C(O)=O)=CC=2)=C1 XPRDUGXOWVXZLL-UHFFFAOYSA-N 0.000 description 1
- BTIHMVBBUGXLCJ-UHFFFAOYSA-N 2-[[6-(benzylamino)-9-propan-2-ylpurin-2-yl]amino]butan-1-ol Chemical compound C=12N=CN(C(C)C)C2=NC(NC(CO)CC)=NC=1NCC1=CC=CC=C1 BTIHMVBBUGXLCJ-UHFFFAOYSA-N 0.000 description 1
- KZMAWJRXKGLWGS-UHFFFAOYSA-N 2-chloro-n-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]-n-(3-methoxypropyl)acetamide Chemical compound S1C(N(C(=O)CCl)CCCOC)=NC(C=2C=CC(OC)=CC=2)=C1 KZMAWJRXKGLWGS-UHFFFAOYSA-N 0.000 description 1
- AZSNMRSAGSSBNP-UHFFFAOYSA-N 22,23-dihydroavermectin B1a Natural products C1CC(C)C(C(C)CC)OC21OC(CC=C(C)C(OC1OC(C)C(OC3OC(C)C(O)C(OC)C3)C(OC)C1)C(C)C=CC=C1C3(C(C(=O)O4)C=C(C)C(O)C3OC1)O)CC4C2 AZSNMRSAGSSBNP-UHFFFAOYSA-N 0.000 description 1
- HUJXGQILHAUCCV-MOROJQBDSA-N 3-iodobenzyl-5'-N-methylcarboxamidoadenosine Chemical compound O[C@@H]1[C@H](O)[C@@H](C(=O)NC)O[C@H]1N1C2=NC=NC(NCC=3C=C(I)C=CC=3)=C2N=C1 HUJXGQILHAUCCV-MOROJQBDSA-N 0.000 description 1
- UYNVMODNBIQBMV-UHFFFAOYSA-N 4-[1-hydroxy-2-[4-(phenylmethyl)-1-piperidinyl]propyl]phenol Chemical compound C1CC(CC=2C=CC=CC=2)CCN1C(C)C(O)C1=CC=C(O)C=C1 UYNVMODNBIQBMV-UHFFFAOYSA-N 0.000 description 1
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 1
- JWEQLWMZHJSMEC-AFJTUFCWSA-N 4-[8-amino-3-[(2S)-1-but-2-ynoylpyrrolidin-2-yl]imidazo[1,5-a]pyrazin-1-yl]-N-pyridin-2-ylbenzamide (Z)-but-2-enedioic acid Chemical compound OC(=O)\C=C/C(O)=O.CC#CC(=O)N1CCC[C@H]1c1nc(-c2ccc(cc2)C(=O)Nc2ccccn2)c2c(N)nccn12 JWEQLWMZHJSMEC-AFJTUFCWSA-N 0.000 description 1
- VERWQPYQDXWOGT-LVJNJWHOSA-N 4-amino-5-fluoro-1-[(2r,5s)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]pyrimidin-2-one;[[(2r)-1-(6-aminopurin-9-yl)propan-2-yl]oxymethyl-(propan-2-yloxycarbonyloxymethoxy)phosphoryl]oxymethyl propan-2-yl carbonate;(e)-but-2-enedioic acid Chemical compound OC(=O)\C=C\C(O)=O.C1=C(F)C(N)=NC(=O)N1[C@H]1O[C@@H](CO)SC1.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VERWQPYQDXWOGT-LVJNJWHOSA-N 0.000 description 1
- AEUAEICGCMSYCQ-UHFFFAOYSA-N 4-n-(7-chloroquinolin-1-ium-4-yl)-1-n,1-n-diethylpentane-1,4-diamine;dihydrogen phosphate Chemical compound OP(O)(O)=O.ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 AEUAEICGCMSYCQ-UHFFFAOYSA-N 0.000 description 1
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- VHRSUDSXCMQTMA-PJHHCJLFSA-N 6alpha-methylprednisolone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)CO)CC[C@H]21 VHRSUDSXCMQTMA-PJHHCJLFSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- OZOGDCZJYVSUBR-UHFFFAOYSA-N 8-chloro-n-[4-(trifluoromethoxy)phenyl]quinolin-2-amine Chemical compound C1=CC(OC(F)(F)F)=CC=C1NC1=CC=C(C=CC=C2Cl)C2=N1 OZOGDCZJYVSUBR-UHFFFAOYSA-N 0.000 description 1
- SPBDXSGPUHCETR-JFUDTMANSA-N 8883yp2r6d Chemical compound O1[C@@H](C)[C@H](O)[C@@H](OC)C[C@@H]1O[C@@H]1[C@@H](OC)C[C@H](O[C@@H]2C(=C/C[C@@H]3C[C@@H](C[C@@]4(O[C@@H]([C@@H](C)CC4)C(C)C)O3)OC(=O)[C@@H]3C=C(C)[C@@H](O)[C@H]4OC\C([C@@]34O)=C/C=C/[C@@H]2C)/C)O[C@H]1C.C1C[C@H](C)[C@@H]([C@@H](C)CC)O[C@@]21O[C@H](C\C=C(C)\[C@@H](O[C@@H]1O[C@@H](C)[C@H](O[C@@H]3O[C@@H](C)[C@H](O)[C@@H](OC)C3)[C@@H](OC)C1)[C@@H](C)\C=C\C=C/1[C@]3([C@H](C(=O)O4)C=C(C)[C@@H](O)[C@H]3OC\1)O)C[C@H]4C2 SPBDXSGPUHCETR-JFUDTMANSA-N 0.000 description 1
- 101150046889 ADORA3 gene Proteins 0.000 description 1
- 108010049501 AP301 peptide Proteins 0.000 description 1
- 241000208140 Acer Species 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 229940122614 Adenosine receptor agonist Drugs 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 208000010470 Ageusia Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 229940118148 Aldose reductase inhibitor Drugs 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 241000270730 Alligator mississippiensis Species 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108010048036 Angiopoietin-2 Proteins 0.000 description 1
- 102000008873 Angiotensin II receptor Human genes 0.000 description 1
- 108050000824 Angiotensin II receptor Proteins 0.000 description 1
- 206010002653 Anosmia Diseases 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 208000006820 Arthralgia Diseases 0.000 description 1
- 206010003598 Atelectasis Diseases 0.000 description 1
- 206010003757 Atypical pneumonia Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- 102000008096 B7-H1 Antigen Human genes 0.000 description 1
- 229940125814 BTK kinase inhibitor Drugs 0.000 description 1
- 102100032412 Basigin Human genes 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 208000031648 Body Weight Changes Diseases 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- 239000004072 C09CA03 - Valsartan Substances 0.000 description 1
- 239000005537 C09CA07 - Telmisartan Substances 0.000 description 1
- 101100476210 Caenorhabditis elegans rnt-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102000005701 Calcium-Binding Proteins Human genes 0.000 description 1
- 108010045403 Calcium-Binding Proteins Proteins 0.000 description 1
- 108010032088 Calpain Proteins 0.000 description 1
- 102000007590 Calpain Human genes 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010008469 Chest discomfort Diseases 0.000 description 1
- 241000288673 Chiroptera Species 0.000 description 1
- 102100030099 Chloride anion exchanger Human genes 0.000 description 1
- 101710133455 Chloride anion exchanger Proteins 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 102100031506 Complement C5 Human genes 0.000 description 1
- 206010051625 Conjunctival hyperaemia Diseases 0.000 description 1
- 108010061994 Coronavirus Spike Glycoprotein Proteins 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- 102000000541 Defensins Human genes 0.000 description 1
- 108010002069 Defensins Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 101710087078 Dipeptidyl peptidase 1 Proteins 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 206010015719 Exsanguination Diseases 0.000 description 1
- 240000000731 Fagus sylvatica Species 0.000 description 1
- 235000010099 Fagus sylvatica Nutrition 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108091006020 Fc-tagged proteins Proteins 0.000 description 1
- 108010008177 Fd immunoglobulins Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- LFMYNZPAVPMEGP-PIDGMYBPSA-N Fluvoxamine maleate Chemical compound OC(=O)\C=C/C(O)=O.COCCCC\C(=N/OCCN)C1=CC=C(C(F)(F)F)C=C1 LFMYNZPAVPMEGP-PIDGMYBPSA-N 0.000 description 1
- 229940126656 GS-4224 Drugs 0.000 description 1
- GYHNNYVSQQEPJS-UHFFFAOYSA-N Gallium Chemical compound [Ga] GYHNNYVSQQEPJS-UHFFFAOYSA-N 0.000 description 1
- 102000004878 Gelsolin Human genes 0.000 description 1
- 108090001064 Gelsolin Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 229920002683 Glycosaminoglycan Chemical class 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 244000041633 Grewia tenax Species 0.000 description 1
- 235000005612 Grewia tenax Nutrition 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 208000000616 Hemoptysis Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 241000175212 Herpesvirales Species 0.000 description 1
- 101000798441 Homo sapiens Basigin Proteins 0.000 description 1
- 101000941598 Homo sapiens Complement C5 Proteins 0.000 description 1
- 101000793922 Homo sapiens Dipeptidyl peptidase 1 Proteins 0.000 description 1
- 101000959820 Homo sapiens Interferon alpha-1/13 Proteins 0.000 description 1
- 101001076407 Homo sapiens Interleukin-1 receptor antagonist protein Proteins 0.000 description 1
- 101000937642 Homo sapiens Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Proteins 0.000 description 1
- 101000590830 Homo sapiens Monocarboxylate transporter 1 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001081555 Homo sapiens Plasma protease C1 inhibitor Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 244000309467 Human Coronavirus Species 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000711467 Human coronavirus 229E Species 0.000 description 1
- 241001109669 Human coronavirus HKU1 Species 0.000 description 1
- 241000482741 Human coronavirus NL63 Species 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 102000039996 IL-1 family Human genes 0.000 description 1
- 108091069196 IL-1 family Proteins 0.000 description 1
- ZJVFLBOZORBYFE-UHFFFAOYSA-N Ibudilast Chemical compound C1=CC=CC2=C(C(=O)C(C)C)C(C(C)C)=NN21 ZJVFLBOZORBYFE-UHFFFAOYSA-N 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100040019 Interferon alpha-1/13 Human genes 0.000 description 1
- 102100040018 Interferon alpha-2 Human genes 0.000 description 1
- 108010005716 Interferon beta-1a Proteins 0.000 description 1
- 108010079944 Interferon-alpha2b Proteins 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 229940119178 Interleukin 1 receptor antagonist Drugs 0.000 description 1
- 102000003777 Interleukin-1 beta Human genes 0.000 description 1
- 108090000193 Interleukin-1 beta Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 102000008133 Iron-Binding Proteins Human genes 0.000 description 1
- 108010035210 Iron-Binding Proteins Proteins 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- UETNIIAIRMUTSM-UHFFFAOYSA-N Jacareubin Natural products CC1(C)OC2=CC3Oc4c(O)c(O)ccc4C(=O)C3C(=C2C=C1)O UETNIIAIRMUTSM-UHFFFAOYSA-N 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 1
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000002144 L01XE18 - Ruxolitinib Substances 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 206010024264 Lethargy Diseases 0.000 description 1
- 241000239218 Limulus Species 0.000 description 1
- 206010024971 Lower respiratory tract infections Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 208000004852 Lung Injury Diseases 0.000 description 1
- 206010025327 Lymphopenia Diseases 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000009571 Macrophage Inflammatory Proteins Human genes 0.000 description 1
- 108010009474 Macrophage Inflammatory Proteins Proteins 0.000 description 1
- 238000000585 Mann–Whitney U test Methods 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 1
- ZOKXTWBITQBERF-AKLPVKDBSA-N Molybdenum Mo-99 Chemical compound [99Mo] ZOKXTWBITQBERF-AKLPVKDBSA-N 0.000 description 1
- 108700038057 Monocarboxylate transporter 1 Proteins 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 208000034486 Multi-organ failure Diseases 0.000 description 1
- 208000010718 Multiple Organ Failure Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 101100003249 Mus musculus Atoh1 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000000112 Myalgia Diseases 0.000 description 1
- XYQHCMDVGIJOTA-UHFFFAOYSA-N N-(4-amino-3,4-dioxo-1-phenylbutan-2-yl)-4-(2-fluorophenyl)-2-methyl-1,3-oxazole-5-carboxamide Chemical compound NC(C(C(CC1=CC=CC=C1)NC(=O)C1=C(N=C(O1)C)C1=C(C=CC=C1)F)=O)=O XYQHCMDVGIJOTA-UHFFFAOYSA-N 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 102000004868 N-Methyl-D-Aspartate Receptors Human genes 0.000 description 1
- 108090001041 N-Methyl-D-Aspartate Receptors Proteins 0.000 description 1
- NOFRQDXKZDAYGB-UHFFFAOYSA-N NC=1C(=NC2=CC=CC=C2C=1)C(C)(C)O Chemical compound NC=1C(=NC2=CC=CC=C2C=1)C(C)(C)O NOFRQDXKZDAYGB-UHFFFAOYSA-N 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 206010028735 Nasal congestion Diseases 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 102000002002 Neurokinin-1 Receptors Human genes 0.000 description 1
- 108010040718 Neurokinin-1 Receptors Proteins 0.000 description 1
- 102100028492 Neuropilin-2 Human genes 0.000 description 1
- 108090000770 Neuropilin-2 Proteins 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 102000006570 Non-Histone Chromosomal Proteins Human genes 0.000 description 1
- 108010008964 Non-Histone Chromosomal Proteins Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 206010068319 Oropharyngeal pain Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 108700028865 Pam2CSK4 acetate and ODN M362 combination Proteins 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 241000255972 Pieris <butterfly> Species 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 108010046644 Polymeric Immunoglobulin Receptors Proteins 0.000 description 1
- 102100035187 Polymeric immunoglobulin receptor Human genes 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 108010048233 Procalcitonin Proteins 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 208000007123 Pulmonary Atelectasis Diseases 0.000 description 1
- 229940022005 RNA vaccine Drugs 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 206010062106 Respiratory tract infection viral Diseases 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- 102220492414 Ribulose-phosphate 3-epimerase_H35A_mutation Human genes 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 229940122055 Serine protease inhibitor Drugs 0.000 description 1
- 101710102218 Serine protease inhibitor Proteins 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 239000004138 Stearyl citrate Substances 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 108010060804 Toll-Like Receptor 4 Proteins 0.000 description 1
- GYDJEQRTZSCIOI-UHFFFAOYSA-N Tranexamic acid Chemical compound NCC1CCC(C(O)=O)CC1 GYDJEQRTZSCIOI-UHFFFAOYSA-N 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 206010069363 Traumatic lung injury Diseases 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 241001516476 Vanda Species 0.000 description 1
- 108010003205 Vasoactive Intestinal Peptide Proteins 0.000 description 1
- 102400000015 Vasoactive intestinal peptide Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 108010042365 Virus-Like Particle Vaccines Proteins 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- FHNFHKCVQCLJFQ-NJFSPNSNSA-N Xenon-133 Chemical compound [133Xe] FHNFHKCVQCLJFQ-NJFSPNSNSA-N 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- JQUNFHFWXCXPRK-AMMMHQJVSA-N [(3as,4r,6ar)-2,3,3a,4,5,6a-hexahydrofuro[2,3-b]furan-4-yl] n-[(2s,3r)-4-[[2-[(1-cyclopentylpiperidin-4-yl)amino]-1,3-benzothiazol-6-yl]sulfonyl-(2-methylpropyl)amino]-3-hydroxy-1-phenylbutan-2-yl]carbamate Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=C2SC(NC3CCN(CC3)C3CCCC3)=NC2=CC=1)NC(=O)O[C@@H]1[C@@H]2CCO[C@@H]2OC1)C1=CC=CC=C1 JQUNFHFWXCXPRK-AMMMHQJVSA-N 0.000 description 1
- CAVRKWRKTNINFF-UHFFFAOYSA-N [2-[1-[[3,5-bis(trifluoromethyl)phenyl]methyl]-5-pyridin-4-yltriazol-4-yl]pyridin-3-yl]-(2-chlorophenyl)methanone Chemical compound FC(F)(F)C1=CC(C(F)(F)F)=CC(CN2C(=C(N=N2)C=2C(=CC=CN=2)C(=O)C=2C(=CC=CC=2)Cl)C=2C=CN=CC=2)=C1 CAVRKWRKTNINFF-UHFFFAOYSA-N 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000037374 absorbed through the skin Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- QPMSXSBEVQLBIL-CZRHPSIPSA-N ac1mix0p Chemical compound C1=CC=C2N(C[C@H](C)CN(C)C)C3=CC(OC)=CC=C3SC2=C1.O([C@H]1[C@]2(OC)C=CC34C[C@@H]2[C@](C)(O)CCC)C2=C5[C@]41CCN(C)[C@@H]3CC5=CC=C2O QPMSXSBEVQLBIL-CZRHPSIPSA-N 0.000 description 1
- WDENQIQQYWYTPO-IBGZPJMESA-N acalabrutinib Chemical compound CC#CC(=O)N1CCC[C@H]1C1=NC(C=2C=CC(=CC=2)C(=O)NC=2N=CC=CC=2)=C2N1C=CN=C2N WDENQIQQYWYTPO-IBGZPJMESA-N 0.000 description 1
- 229950009821 acalabrutinib Drugs 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- YQNQNVDNTFHQSW-UHFFFAOYSA-N acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester Chemical compound CC(=O)OC1=CC=CC=C1C(=O)NC1=NC=C([N+]([O-])=O)S1 YQNQNVDNTFHQSW-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-O acridine;hydron Chemical compound C1=CC=CC2=CC3=CC=CC=C3[NH+]=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-O 0.000 description 1
- 206010069351 acute lung injury Diseases 0.000 description 1
- 239000012082 adaptor molecule Substances 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000019666 ageusia Nutrition 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 239000003288 aldose reductase inhibitor Substances 0.000 description 1
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 1
- 229960003318 alteplase Drugs 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 108700038111 alunacedase alfa Proteins 0.000 description 1
- WLDHEUZGFKACJH-UHFFFAOYSA-K amaranth Chemical compound [Na+].[Na+].[Na+].C12=CC=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(O)=C1N=NC1=CC=C(S([O-])(=O)=O)C2=CC=CC=C12 WLDHEUZGFKACJH-UHFFFAOYSA-K 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001567 anti-fibrinolytic effect Effects 0.000 description 1
- 230000000842 anti-protozoal effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000003904 antiprotozoal agent Substances 0.000 description 1
- 239000003435 antirheumatic agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 229960001164 apremilast Drugs 0.000 description 1
- 230000003143 atherosclerotic effect Effects 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 108010006060 aviptadil Proteins 0.000 description 1
- 229950000586 aviptadil Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 229950009568 bemcentinib Drugs 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 238000004820 blood count Methods 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000004579 body weight change Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- AEXFXNFMSAAELR-RXVVDRJESA-N brensocatib Chemical compound C(#N)[C@H](CC1=CC=C(C=C1)C=1C=CC2=C(N(C(O2)=O)C)C1)NC(=O)[C@H]1OCCCNC1 AEXFXNFMSAAELR-RXVVDRJESA-N 0.000 description 1
- 229940010847 brensocatib Drugs 0.000 description 1
- QPDYBCZNGUJZDK-DNQXCXABSA-N brilacidin Chemical compound O([C@H]1CNCC1)C=1C(NC(=O)CCCCNC(=N)N)=CC(C(F)(F)F)=CC=1NC(=O)C(N=CN=1)=CC=1C(=O)NC1=CC(C(F)(F)F)=CC(NC(=O)CCCCNC(N)=N)=C1O[C@@H]1CCNC1 QPDYBCZNGUJZDK-DNQXCXABSA-N 0.000 description 1
- 229950010313 brilacidin Drugs 0.000 description 1
- 229940088950 c1 esterase inhibitor (human) Drugs 0.000 description 1
- 239000003735 calcitonin gene related peptide receptor antagonist Substances 0.000 description 1
- 150000001669 calcium Chemical class 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229960000772 camostat Drugs 0.000 description 1
- XASIMHXSUQUHLV-UHFFFAOYSA-N camostat Chemical compound C1=CC(CC(=O)OCC(=O)N(C)C)=CC=C1OC(=O)C1=CC=C(N=C(N)N)C=C1 XASIMHXSUQUHLV-UHFFFAOYSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 238000003570 cell viability assay Methods 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 229940125400 channel inhibitor Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960003677 chloroquine Drugs 0.000 description 1
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 1
- 229960002328 chloroquine phosphate Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 208000020832 chronic kidney disease Diseases 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- GBBJCSTXCAQSSJ-XQXXSGGOSA-N clevudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1[C@H](F)[C@@H](O)[C@H](CO)O1 GBBJCSTXCAQSSJ-XQXXSGGOSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 229960001338 colchicine Drugs 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 108700005721 conestat alfa Proteins 0.000 description 1
- 208000027744 congestion Diseases 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 229940099355 cyklokapron Drugs 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- ZVTDLPBHTSMEJZ-UPZRXNBOSA-N danoprevir Chemical compound O=C([C@@]12C[C@H]1\C=C/CCCCC[C@H](C(N1C[C@@H](C[C@H]1C(=O)N2)OC(=O)N1CC2=C(F)C=CC=C2C1)=O)NC(=O)OC(C)(C)C)NS(=O)(=O)C1CC1 ZVTDLPBHTSMEJZ-UPZRXNBOSA-N 0.000 description 1
- 229950002891 danoprevir Drugs 0.000 description 1
- 229960003710 dantrolene sodium Drugs 0.000 description 1
- 229960003834 dapagliflozin Drugs 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 229960002768 dipyridamole Drugs 0.000 description 1
- 238000000375 direct analysis in real time Methods 0.000 description 1
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229950008639 dociparstat sodium Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000012063 dual-affinity re-targeting Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- 210000000969 egg white Anatomy 0.000 description 1
- 229960005135 eicosapentaenoic acid Drugs 0.000 description 1
- JAZBEHYOTPTENJ-UHFFFAOYSA-N eicosapentaenoic acid Natural products CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O JAZBEHYOTPTENJ-UHFFFAOYSA-N 0.000 description 1
- 235000020673 eicosapentaenoic acid Nutrition 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 229960001923 emetine hydrochloride Drugs 0.000 description 1
- 108010072542 endotoxin binding proteins Proteins 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- BPSMYQFMCXXNPC-MFCPCZTFSA-N eritoran Chemical compound O[C@H]1[C@H](OCCCCCCCCCC)[C@@H](NC(=O)CC(=O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O[C@@H]1CO[C@H]1[C@H](NC(=O)CCCCCCCCC\C=C/CCCCCC)[C@@H](OCC[C@@H](CCCCCCC)OC)[C@H](OP(O)(O)=O)[C@@H](COC)O1 BPSMYQFMCXXNPC-MFCPCZTFSA-N 0.000 description 1
- 229950007107 eritoran Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 210000000416 exudates and transudate Anatomy 0.000 description 1
- 229940013204 fadraciclib Drugs 0.000 description 1
- 229960001596 famotidine Drugs 0.000 description 1
- 229940110266 farxiga Drugs 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- ZCGNOVWYSGBHAU-UHFFFAOYSA-N favipiravir Chemical compound NC(=O)C1=NC(F)=CNC1=O ZCGNOVWYSGBHAU-UHFFFAOYSA-N 0.000 description 1
- 229950008454 favipiravir Drugs 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229960000556 fingolimod Drugs 0.000 description 1
- KKGQTZUTZRNORY-UHFFFAOYSA-N fingolimod Chemical compound CCCCCCCCC1=CC=C(CCC(N)(CO)CO)C=C1 KKGQTZUTZRNORY-UHFFFAOYSA-N 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 238000001506 fluorescence spectroscopy Methods 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229960004038 fluvoxamine Drugs 0.000 description 1
- CJOFXWAVKWHTFT-XSFVSMFZSA-N fluvoxamine Chemical compound COCCCC\C(=N/OCCN)C1=CC=C(C(F)(F)F)C=C1 CJOFXWAVKWHTFT-XSFVSMFZSA-N 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 235000021588 free fatty acids Nutrition 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 229950002031 galidesivir Drugs 0.000 description 1
- 229910052733 gallium Inorganic materials 0.000 description 1
- 108010074605 gamma-Globulins Proteins 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003825 glutamate receptor antagonist Substances 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 108010028403 hemagglutinin esterase Proteins 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 102000057041 human TNF Human genes 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 230000037417 hyperactivation Effects 0.000 description 1
- 230000000642 iatrogenic effect Effects 0.000 description 1
- 229960002491 ibudilast Drugs 0.000 description 1
- 229960003998 ifenprodil Drugs 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 210000002074 inflammatory monocyte Anatomy 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229960004461 interferon beta-1a Drugs 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 239000003407 interleukin 1 receptor blocking agent Substances 0.000 description 1
- 108040006849 interleukin-2 receptor activity proteins Proteins 0.000 description 1
- 108090000237 interleukin-24 Proteins 0.000 description 1
- 102000003898 interleukin-24 Human genes 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- VBUWHHLIZKOSMS-RIWXPGAOSA-N invicorp Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 VBUWHHLIZKOSMS-RIWXPGAOSA-N 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960002418 ivermectin Drugs 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000012004 kinetic exclusion assay Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 230000000503 lectinlike effect Effects 0.000 description 1
- 229960000681 leflunomide Drugs 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 231100000515 lung injury Toxicity 0.000 description 1
- 229940009622 luvox Drugs 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000005004 lymphoid follicle Anatomy 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229940028467 lysteda Drugs 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000000155 melt Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 229940071648 metered dose inhaler Drugs 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920012128 methyl methacrylate acrylonitrile butadiene styrene Polymers 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000001000 micrograph Methods 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- HTNPEHXGEKVIHG-QCNRFFRDSA-N molnupiravir Chemical compound C(OC(=O)C(C)C)[C@H]1O[C@H]([C@@H]([C@@H]1O)O)N1C(=O)N=C(NO)C=C1 HTNPEHXGEKVIHG-QCNRFFRDSA-N 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 208000029744 multiple organ dysfunction syndrome Diseases 0.000 description 1
- 229940014456 mycophenolate Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000031225 myocardial ischemia Diseases 0.000 description 1
- 239000003158 myorelaxant agent Substances 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- JJVAPHYEOZSKJZ-JGCGQSQUSA-N n-[(2r)-3-(7-methyl-1h-indazol-5-yl)-1-[4-(1-methylpiperidin-4-yl)piperazin-1-yl]-1-oxopropan-2-yl]-4-(2-oxo-1h-quinolin-3-yl)piperidine-1-carboxamide Chemical compound C1CN(C)CCC1N1CCN(C(=O)[C@@H](CC=2C=C3C=NNC3=C(C)C=2)NC(=O)N2CCC(CC2)C=2C(NC3=CC=CC=C3C=2)=O)CC1 JJVAPHYEOZSKJZ-JGCGQSQUSA-N 0.000 description 1
- MQQNFDZXWVTQEH-UHFFFAOYSA-N nafamostat Chemical compound C1=CC(N=C(N)N)=CC=C1C(=O)OC1=CC=C(C=C(C=C2)C(N)=N)C2=C1 MQQNFDZXWVTQEH-UHFFFAOYSA-N 0.000 description 1
- 229950009865 nafamostat Drugs 0.000 description 1
- 201000009240 nasopharyngitis Diseases 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 230000010807 negative regulation of binding Effects 0.000 description 1
- 230000003557 neuropsychological effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229960001920 niclosamide Drugs 0.000 description 1
- RJMUSRYZPJIFPJ-UHFFFAOYSA-N niclosamide Chemical compound OC1=CC=C(Cl)C=C1C(=O)NC1=CC=C([N+]([O-])=O)C=C1Cl RJMUSRYZPJIFPJ-UHFFFAOYSA-N 0.000 description 1
- 229960002480 nitazoxanide Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 230000030147 nuclear export Effects 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 229940042404 nucleoside and nucleotide reverse transcriptase inhibitor Drugs 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 229950007074 opaganib Drugs 0.000 description 1
- 108700013356 oplunofusp Proteins 0.000 description 1
- VSZGPKBBMSAYNT-RRFJBIMHSA-N oseltamivir Chemical compound CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 VSZGPKBBMSAYNT-RRFJBIMHSA-N 0.000 description 1
- 229960003752 oseltamivir Drugs 0.000 description 1
- PGZUMBJQJWIWGJ-ONAKXNSWSA-N oseltamivir phosphate Chemical compound OP(O)(O)=O.CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 PGZUMBJQJWIWGJ-ONAKXNSWSA-N 0.000 description 1
- 229940011530 otezla Drugs 0.000 description 1
- 229950011410 pacritinib Drugs 0.000 description 1
- HWXVIOGONBBTBY-ONEGZZNKSA-N pacritinib Chemical compound C=1C=C(C=2)NC(N=3)=NC=CC=3C(C=3)=CC=CC=3COC\C=C\COCC=2C=1OCCN1CCCC1 HWXVIOGONBBTBY-ONEGZZNKSA-N 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 229910052763 palladium Inorganic materials 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 238000003909 pattern recognition Methods 0.000 description 1
- 239000004466 pelleted feed Substances 0.000 description 1
- 229940072273 pepcid Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000004976 peripheral blood cell Anatomy 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 229940090007 persantine Drugs 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 229950001448 piclidenoson Drugs 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 235000020004 porter Nutrition 0.000 description 1
- 238000002600 positron emission tomography Methods 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229940073281 prezcobix Drugs 0.000 description 1
- CWCXERYKLSEGEZ-KDKHKZEGSA-N procalcitonin Chemical compound C([C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(O)=O)[C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H]1NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@@H](N)CSSC1)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 CWCXERYKLSEGEZ-KDKHKZEGSA-N 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 238000002818 protein evolution Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 230000004088 pulmonary circulation Effects 0.000 description 1
- 239000003379 purinergic P1 receptor agonist Substances 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000012857 radioactive material Substances 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000002601 radiography Methods 0.000 description 1
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 239000003087 receptor blocking agent Substances 0.000 description 1
- 229940075993 receptor modulator Drugs 0.000 description 1
- 108700018720 recombinant interferon alpha 2b-like Proteins 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 239000013643 reference control Substances 0.000 description 1
- RWWYLEGWBNMMLJ-MEUHYHILSA-N remdesivir Drugs C([C@@H]1[C@H]([C@@H](O)[C@@](C#N)(O1)C=1N2N=CN=C(N)C2=CC=1)O)OP(=O)(N[C@@H](C)C(=O)OCC(CC)CC)OC1=CC=CC=C1 RWWYLEGWBNMMLJ-MEUHYHILSA-N 0.000 description 1
- RWWYLEGWBNMMLJ-YSOARWBDSA-N remdesivir Chemical compound NC1=NC=NN2C1=CC=C2[C@]1([C@@H]([C@@H]([C@H](O1)CO[P@](=O)(OC1=CC=CC=C1)N[C@H](C(=O)OCC(CC)CC)C)O)O)C#N RWWYLEGWBNMMLJ-YSOARWBDSA-N 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 239000013037 reversible inhibitor Substances 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- KNUXHTWUIVMBBY-JRJYXWDASA-N rintatolimod Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(O)=O)O1.O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(=O)NC(=O)C=C1.O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(NC=NC2=O)=C2N=C1 KNUXHTWUIVMBBY-JRJYXWDASA-N 0.000 description 1
- 229950006564 rintatolimod Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 1
- 229940009560 ruconest Drugs 0.000 description 1
- 229960000215 ruxolitinib Drugs 0.000 description 1
- HFNKQEVNSGCOJV-OAHLLOKOSA-N ruxolitinib Chemical compound C1([C@@H](CC#N)N2N=CC(=C2)C=2C=3C=CNC=3N=CN=2)CCCC1 HFNKQEVNSGCOJV-OAHLLOKOSA-N 0.000 description 1
- 229940093749 ryanodex Drugs 0.000 description 1
- 108010038196 saccharide-binding proteins Proteins 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 108010038379 sargramostim Proteins 0.000 description 1
- 229960002530 sargramostim Drugs 0.000 description 1
- 229950006348 sarilumab Drugs 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 229940124834 selective serotonin reuptake inhibitor Drugs 0.000 description 1
- 239000012896 selective serotonin reuptake inhibitor Substances 0.000 description 1
- 125000002327 selenol group Chemical group [H][Se]* 0.000 description 1
- 229950010613 selinexor Drugs 0.000 description 1
- SCTZUZTYRMOMKT-UHFFFAOYSA-N senicapoc Chemical compound C=1C=C(F)C=CC=1C(C=1C=CC(F)=CC=1)(C(=O)N)C1=CC=CC=C1 SCTZUZTYRMOMKT-UHFFFAOYSA-N 0.000 description 1
- 229950000348 senicapoc Drugs 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000003001 serine protease inhibitor Substances 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 208000013220 shortness of breath Diseases 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- MKNJJMHQBYVHRS-UHFFFAOYSA-M sodium;1-[11-(2,5-dioxopyrrol-1-yl)undecanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCCCCCCN1C(=O)C=CC1=O MKNJJMHQBYVHRS-UHFFFAOYSA-M 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- MIDXXTLMKGZDPV-UHFFFAOYSA-M sodium;1-[6-(2,5-dioxopyrrol-1-yl)hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O MIDXXTLMKGZDPV-UHFFFAOYSA-M 0.000 description 1
- 229950008127 solnatide Drugs 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000009168 stem cell therapy Methods 0.000 description 1
- 238000009580 stem-cell therapy Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229940031626 subunit vaccine Drugs 0.000 description 1
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 1
- NCEXYHBECQHGNR-QZQOTICOSA-N sulfasalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-QZQOTICOSA-N 0.000 description 1
- 229960001940 sulfasalazine Drugs 0.000 description 1
- NCEXYHBECQHGNR-UHFFFAOYSA-N sulfasalazine Natural products C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 230000002483 superagonistic effect Effects 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 108010030393 synthetic preimplantation factor Proteins 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 229940061367 tamiflu Drugs 0.000 description 1
- 238000010863 targeted diagnosis Methods 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 229910052713 technetium Inorganic materials 0.000 description 1
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 1
- 229960005187 telmisartan Drugs 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229910052716 thallium Inorganic materials 0.000 description 1
- BKVIYDNLLOSFOA-UHFFFAOYSA-N thallium Chemical compound [Tl] BKVIYDNLLOSFOA-UHFFFAOYSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229960000187 tissue plasminogen activator Drugs 0.000 description 1
- 229960001350 tofacitinib Drugs 0.000 description 1
- UJLAWZDWDVHWOW-YPMHNXCESA-N tofacitinib Chemical class C[C@@H]1CCN(C(=O)CC#N)C[C@@H]1N(C)C1=NC=NC2=C1C=CN2 UJLAWZDWDVHWOW-YPMHNXCESA-N 0.000 description 1
- SYIKUFDOYJFGBQ-YLAFAASESA-N tofacitinib citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C[C@@H]1CCN(C(=O)CC#N)C[C@@H]1N(C)C1=NC=NC2=C1C=CN2 SYIKUFDOYJFGBQ-YLAFAASESA-N 0.000 description 1
- 229940044616 toll-like receptor 7 agonist Drugs 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 229950011232 tradipitant Drugs 0.000 description 1
- GYDJEQRTZSCIOI-LJGSYFOKSA-N tranexamic acid Chemical compound NC[C@H]1CC[C@H](C(O)=O)CC1 GYDJEQRTZSCIOI-LJGSYFOKSA-N 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- WFKWXMTUELFFGS-UHFFFAOYSA-N tungsten Chemical compound [W] WFKWXMTUELFFGS-UHFFFAOYSA-N 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 239000010937 tungsten Substances 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 229950008558 ulinastatin Drugs 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 229960004626 umifenovir Drugs 0.000 description 1
- KCFYEAOKVJSACF-UHFFFAOYSA-N umifenovir Chemical compound CN1C2=CC(Br)=C(O)C(CN(C)C)=C2C(C(=O)OCC)=C1CSC1=CC=CC=C1 KCFYEAOKVJSACF-UHFFFAOYSA-N 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 108010088854 urinastatin Proteins 0.000 description 1
- ODVKSTFPQDVPJZ-UHFFFAOYSA-N urinastatin Chemical compound C1C=CCCC11COC(C=2OC=CC=2)OC1 ODVKSTFPQDVPJZ-UHFFFAOYSA-N 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 229960004699 valsartan Drugs 0.000 description 1
- SJSNUMAYCRRIOM-QFIPXVFZSA-N valsartan Chemical compound C1=CC(CN(C(=O)CCCC)[C@@H](C(C)C)C(O)=O)=CC=C1C1=CC=CC=C1C1=NN=N[N]1 SJSNUMAYCRRIOM-QFIPXVFZSA-N 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000006453 vascular barrier function Effects 0.000 description 1
- 239000002525 vasculotropin inhibitor Substances 0.000 description 1
- 229940126580 vector vaccine Drugs 0.000 description 1
- 230000007486 viral budding Effects 0.000 description 1
- 230000007502 viral entry Effects 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 229940023147 viral vector vaccine Drugs 0.000 description 1
- 229940100050 virazole Drugs 0.000 description 1
- 230000008673 vomiting Effects 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 229940039916 xeljanz Drugs 0.000 description 1
- 229950004094 xenon (133xe) Drugs 0.000 description 1
- 229940124663 xpovio Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1002—Coronaviridae
- C07K16/1003—Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2 or Covid-19]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein.
- agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
- binding agents are useful, including in compositions and in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
- Coronavirus are positive-sense, single-stranded RNA viruses that have been classified into 4 groups, a, b, yand d coronaviruses. They infect birds and mammals; common human coronaviruses include the b-coronaviruses HCovOC43 and HCoV-HKU1 and the a-coronaviruses HCoV-229E and HCoV-NL63 that cause common colds and more severe lower respiratory tract infections in the very young and the elderly.
- SARS-CoV-1 SARS-CoV-2
- SARS-CoV-2 SARS-CoV-2
- HCoV- NL63 the host receptor is the angiotensin converting enzyme 2 (ACE2) expressed on mucosal epithelia of the lungs and the Gl tract.
- ACE2 angiotensin converting enzyme 2
- the spike glycoprotein protomer for SARS-CoV-2 is a 1273 amino acid protein, wherein the S1 domain comprises residues 13 - 685 and the S2 domain comprises residues 686 -1273.
- SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein.
- agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
- Such antibodies may bind to a SARS-CoV-2 spike glycoprotein (e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
- SARS-CoV-2 spike glycoprotein e.g., homotrimer, protomer
- RBD receptor binding domain
- compositions comprising a SARS- CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein.
- Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
- the present disclosure also provides methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition with a SARS-CoV-2 binding agent or a composition comprising the SARS-CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein or composition comprising such an agent.
- Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
- FIG. 1 illustrates exemplary results from assays for separation of potential inhibitors of receptor binding from non-inhibitors, including from FACS identification of a subset of SARS-CoV-2-RBD positive antibody clones that inhibit ACE2 receptor binding to captured antigen.
- Left panel unstained yeast cells.
- Right panel yeast cells after induction of antibody display were stained with biotinylated SARS-CoV-2 RBD and Phycoerythrin (PE)-conjugated streptavidin (P1 gate), followed by incubation with human ACE2-human Fc fusion protein (which had been shown to bind to SARS-CoV-2-RBD with high affinity).
- PE Phycoerythrin
- Bound ACE2-human Fc was then detected by Dylight 647 conjugated goat anti-human Fc.
- Antibody clones that could bind ACE2 in the presence of bound antigen appear double positive (P3 gate).
- Antibody clones that bind biotinylated SARS-CoV-2 RBD in a manner that prevents binding of ACE2-Fc to antigen are potential inhibitory antibody clones that block the RBD-receptor interaction.
- FIG. 2 illustrates exemplary results from ELISA screening assays to identify antibody clones that inhibit the interaction of SARS-CoV-2-RBD with ACE2, including from characterization of individual antibody clone Fab-containing culture media.
- Exemplary results of ELISA competition assays testing the ability of secreted Fab from individual yeast antibody clones to inhibit binding of SARS-CoV-2-RBD to ACE2 coated wells are shown.
- Secreted Fab in culture medium was used directly for assessing the ability of the Fab to block SARS-CoV-2-RBD binding to ACE2-Fc coated wells and compared with the level of binding in the presence of yeast media alone as the null effect control.
- FIG. 3 illustrates exemplary results from assays of Fab supernatant binding to 293F cells that were transfected to express a SARS-CoV-2 spike glycoprotein, including from evaluation of the Fab in individual clone culture media to bind to SARS-CoV-2 spike glycoprotein expressed in the 293F cells.
- 293F cells transiently transfected with a vector encoding full-length spike protein as a green fluorescent protein (GFP) fusion were incubated in the presence of 50 pi of clone culture media, a negative control clone culture media, or plain culture media (for secondary detection staining alone) added to 50 mI DMEM.
- GFP green fluorescent protein
- FIGS. 4A-4D illustrates exemplary results from viral neutralization assays.
- Vero E6 cells were plated in 96-well plates at 20,000 cells per well and assessed for viral induced cytopathic effects 2-4 days after addition of SARS-CoV-2 isolate WA1- F6/2020 equivalent to 100 TCID50.
- FIG. 4A Phase contrast of uninfected Vero E6 cells, or SARS-CoV-2 infected Vero E6 cells 4 days after infection.
- FIGS. 4B-4D Phase contrast of uninfected Vero E6 cells, or SARS-CoV-2 infected Vero E6 cells 4 days after infection.
- FIGS. 4B-4D illustrates exemplary results from viral neutralization assays.
- the antibody clones were diluted in Complete DMEM and serially diluted 1:3 ranging from 10 pg/ml to 0.00005 pg/ml.
- the dilutions of antibody were incubated with 100 TCIDso per 50 pL of SARS-CoV-2 for 1 hr and added to the assay plates.
- the plates were incubated for 4 days at 37°C, 5% CO2 and 95% relative humidity and the inhibitory effects of the antibodies were measured using an MTS colorimetric cell viability method and the IC50 values were determined using Prism software (GraphPad, San Diego CA).
- FIGS. 5A-5C illustrate the binding properties of Clone B (AvGn-B).
- FIG. 5A Binding of monomeric biotinylated SARS-CoV-2-RBD at different concentrations to immobilized Clone B (AvGn-B) coated on wells of Immobilon plates.
- FIG. 5B Binding of ACE-2-Fc and Clone B (AvGn-B) to SARS-COV-2 spike-protein expressing transfected 293 cells versus concentration.
- FIG. 5C Inhibitory activity versus concentration curve measuring the ability of Clone B (AvGn-B) to block SARS-CoV-2-RBD binding to wells coated with ACE2-Fc. Curve fitting and determination of KD and IC50 values were performed using Prism software.
- FIGS. 6A and 6B illustrate the effect of dosing Clone B (AvGn-B) on body weight and lung viral load in SARS-CoV-2 infected hamsters.
- AvGn-B dosing Clone B
- FIG. 6A Body weight changes post infection. Hamster body weights were recorded daily (0-5 days post-infection [dpi]), and weight loss was defined as percentage loss from 0dpi. Weight loss of infected groups compared to the uninfected control group was analyzed using two-way ANOVA in Prism GraphPad for each day (p ⁇ 0.0001).
- FIG. 6B Quantification of viral load (gene copy number/reaction) in infected hamster lung was compared between treatment groups (analyzed by Mann-Whitney U Test in Prism GraphPad) (*P ⁇ 0.05).
- FIGS. 7A and 7B illustrate the effect of Clone B (AvGn-B) on lung histology 5 days post-infection compared with lungs from uninfected hamsters.
- FIG. 7A H&E stained whole lung lobe section from uninfected control (panel A), infected with no treatment (Untreated, panel B), infected treated with 2.5 mg control lgG1 (panel C), and infected treated with 1 mg Clone B (AvGn-B) (panel D).
- FIG. 7B Quantification of bronchiointerstitial pneumonia within regions of interest delineated from each lung lobe of each animal. (*P ⁇ 0.05, **P ⁇ 0.01,***P ⁇ 0.001, ****P ⁇ 0.0001).
- FIG. 8 illustrates the effect of Clone B (AvGn-B) on SARS-CoV-2 viral content of hamsters 5 days post infection (dpi). Staining for the nucleocapsid protein of SARS-CoV-2 in lungs of an infected, untreated (panel A) and control lgG1 treated (2.5 mg/dose) treated (panel C) compared with lungs from infected, clone B (AvGn- B) treated hamsters at 1 mg/dose (panel B) or 2.5 mg/dose (panel D).
- FIG. 9A and 9B illustrate the effect of Clone B (AvGn-B) on macrophage activity within lungs of hamsters 5 days post infection with SARS-CoV-2 virus compared to uninfected hamsters.
- FIG. 9A Macrophage content/pm determined using IBA1 staining to identify monocytes and macrophages within lung tissue measured using a scanning digital microscope and cellSens software.
- FIG. 9B Colocalization of SARS-CoV-2 virus and monocytes/macrophages within the lung of infected hamsters determined using IBA1 staining for monocytes and macrophages and anti-SARS-CoV-2 nucleocapsid protein to stain for virus. (*P ⁇ 0.05,
- FIGS. 10A and 10B illustrate the comparison of Clone B (AvGn-B) with an exemplary engineered variant.
- FIG. 10A Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transfected 293 cells versus concentration.
- FIG. 10A Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transfected 293 cells versus concentration.
- FIG. 10A Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transf
- 11 A and 11 B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone G2 (AvGn-B-G2), Clone G4 (AvGn-B-G4), Clone H1 (AvGn-B-H1), Clone H2 (AvGn- B-H2), Clone A1 (AvGn-B-A1), Clone F2 (AvGn-B-F2), and Clone F11 (AvGn-B- F11 ), including consensus sequences for VFI CDR1 , VFI CDR2, VFI CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
- FIGS. 12A and 12B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone C (AvGn-C), and Clone F (AvGn-F), including sequences for VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
- SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein.
- agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
- Such antibodies may bind to a SARS-CoV-2 spike glycoprotein ⁇ e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
- binding agents ⁇ e.g., antibodies) are useful in compositions and in methods of treating, preventing, or alleviating a coronavirus-mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
- the present disclosure provides SARS-CoV-2 binding agents such as agents the bind to a SARS-CoV-2 spike glycoprotein, including agents that are antibodies or antibody fragments, and methods of using SARS-CoV-2 binding agents such as agents that bind to a SARS-CoV-2 spike glycoprotein, in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
- SARS-CoV-2 binding agents such as agents, including antibodies, that bind to a SARS-CoV-2 spike glycoprotein (e.g., monospecific or multispecific antibodies, including bispecific antibodies) are useful in such methods of treatment, prevention, or alleviation.
- agents including antibodies
- SARS-CoV-2 spike glycoprotein e.g., monospecific or multispecific antibodies, including bispecific antibodies
- binding agents which bind to SARS- CoV-2, including agents (e.g., antibodies) that bind to a SARS-CoV-2 spike glycoprotein (e.g., with an amino acid sequence of SEQ ID NO:31).
- a SARS-CoV-2 binding agent e.g., antibody
- a SARS-CoV-2 binding agent may bind to a SARS-CoV-2 spike glycoprotein or portion thereof such as an S1 domain (e.g., with an amino acid sequence of SEQ ID NO:28) or receptor binding domain (e.g., with an amino acid sequence of SEQ ID NO:27).
- An exemplary amino acid sequence of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 ⁇ see, e.g., amino acids 13-1273).
- An exemplary amino acid sequence of an S1 domain of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 ⁇ see, e.g., amino acids 13(Ser)-685(Arg)).
- An exemplary amino acid sequence of a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 ⁇ see.e.g., amino acids 319(Arg)-532(Asn)).
- SARS-CoV-2 binding agent e.g., antibody
- SEQ ID NO:3 amino acid sequence that is YYVGWGWFDV
- An exemplary anti-SARS-CoV-2 antibody is provided herein which comprises a heavy chain variable (VFI) region, for example, comprising a VFI CDR1 , VFI CDR2, and VFI CDR3, and a light chain variable (VL) region, for example, comprising a VL CDR1 ,
- antibody immunoglobulin
- immunoglobulin is used interchangeably herein, and is used in the broadest sense and specifically covers, for example polyclonal antibodies, monoclonal antibodies (including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies), antibody compositions with polyepitopic or monoepitopic specificity, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), synthetic antibodies, chimeric antibodies, humanized antibodies, or human versions of antibodies having full length heavy and/or light chains.
- Antibodies and fragments thereof as disclosed herein include antibodies and fragments thereof that bind to SARS-CoV-2, including, for example, a SARS-CoV-2 spike glycoprotein (e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
- Antibodies may be neutralizing antibodies.
- the present disclosure includes antibody fragments (and/or polypeptides that comprise antibody fragments) that retain SARS-CoV-2 binding characteristics.
- Non-limiting examples of antibody fragments include antigen-binding regions and/or effector regions of the antibody, e.g., F(ab)2, F(ab')2, Fab, Fab', Fd, Fc, and Fv fragments (e.g., fragments consisting of the variable regions of the heavy and light chains that are non-covalently coupled), disulfide-linked Fvs (dsFv), or single-domain antibodies ⁇ e.g., nanobodies).
- a variable (V) region domain may be any suitable arrangement of immunoglobulin heavy (VH) and/or light (VL) chain variable domains.
- the present disclosure also includes tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, and an antibody heavy chain monomer.
- the V region domain may be dimeric and contain VH-VH, VH-VL, or VL-VL dimers that bind SARS CoV-2, including a SARS CoV-2 spike glycoprotein or portion thereof (e.g., S1 domain, receptor binding domain).
- the VH and VL chains may be covalently coupled either directly or through a linker to form a single chain Fv (scFv).
- antibody fragments e.g., single-chain antibodies or other binding domains
- Antibody fragments can exist alone or in combination with one or more of the following: hinge region, CH1, CH2, CH3, or CH4 domains, J chain, or secretory component.
- Another form of an antibody fragment is a peptide comprising one or more complementarity determining regions (CDRs) of an antibody.
- CDRs also termed “minimal recognition units” or “hypervariable region” can be obtained by constructing polynucleotides that encode the CDR of interest.
- Such polynucleotides are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA of antibody-producing cells as a template (see, for example, Larrick et al. , Methods: A Companion to Methods in Enzymology, 2:106 (1991); Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies Production, Engineering and Clinical Application, Ritter et al.
- Antibody fragments may be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, variable domains of new antigen receptors (v-NAR), and bis-single chain Fv regions (see, e.g., Hollinger and Hudson, Nature Biotechnology, 23(9): 1126-1136, 2005).
- the binding agent in some embodiments, contains a light chain and/or a heavy chain constant region, such as one or more constant regions, including one or more lgG1, lgG2, lgG3 and/or lgG4 constant regions.
- antibodies can include epitope-binding fragments of any of the above.
- the antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., lgG1, lgG2, lgG3, lgG4, lgA1, and lgA2) of immunoglobulin molecule.
- Antibodies may be neutralizing antibodies.
- the term "monospecific” antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen.
- the term “bispecific” means that the antibody is able to specifically bind to at least two distinct antigenic determinants, for example two binding sites each formed by a pair of an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL) binding to different antigens or to different epitopes on the same antigen.
- VH antibody heavy chain variable domain
- VL antibody light chain variable domain
- Such a bispecific antibody may have a 1+1 format.
- bispecific antibody formats may be 2+1 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding sites for a second antigen or epitope).
- a bispecific antibody comprises two antigen binding sites, each may bind to a different antigenic determinant.
- Such a bispecific antibody may bind to two different epitopes on the same antigen (e.g., epitopes on a SARS-CoV-2 spike glycoprotein).
- nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
- the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
- Various algorithms and software that can be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variants thereof.
- two nucleic acids or polypeptides are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
- identity exists over a region of the amino acid sequences that is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues in length or any integral value there between.
- identity exists over a longer region than 60- 80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a target protein or an antibody. In some embodiments, identity exists over a region of the nucleotide sequences that is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases in length or any integral value there between.
- identity exists over a longer region than 60-80 bases, such as at least about 80-1000 bases or more, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as a nucleotide sequence encoding a protein of interest.
- a “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a side chain with similar chemical characteristics.
- Families of amino acid residues having similar side chains have been generally defined in the art, including basic side chains (e.g ., lysine, arginine, histidine), acidic side chains ⁇ e.g., aspartic acid, glutamic acid), uncharged polar side chains ⁇ e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains ⁇ e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains ⁇ e.g., threonine, valine, isoleucine) and aromatic side chains ⁇ e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g lysine, arginine, histidine
- acidic side chains ⁇ e.g
- polypeptide refers to polymers of amino acids of any length.
- the polymer can be linear or branched, it can comprise modified amino acids, and it can include ⁇ e.g., be interrupted by) non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as linkage to or conjugation with (directly or indirectly) a moiety such as a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids
- the polypeptides of this disclosure can be based upon antibodies or other members of the immunoglobulin superfamily, in some embodiments, the polypeptides can occur as single chains.
- an “antigen” is a moiety or molecule that contains an epitope to which an antibody can bind. As such, an antigen is also is bound by an antibody.
- the antigen, to which an antibody described herein binds is SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein), or a fragment thereof.
- an “epitope” is a term in the art and refers to a localized region of an antigen to which an antibody can bind.
- An epitope can be a linear epitope or a conformational, non-linear, or discontinuous, epitope.
- an epitope can be contiguous amino acids of the polypeptide (a “linear” epitope) or an epitope can comprise amino acids from two or more non-contiguous regions of the polypeptide (a “conformational,” “non-linear” or “discontinuous” epitope), e.g., a SARS-CoV-2 spike glycoprotein.
- a linear epitope may or may not be dependent on secondary, tertiary, or quaternary structure.
- an antibody binds to a group of amino acids regardless of whether they are folded in a natural three dimensional protein structure.
- an antibody requires amino acid residues making up the epitope to exhibit a particular conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
- the terms “specifically binds,” “specifically recognizes,” “immunospecifically binds,” “selectively binds,” “immunospecifically recognizes” and “immunospecific” are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., epitope) as such binding is understood by one skilled in the art.
- “specifically binds” means, for instance that a polypeptide or molecule interacts more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including related and unrelated proteins.
- a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, generally with lower affinity as determined by, e.g., immunoassays, BiacoreTM, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or Bio-Layer Interferometry (BLI) assays, GatorTM instrument (Probe Life, Inc., Palo Alto, CA), or other assays known in the art.
- immunoassays e.g., immunoassays, BiacoreTM, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or Bio-Layer Interferometry (BLI) assays, GatorTM instrument (Probe Life, Inc., Palo Alto, CA), or other assays known in the art.
- an antibody or antigen binding domain binds to or specifically binds to an antigen when it binds to an antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
- RIA radioimmunoassays
- ELISAs enzyme linked immunosorbent assays
- a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed.,
- the extent of binding of an antibody or antigen binding domain to a “non-target” protein is less than about 10% of the binding of the antibody or antigen binding domain to its particular target antigen, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA.
- FACS fluorescence activated cell sorting
- molecules that specifically bind to an antigen bind to the antigen with a Ka that is at least 2 logs, 2.5 logs, 3 logs, 4 logs or greater than the Ka when the molecules bind to another antigen.
- molecules that specifically bind to an antigen do not cross react with other proteins.
- “specifically binds” means, for instance, that a polypeptide or molecule binds a protein or target with a KD of about 0.1 mM or less, but more usually less than about 1mM. In some embodiments, “specifically binds” means that a polypeptide or molecule binds a target with a KD of at least about 0.1 mM or less, at least about 0.01 mM or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include a polypeptide or molecule that recognizes a protein or target in more than one species.
- specific binding can include a polypeptide or molecule that recognizes more than one protein or target. It is understood that, in some embodiments, a polypeptide or molecule that specifically binds a first target may or may not specifically bind a second target. As such, “specific binding” does not necessarily require (although it can include) exclusive binding, e.g., binding to a single target. Thus, a polypeptide or molecule can, in some embodiments, specifically bind more than one target. In some embodiments, multiple targets can be bound by the same antigen-binding site on the polypeptide or molecule.
- an antibody can, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins.
- an antibody can be bispecific and comprise at least two antigen-binding sites with differing specificities.
- binding means “specific binding”.
- the term “constant region” or “constant domain” is a well- known antibody term of art and refers to an antibody portion, e.g., for example, a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor.
- the term refers to a portion of an immunoglobulin molecule having a generally more conserved amino acid sequence relative to an immunoglobulin variable domain.
- the term “Fc region” or “Fc domain” is used herein to refer to a portion of a constant region or one or more constant regions.
- the term “heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino- terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy-terminal portion includes one or more constant regions.
- the “heavy chain” can refer to any distinct types, e.g., for example, alpha (a), delta (d), epsilon (e), gamma (y) and mu (m), based on the amino acid sequence of the constant domain, which give rise to IgA, IgD, IgE, IgG and IgM classes of antibodies, respectively, including subclasses of IgG, e.g., lgG1, lgG2, lgG3 and lgG4.
- the term “light chain” when used in reference to an antibody can refer to a polypeptide chain of about 25 kDa, wherein the amino- terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy-terminal portion includes a constant region.
- the approximate length of a light chain is 211 to 217 amino acids.
- K kappa
- l lambda
- Light chain amino acid sequences are well known in the art.
- an “isolated” or “purified” antibody or antigen binding fragment is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the antibody or antigen binding fragment is derived, or substantially free of chemical precursors or other chemicals when the antibody or antigen binding fragment is chemically synthesized.
- secretory component refers to a protein that specifically binds to J-chain-containing antibody, and is related to, derivable from, or identical to an extracellular portion of the polymeric immunoglobulin receptor (plgR), preferably a human plgR.
- the secretory component confers increased stability to the J-chain containing immunoglobulin.
- the secretory component can become associated with an antibody (e.g., dimeric or polymeric IgA or pentameric IgM) comprising a J chain.
- the secretory component may confer increased stability to the J-chain containing antibody.
- J-chain refers to J-chain polypeptide of about 15kDa of IgM or IgA antibodies of any animal species, including mature human J- chain.
- the amino acid sequence of mature human J-chain is well known in the art.
- the J chain sequence may be modified, for example, to comprise a fragment or variant of the J chain native sequence or to comprise a heterologous moiety or peptide.
- the J chain may be a full-length native J chain, but may also contain amino acid alterations, such as substitutions, insertions, deletions, truncations, including J chain fragments.
- the J-chain is modified to comprise a heterologous moiety or peptide.
- the heterologous moiety may be attached directly or indirectly (e.g., through a linker).
- the J chain may comprise a moiety that is a binding domain. See, e.g., U.S. Patent Nos. 10,400,038 and 9,951 , 134.
- the J chain may comprise a moiety that confers a desired characteristic to the antibody.
- the J-chain may comprise a moiety that affects the absorption, distribution, metabolism, or excretion (ADME) characteristics of an antibody. See, e.g., U.S. Patent No. 10,618,978.
- the heterologous moiety does not affect polymerization of the antibody (e.g., pentamerization of IgM and dimerization of IgA) and binding of the antibody to a target.
- antigen binding fragment refers to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding fragment, domain, or region its specificity and affinity for the antigen (e.g., the CDRs).
- Antigen binding fragment as used herein include “antibody fragment,” which comprise a portion of an intact antibody including one or more CDRs, such as the antigen binding or variable region of the intact antibody.
- antibody fragments include, without limitation, Fab, Fab’, F(ab’)2, and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger et al., Proc Natl Acad Sci 1993, 90:6444-48; Lu et al., J Biol Chem, 2005, 280:19665-72; Hudson et al., Nat Med, 2003, 9:129-34; WO 93/11161; and U.S. Pat. Nos. 5,837,242 and 6,492,123); single-chain antibody molecules (see, e.g., U.S. Pat. Nos.
- a SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein can bind to a SARS-CoV-2 spike glycoprotein (e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
- SARS-CoV-2 spike glycoprotein e.g ., homotrimer, protomer
- RBD receptor binding domain
- an SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein ⁇ e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
- a SARS-CoV-2 binding agent includes an antibody, antibody fragment, or other peptide-based molecule.
- Antibodies provided herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab’) fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-ld) antibodies, and epitope binding fragments of any of the above.
- synthetic antibodies e.g., monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab’) fragments, disul
- antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, including molecules that contain one or more antigen binding sites that bind to a SARS-CoV-2 antigen.
- Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA or IgY), any class, (e.g., lgG1, lgG2, lgG3, lgG4, lgA1 or lgA2), or any subclass (e.g., lgG2a or lgG2b) of immunoglobulin molecule.
- Antibodies may be neutralizing antibodies.
- antibodies described herein are IgG antibodies (e.g., human IgG), or a class (e.g., human lgG1 , lgG2, lgG3 or lgG4) or subclass thereof.
- antibodies described herein are IgA antibodies (e.g., human IgA), or a class (e.g., human lgA1 or lgA2) or subclass thereof.
- Antibody classes and subclasses including lgG1, lgG2, lgG3, lgG4, lgA1, lgA2, are well known in the art and are known to confer functional specialization. Modified versions of each of these classes and subclasses may be prepared by those skilled in the art.
- antibodies are hybrid antibodies with properties of more than one class or subclass of antibody. Methods for making hybrid antibodies (e.g., IgA/lgG and IgM/lgG) are known in the art.
- Antibodies include those of all isotypes, sub- classes and forms, including their fragments, for example, SARS-CoV-2 binding fragments.
- An antibody can include a J-chain and/or a secretory component.
- Antibodies may be modified to include sequences from other isotypes, such as IgG to produce chimeric antibodies.
- An antibody encompasses anything ranging from a small binding fragment of an antibody to a full sized antibody, including a multimeric antibody, for example, an IgA antibody that includes four complete heavy chains and four complete light chains and optionally includes a J chain and/or a secretory component, or an IgM antibody that includes ten or twelve complete heavy chains and ten or twelve complete light chains and, optionally, includes a J-chain and/or a secretory component.
- an antibody is a 4-chain antibody unit comprising two heavy (H) chain / light (L) chain pairs, wherein the amino acid sequences of the H chains are identical and the amino acid sequences of the L chains are identical.
- the H and L chains comprise constant regions, for example, human constant regions.
- the L chain constant region of such antibodies is a kappa or lambda light chain constant region, for example, a human kappa or lambda light chain constant region.
- the H chain constant region of such antibodies comprise a gamma heavy chain constant region, for example, a human gamma heavy chain constant region.
- such antibodies comprise IgG constant regions, for example, human IgG constant regions ( e.g lgG1, lgG2, lgG3, and/or lgG4 constant regions).
- An antibody or fragment thereof may preferentially bind to SARS-CoV-2 meaning that the antibody or fragment thereof binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein and/or binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein.
- the antibody or fragment thereof may specifically recognize and bind a SARS-CoV-2 spike glycoprotein or a portion thereof. “Specific binding” means that the antibody or fragment thereof binds to SARS-CoV-2 with an affinity that is at least 5, 10, 15, 20, 25, 50, 100, 250, 500, 1000, or 10,000 times greater than the affinity for an unrelated control protein (e.g., hen egg white lysozyme).
- the antibody or fragment thereof may bind SARS-CoV-2 substantially exclusively (e.g., is able to distinguish SARS-CoV-2 from other known polypeptides such other SARS-CoV-2, for example, by virtue of measurable differences in binding affinity).
- the term “hypervariable region”, “HVR”, or “HV”, when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six hypervariable regions; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3). A number of hypervariable region delineations are in use and are encompassed herein.
- CDRs The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (see, e.g., Kabat etal., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)).
- the end of the Chothia CDR- H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag).
- the “contact” hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions or CDRs are noted below.
- IMGT ImMunoGeneTics
- Information System ®
- IG immunoglobulins
- TR T cell receptors
- MHC major histocompatibility complex
- CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain.
- Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 or 26-35A (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
- a SARS-CoV-2 binding agent e.g ., antibody
- an agent ⁇ e.g., antibody that binds to a SARS-CoV-2 spike glycoprotein, comprises a VH region which comprises VH CDR1 , VH CDR2, and/or VH CDR3, and a VL region which comprises VL CDR1 , VL CDR2, and/or VL CDR3 of any one of the binding agents described herein (see, e.g., Tables 1-8).
- a SARS-CoV-2 binding agent e.g., antibody
- an agent e.g., antibody
- the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- the SARS-CoV-2 binding agent e.g., antibody
- the SARS-CoV-2 binding agent provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8.
- the SARS-CoV-2 binding agent (e.g., antibody) provided herein is bispecific and comprises a first binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8 and a second binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from another antibody, including, for example, another antibody that binds to SARS-CoV-2 and/or SARS-CoV-1.
- Table 1 Antibody Clone B (AvGn-B)
- SARS-CoV-2 binding agents e.g ., antibodies
- SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VH region or VH domain.
- SARS-CoV-2 binding agents ⁇ e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VL region or VL chain.
- SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein have a combination of (i) a VH domain or VH region and (ii) a VL domain or VL region.
- the CDRs disclosed herein include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-8).
- a “consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and/or variable amino acids that vary within a given amino acid sequence.
- the CDR consensus sequences provided include CDRs corresponding to VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2 and/or VL CDR3.
- Consensus sequences of CDRs of SARS-CoV-2 binding agents including an agent that binds to a SARS-CoV-2 spike glycoprotein, are shown in FIGS. 11A and 11 B.
- a SARS-CoV-2 binding agent e.g., antibody
- a SARS-CoV-2 binding agent e.g., antibody
- VH heavy chain variable
- VL light chain variable
- the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is
- a SARS-CoV-2 binding agent e.g ., antibody
- a SARS-CoV-2 binding agent e.g ., antibody
- a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- VH heavy chain variable
- a SARS-CoV-2 binding agent ⁇ e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
- VL light chain variable
- a SARS- CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
- the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
- the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid.
- the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- the VL CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid.
- the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of Xi AX2SRAT (SEQ ID NO: 111) wherein Xi and X2 are each independently a naturally occurring amino acid.
- the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
- a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X 2 A, I, L orV, and X3 is Q or R; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA
- a SARS-CoV-2 binding agent e.g., antibody
- a SARS-CoV-2 binding agent e.g., antibody
- a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X 2 A, I, L orV, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- VH heavy chain variable
- a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:115) wherein Xi is S, G or D; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S orT; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
- VL light chain variable
- a SARS-CoV-2 binding agent e.g ., antibody
- a SARS-CoV-2 binding agent e.g ., antibody
- a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VFI CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X 2 A, I, L orV, and X3 is Q or R; and (3) a VFI CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX
- the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H.
- the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R.
- the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- the VL CDR1 of a SARS- CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D.
- the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T.
- the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
- SARS-CoV-2 binding agents ⁇ e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Tables 1-8.
- SARS-CoV-2 binding agents ⁇ e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, provided herein comprise a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- SARS-CoV-2 binding agents e.g ., antibodies, including bispecific antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein provided herein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8.
- SARS-CoV-2 binding agents ⁇ e.g., antibodies, including bispecific antibodies
- agents that bind to a SARS- CoV-2 spike glycoprotein provided herein comprise one or more CDRs, including six CDRs, VL CDRs listed in Tables 1-8.
- SARS-CoV-2 binding agents e.g., antibodies, including bispecific antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8 and one or more CDRs, including six VL CDRs listed in Tables 1-8.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
- CDRs complementarity determining regions
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58- 64, 66-75, 78-82, 85-96 and 99-105.
- CDRs complementarity determining regions
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32- 48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
- CDRs complementarity determining regions
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises four or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
- CDRs complementarity determining regions
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises five or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
- CDRs complementarity determining regions
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises six or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
- CDRs complementarity determining regions
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS- CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS- CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18; and/or (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable region (VL) comprising
- VH CDR1 VH complementarity determining region 1
- VH CDR2 VH complementarity determining region 2
- VH CDR3 VH complementarity
- VL CDR1 VL complementarity determining region 1
- VL CDR2 VL complementarity determining region 2
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- a heavy chain variable region comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:1, 7, 12, 13, and 18; (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and (b) a light chain variable region (VL) comprising (i) a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16,
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO: 11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent (. e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable region
- VL light chain variable region
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and/or a VL comprising an amino acid sequence of SEQ ID NO:26.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and a VL comprising an amino acid sequence of SEQ ID NO:26.
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35,
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35, 36, 39, 40, 42, 43, 45, 46, and 47.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 32, 37, and 41.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 33, 38, 44, and 48.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:34, 39, 42, and 45.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:36, 43, and 47.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VH CDR1 having an amino
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino amino acid sequence selected from the group consisting of S
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and/or a VL comprising an amino acid sequence of SEQ ID NO:50.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and a VL comprising an amino acid sequence of SEQ ID NO:50.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 38, 44, 48, and 51.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VH CDR1 having an amino
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 38,
- VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20
- VL light chain variable region
- a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55
- a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46
- a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and/or a VL comprising an amino acid sequence of SEQ ID NO:57.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and a VL comprising an amino acid sequence of SEQ ID NO:57.
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 58, 60, and 62.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 59, 61, 63, and 64.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and/or a VL comprising an amino acid sequence of SEQ ID NO:57.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and a VL comprising an amino acid sequence of SEQ ID NO:57.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53,
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53, 54, 55, 67, 68, 70, 71, 73, and 74.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:67, 70, and 73.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a selected from a group consisting group consisting of SEQ ID NO:68, 71, and 74.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or (3)
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 66,
- VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71 , and 74.
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and/or a VL comprising an amino acid sequence of SEQ ID NO:77.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and a VL comprising an amino acid sequence of SEQ ID NO:77.
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21, 23, 35, 40, and 46.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21 , 23, 35, 40, and 46.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:78, 79, 80, 81 , and 82.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15 and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and/or a VL comprising an amino acid sequence of SEQ ID NO:84.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and a VL comprising an amino acid sequence of SEQ ID NO:84.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:85, 88, 91 , 92, and 93.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- VH CDR2 VH complementarity determining region 2
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:87, 90, and 95.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and (3)
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and/or a VL comprising an amino acid sequence of SEQ ID NO:98.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and a VL comprising an amino acid sequence of SEQ ID NO:98.
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 14, 99, 101, 103, and 105.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
- VH CDR3 VH complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 100, 102, and 104.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 99, 101 , 103, and 105; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL C
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 101 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and/or a VL comprising an amino acid sequence of SEQ ID NO: 107.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and a VL comprising an amino acid sequence of SEQ ID NO: 107.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:118, 119, 120, 124, 125, 126, 129, 130, 131 , 132, 135, 136, 137, and 141.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 118, 119, 120, 124, 125, 126, 129, 130, 131, 132, 135, 136, 137, and 141 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 118, 124, 129, 130, and 135.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- VH CDR2 VH complementarity determining region 2
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:120, 126, 132, and 137.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 121, 127, 133, and 138.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 122, 128, and 139.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 123, 134, and 140.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:119, 125, 131, 136, and 141; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; and/or (2) a VL CDR2 having an amino acid sequence selected from the group
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 126; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 130; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 135; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 137; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131 , 136, and 141 ; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and/or a VL comprising an amino acid sequence of SEQ ID NO: 143.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and a VL comprising an amino acid sequence of SEQ ID NO: 143.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165.
- VL light chain variable region
- CDRs VL complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165.
- VH heavy chain variable region
- CDRs VH complementarity determining regions
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 144, 150, 154, 155, and 160.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 145, 151 , 156, 161 , and 166.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 146, 152, 157, and 162.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 147, 153, 158, and 163.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:90, 148, and 164.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 149, 159, and 165.
- VL CDR3 VL complementarity determining region 3
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or (2) a VL CDR2 having an amino acid sequence
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 150; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 151 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 157; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 160; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 162; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165.
- VH heavy chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
- VH heavy chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of S
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 159.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
- VH heavy chain variable
- VL light chain variable
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and/or a VL comprising an amino acid sequence of SEQ ID NO: 168.
- the SARS-CoV-2 binding agent e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and a VL comprising an amino acid sequence of SEQ ID NO:168.
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO:167 and the light chain variable region having an amino acid sequence of SEQ ID NO: 168.
- the SARS-CoV-2 binding agent (e.g ., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/
- VH CDR3 as set forth in SEQ ID NO: 143; or (x) a VH CDR1 , a VH CDR2, and a VH
- VL CDR3 as set forth in SEQ ID NO: 167, and/or a VL CDR1 , a VL CDR2, and a VL
- the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR
- the SARS-CoV-2 binding agent e.g ., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143.
- the SARS-CoV-2 binding agent ⁇ e.g., an antibody, including a bispecific antibody
- the SARS-CoV-2 binding agent comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
- SARS-CoV-2 binding agents ⁇ e.g., antibodies
- SARS-CoV-2 binding agents are provided that compete with one of the exemplified SARS-CoV-2 binding agents ⁇ e.g., antibodies) disclosed herein.
- Such binding agents may also bind to the same or essentially the same epitope as one of the herein exemplified SARS-CoV-2 binding agents ⁇ e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, or an overlapping epitope.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents include those with the VH and VL regions, and CDRs provided herein (see, e.g., Tables 1-8).
- the SARS-CoV-2 binding agents ⁇ e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, that are provided include those that compete with an antibody comprising: (a) 1, 2, 3, 4, 5 or all 6 of the VH and VL CDRs identified in Tables 1-8; (b) a VH and a VL identified in Tables 1-8; or (c) two light chains each comprising a VL and two heavy chains each comprising a VH, including the VL and VH identified in Tables 1-8.
- an antibody comprising: (a) 1, 2, 3, 4, 5 or all 6 of the VH and VL CDRs identified in Tables 1-8; (b) a VH and a VL identified in Tables 1-8; or (c) two light chains each comprising a VL and two heavy chains each comprising a VH, including the VL and VH identified in Tables 1-8.
- the CDRs of an SARS-CoV-2 binding agent e.g., an antibody
- an agent that binds to a SARS-CoV-2 spike glycoprotein can be determined according to the Kabat system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- the CDRs of an SARS-CoV-2 binding agent can be determined according to the Chothia system, which will be referred to herein as the “Chothia CDRs” (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al- Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1): 175-82; and U.S.
- the CDRs of an SARS-CoV-2 binding agent can be determined according to the ImMunoGeneTics (IMGT) system, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7:132-136 and Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212 (“IMGT CDRs”).
- IMGT ImMunoGeneTics
- the CDRs of an SARS-CoV-2 binding agent can be determined according to the AbM system, which will be referred to herein as the “AbM CDRs,” for example as described in MacCallum et al., 1996, J. Mol. Biol., 262:732-745. See also, e.g., Martin, A., “Protein Sequence and Structure Analysis of Antibody Variable Domains,” in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001).
- the CDRs of an SARS-CoV-2 binding agent can be determined according to the Contact system, which will be referred to herein as the “Contact CDRs” (see, e.g., MacCallum RM et al. , 1996, J Mol Biol 5: 732-745).
- the Contact CDRs are based on an analysis of the available complex crystal structures.
- the position of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1 , CDR2, or CDR3) region of a SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary by one, two, three, four, five, or six amino acid positions so long as binding to SARS-CoV-2 (e.g., a SARS- CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- the position defining a CDR as identified in Tables 1-8 may vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the current CDR position, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- SARS-CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
- the length of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- SARS-CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
- a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99- 105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- SARS-CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
- the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78- 82, 85-96 and 99-105, so long as binding to SARS-CoV-2 (e.g ., a SARS-CoV-2 spike glycoprotein) is maintained ⁇ e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- SARS-CoV-2 e.g ., a SARS-CoV-2 spike glycoprotein
- the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51- 55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained ⁇ e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained ⁇ e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- any method known in the art can be used to ascertain whether binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein) is maintained, for example, the binding assays and conditions described in the Examples provided herein.
- Examples 1 and 2 provided herein describe assays for measuring binding to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein).
- the SARS-CoV-2 binding agents e.g., antibodies
- an agent that binds to a SARS-CoV-2 spike glycoprotein presented herein that bind to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein
- conservative sequence modifications include conservative amino acid substitutions that include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- beta-branched side chains ⁇ e.g., threonine, valine, isoleucine
- aromatic side chains ⁇ e.g., tyrosine, phenylalanine, tryptophan, histidine).
- a predicted nonessential amino acid residue is replaced with another amino acid residue from the same side chain family.
- Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art ⁇ see, e.g., Brummell et al. , Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
- the conservative sequence modifications described herein modify the amino acid sequences of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, by 50%, or 55%, or 60%, or 65%, or 70%, or 75%, or 80%, or 85%, or 90%, or 95%, or 98%, or 99%.
- the nucleotide and amino acid sequence modifications refer to at most 1 , 2, 3, 4, 5, or 6 amino acid substitutions to the CDRs described in Tables 1-8.
- each such CDR may contain up to 5 conservative amino acid substitutions, for example up to (not more than) 4 conservative amino acid substitutions, for example up to (not more than) 3 conservative amino acid substitutions, for example up to (not more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution.
- the present disclosure also provides conjugates, including immunoconjugates comprising any one of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD), of the present disclosure, including those directly or indirectly linked another agent.
- SARS-CoV-2 binding agents e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD
- SARS-CoV-2 binding agents e.g ., antibodies
- SARS-CoV-2 spike glycoprotein or a fragment thereof ⁇ e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD
- SARS-CoV-2-S1, SARS-CoV- 2-RBD may be covalently bound by a synthetic linker to one or more agents.
- SARS-CoV-2 binding agents ⁇ e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein, described herein which bind to SARS-CoV-2 ⁇ e.g., a SARS-CoV-2 spike glycoprotein may be linked or conjugated (directly or indirectly) to a polypeptide.
- an SARS-CoV-2 binding agent e.g., antibody
- an agent that binds to a SARS-CoV-2 spike glycoprotein is linked or conjugated (directly or indirectly) to an agent.
- SARS-CoV-2 binding agents e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein provided herein are conjugated or recombinantly linked (directly or indirectly) to a therapeutic agent or to a diagnostic or detectable agent.
- the conjugated or recombinantly linked antibodies can be useful, for example, for treating or preventing a disease or disorder such as an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
- conjugated or recombinantly linked SARS-CoV-2 binding agents can be useful, for example, for monitoring or prognosing the onset, development, progression, and/or severity of an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
- Such diagnosis and detection can be accomplished, for example, by coupling the SARS-CoV-2 binding agent (e.g., an antibody) to detectable substances including, for example: enzymes, including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, including, but not limited to, streptavidin/biotin or avidin/biotin; fluorescent materials, including, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; luminescent materials, including, but not limited to, luminol; bioluminescent materials, including, but not limited to, luciferase, luciferin, or aequorin; chemiluminescent material, including, but not limited
- SARS-CoV-2 binding agents e.g ., antibodies
- SARS-CoV-2 binding agents e.g ., antibodies
- a heterologous protein or polypeptide or fragment thereof, for example, to a polypeptide ⁇ e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids
- a polypeptide ⁇ e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids
- fusion proteins comprising an antigen-binding fragment of SARS-CoV-2 binding agents (e.g., an antibody), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein (e.g., comprising CDR1 , CDR2, and/or CDR3 of VH and/or VL) and a heterologous protein, polypeptide, or peptide.
- SARS-CoV-2 binding agent e.g., an antibody
- the heterologous protein, polypeptide, or peptide that the SARS-CoV-2 binding agent e.g., antibody
- SARS-CoV-2 binding agents e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein can be linked (directly or indirectly) to marker or “tag” sequences, such as a peptide, to facilitate purification.
- the marker or tag amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (see, e.g., QIAGEN, Inc.), among others, many of which are commercially available. For example, as described in Gentz et al., 1989, Proc. Natl. Acad. Sci.
- hexa-histidine provides for convenient purification of a fusion protein.
- Other peptide tags useful for purification include, but are not limited to, the hemagglutinin (‘ ⁇ A”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767-78), and the “FLAG” tag.
- Fusion proteins may be generated, for example, through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”).
- DNA shuffling may be employed to alter the activities of the SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, as provided herein, including, for example, SARS-CoV-2 binding agents with higher affinities and lower dissociation rates (see, e.g., U.S. Pat. Nos.
- SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination.
- One or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., antibody) provided herein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
- SARS-CoV-2 binding agents e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein provided herein can also be linked or conjugated (directly or indirectly) to a second antibody to form an antibody heteroconjugate (see, e.g., U.S. Pat. No. 4,676,980).
- SARS-CoV-2 binding agents e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein provided herein may also be attached to solid supports, which are useful for immunoassays or purification of the target antigen.
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene.
- the linker may be a “cleavable linker” facilitating release of the linked or conjugated agent in a cell, but non-cleavable linkers are also contemplated herein.
- Linkers for use in conjugates of the present disclosure include, without limitation, acid labile linkers (e.g., hydrazone linkers), disulfide-containing linkers, peptidase- sensitive linkers (e.g., peptide linkers comprising amino acids, for example, valine and/or citrulline such as citrulline-valine or phenylalanine-lysine), photolabile linkers, dimethyl linkers (see, e.g., Chari etai, 1992, Cancer Res.
- Conjugates of an antibody and agent may be made using a variety of bifunctional protein coupling agents such as BMPS, EMCS, GMBS, HBVS, LC- SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo- GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate).
- conjugates of antibodies and agents may be prepared using any suitable methods as disclosed in the art (see, e.g., Bioconjugate Techniques (Hermanson ed., 2d ed. 2008)).
- selenocysteine is cotranslationally inserted into an antibody sequence by recoding the stop codon UGA from termination to selenocysteine insertion, allowing site specific covalent conjugation at the nucleophilic selenol group of selenocysteine in the presence of the other natural amino acids (see, e.g., Hofer etai, 2008, Proc. Natl. Acad. Sci. USA 105:12451-56; and Hofer et a/., 2009, Biochemistry 48(50): 12047-57).
- SARS-CoV-2 binding agents including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein may be monospecific, bispecific, trispecific or of greater multispecificity.
- agents may include antibodies.
- Multispecific antibodies such as bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens (e.g., SARS-CoV-2 and SARS-CoV-1) or two different epitopes on the same antigen (e.g., a SARS-CoV-2 spike glycoprotein).
- the multispecific antibodies can be constructed based on the sequences of the antibodies provided herein, e.g., the CDR sequences listed in Tables 1-8.
- the multispecific antibodies provided herein are bispecific antibodies.
- bispecific antibodies are mouse, chimeric, human or humanized antibodies.
- multispecific antibody molecules can comprise more than one antigen-binding site, in which different sites are specific for different antigens.
- multispecific antibody molecules can bind more than one (e.g ., two or more) epitopes on the same antigen.
- one of the binding specificities is for SARS-CoV-2 and the other is for any other antigen ⁇ e.g., SARS-CoV-1).
- Bispecific antibodies can be prepared in various antibody formats, including as full length antibodies or antibody fragments ⁇ e.g., F(ab’)2 bispecific antibodies).
- Multispecific antibodies Methods for making multispecific antibodies are known in the art, such as, by co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (see, e.g., Milstein and Cuello, 1983, Nature 305:537-40).
- multispecific antibodies e.g., bispecific antibodies
- Bispecific Antibodies Kontermann ed., 2011 .
- bispecific antibody molecules can be classified into different structural groups: (i) bispecific immunoglobulin G (BslgG); (ii) IgG appended with an additional antigen-binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates.
- BslgG formats can include crossMab, DAF (two-in-one), DAF (four-in-one),
- BslgG comprises heavy chains that are engineered for heterodimerization.
- heavy chains can be engineered for heterodimerization using a "knobs-into-holes" strategy, a SEED platform, a common heavy chain (e.g., in kl-bodies), and use of heterodimeric Fc regions.
- Strategies are known in the art to avoid heavy chain pairing of homodimers in BslgG, including knobs-into-holes, duobody, azymetric, charge pair, FIA-TF, SEEDbody, and differential protein A affinity.
- bispecific antibody format is IgG appended with an additional antigen-binding moiety.
- monospecific IgG can be engineered to have bispecificity by appending an additional antigen-binding unit onto the monospecific IgG, e.g., at the N- or C- terminus of either the heavy or light chain.
- additional antigen-binding units include single domain antibodies ⁇ e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable domains ⁇ e.g., single chain variable fragments or variable fragments).
- Non-limiting examples of appended IgG formats include dual variable domain IgG (DVD-lg), lgG(H)-scFv, scFv-(H)lgG, lgG(L)-scFv, scFv-(L)lgG, lgG(L,H)-Fv, lgG(H)-V, V(H)-lgG, lgG(L)-V, V(L)-lgG, KIH IgG-scFab, 2scFv-lgG, lgG-2scFv, scFv4-lg, zybody, and DVI-lgG (four- in-one). See, Spiess et al. Mol. Immunol. 67(2015):95-106.
- Bispecific antibody fragments are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region.
- bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell.
- bispecific antibody fragments include, but are not limited to, nanobody, nanobody- FIAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CFI3, Diabody-CFI3, triple body, miniantibody, minibody, TriBi minibody, scFv-CFI3 KIH, Fab-scFv, scFv- CH-CL-scFv, F(ab')2, F(ab')2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody.
- Bispecific fusion proteins include antibody fragments linked to other proteins.
- bispecific fusion proteins can be linked to other proteins to add additional specificity and/or functionality.
- the dock-and- lock (DNL) method can be used to generate bispecific antibody molecules with higher valency.
- bispecific antibody fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments.
- chemical conjugation for example, chemical conjugation of antibodies and/or antibody fragments, can be used to create BsAb molecules.
- An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof. In embodiments, the conjugation improves the serum half-life.
- multispecific antibodies including bispecific antibodies
- multispecific antibodies, including bispecific antibodies can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly or by expression of the component antibodies in a single host cell.
- Purification of multispecific antibody molecules can be performed by various methods known in the art, such as affinity chromatography.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents e.g., antibodies
- a multispecific ⁇ e.g., bispecific antibody disclosed herein comprises an SARS-CoV-2 binding agent and a second binding agent, wherein the SARS-CoV-2 binding agent (e.g., antibody) comprises a VL and/or VH amino acid sequence of Tables 1 -8.
- a bispecific antibody disclosed herein comprises an SARS-CoV-2 binding agent that comprises a VL and/or VH amino acid sequence of Tables 1-8 and further comprises a VL and/or VH amino acid sequence of another antibody.
- a bispecific antibody which binds to SARS -CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) that comprises VL and VH CDRs (e.g., VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3), wherein at least one VH CDR3 of the bispecific antibody comprises the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- SARS -CoV-2 e.g., a SARS-CoV-2 spike glycoprotein
- VL and VH CDRs e.g., VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 1 (SEQ ID NOS:1, 2, 3, 4, 5 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:7, 8, 9, 10, 11 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:12, 2, 3, 4, 5, and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 13, 14, 15, 16,
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 18, 19, 20, 21, 22 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 1 , 24, 3, 4, 5 and/or 6).
- a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 2 (SEQ ID NOS:32, 33, 3, 34, 35 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:37, 38, 9, 39, 40 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:12, 33, 3, 34, 35 and/or 36).
- provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:41 , 14, 15, 42, 40 and/or 43). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS: 18, 44, 20, 45, 46 and/or 47). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:32, 48, 3, 34, 35 and/or 36).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 3 (SEQ ID NOS:1 , 51 , 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:7, 38, 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:12, 51, 3, 52, 35 and/or 6).
- provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 13, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 18, 44, 20, 55, 46 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:1 , 48, 3, 52, 35 and/or 6).
- a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 4 (SEQ ID NOS:58, 59, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:60, 61 , 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:12, 59, 3, 52, 35 and/or 6).
- provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:62, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS: 18, 63, 20, 55, 46, and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:58, 64, 3, 52, 35 and/or 6).
- a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 5 (SEQ ID NOS:1 , 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:7, 69, 9, 53, 70 and/or 68).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:12, 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS: 13, 14, 15, 54, 70 and/or 71). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:18, 72, 20, 55, 73 and/or 74).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:1 , 75, 3, 52, 67 and/or 68). [00277] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 6 (SEQ ID NOS:78, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:79, 69, 9, 10, 40 and/or 6).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:80, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:81 , 14, 15, 16, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:82, 72, 20, 21 , 46 and/or 23).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:78, 75, 3, 4, 35 and/or 6). [00278] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 7 (SEQ ID NOS:85, 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:88, 89, 9, 53, 90 and/or 6).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:91 , 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:92, 14, 15, 54, 90 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:93, 94, 20, 55, 95 and/or 23).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:85, 96, 3, 52, 87 and/or 6). [00279] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 8 (SEQ ID NOS:1, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS:7, 101, 9, 10, 40 and/or 100).
- provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 12, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 13, 14, 15, 16, 40 and/or 102). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 18, 103, 20, 21 , 46 and/or 104). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 1 , 105, 3, 4, 35 and/or 100).
- Antibodies that bind SARS-CoV-2 including antibodies that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be obtained by any suitable method, such as (but not limited to) immunization with whole cells expressing a SARS-CoV-2 spike glycoprotein or a fragment thereof and collection of antibodies, recombinant techniques, or screening libraries of antibodies or antibody fragments using a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD).
- a SARS-CoV-2 spike glycoprotein or a fragment thereof e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD
- Monoclonal antibodies may be generated using a variety of known techniques (see, for example, Coligan et al. (eds.), Current Protocols in Immunology, 1:2.5.12.6.7 (John Wiley & Sons 1991); Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol (eds.) (1980); Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press (1988); and Picksley et al., “Production of monoclonal antibodies against proteins expressed in E. coli," in DNA Cloning 2: Expression Systems, 2nd Edition, Glover et al.
- One exemplary technique for generating monoclonal antibodies comprises immunizing an animal with a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) and generating a hybridoma from spleen cells taken from the animal.
- a hybridoma may produce a monoclonal antibody or antibody fragment that binds SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD).
- human antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof may be generated by any of a number of techniques including, but not limited to, Epstein Barr Virus (EBV) transformation of human peripheral blood cells (e.g ., containing B lymphocytes), in vitro immunization of human B cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein.
- EBV Epstein Barr Virus
- human antibodies that bind SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof may be obtained from transgenic animals that have been engineered to produce specific human antibodies in response to antigenic challenge.
- SARS-CoV-2-S1, SARS-CoV- 2-RBD a SARS-CoV-2 spike glycoprotein or a fragment thereof
- transgenic animals having a human Ig locus, wherein the animals do not produce functional endogenous immunoglobulins due to the inactivation of endogenous heavy and light chain loci.
- Transgenic non-primate mammalian hosts capable of mounting an immune response to an immunogen, wherein the antibodies have primate constant and/or variable regions, and wherein the endogenous immunoglobulin encoding loci are substituted or inactivated, also have been described.
- International Patent Publication No. WO 96/30498 discloses the use of the Cre/Lox system to modify the immunoglobulin locus in a mammal, such as to replace all or a portion of the constant or variable region to form a modified antibody molecule.
- WO 94/02602 discloses non-human mammalian hosts having inactivated endogenous Ig loci and functional human Ig loci.
- U.S. Patent No. 5,939,598 discloses methods of making transgenic mice in which the mice lack endogenous heavy chains, and express an exogenous immunoglobulin locus comprising one or more xenogeneic constant regions.
- an immune response can be produced to a selected antigenic molecule, and antibody producing cells can be removed from the animal and used to produce hybridomas that secrete human-derived monoclonal antibodies.
- Immunization protocols, adjuvants, and the like are known in the art, and are used in immunization of, for example, a transgenic mouse as described in International Patent Publication No. WO 96/33735.
- the monoclonal antibodies can be tested for the ability to inhibit or neutralize the biological activity or physiological effect of the corresponding protein.
- Humanized antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof may be produced using techniques known to those skilled in the art (Zhang et al., Molecular Immunology, 42(12): 1445-1451, 2005; Hwang et al., Methods, 36(1): 35- 42, 2005; Dall'Acqua et al., Methods, 36(1): 43-60, 2005; Clark, Immunology Today, 21(8): 397-402, 2000, and U.S. Patent Nos. 6,180,370; 6,054,927; 5,869,619; 5,861,155; 5,712,120; and 4,816,567.
- an isolated cell e.g., a hybridoma
- an SARS-CoV-2 binding agent e.g., antibody or antibody fragment
- a cell e.g., an isolated cell
- one or more polynucleotides comprising one or more nucleic acid sequences encoding a SARS-CoV-2 binding agent (e.g., antibody or antibody fragment) may be generated.
- the one or more polynucleotides are isolated and/or recombinant polynucleotides.
- the one or more isolated polynucleotides comprise one or more nucleotide sequences that encode an antibody heavy chain variable region (VH) and/or an antibody light chain variable region (VL), wherein the VH and the VL comprise complementarity determining regions (CDRs) as shown in Tables 1-8.
- one or more vectors may comprise one or more polynucleotides for expression of one or more polynucleotides in a suitable host cell.
- Such vectors are useful, e.g., for amplifying the polynucleotides in host cells to create useful quantities thereof, and for expressing binding agents, such as antibodies or antibody fragments, using recombinant techniques.
- Vectors also are useful in “gene therapy” treatment regimens, wherein, for example, one or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., an antibody, including a multispecific antibody such as a bispecific antibody), is introduced into a subject suffering from or at risk of suffering from a SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
- a SARS-CoV-2 binding agent e.g., an antibody, including a multispecific antibody such as a bispecific antibody
- one or more vectors are expression vectors wherein one or more polynucleotides are operatively linked to one or more polynucleotides comprising expression control sequences.
- Autonomously replicating recombinant expression constructs such as plasmid and viral DNA vectors incorporating one or more polynucleotides encoding antibody sequences that bind SARS-CoV-2 are specifically contemplated.
- Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression construct is to be utilized. Promoter and enhancer sequences are generally selected for the ability to increase gene expression, while operator sequences are generally selected for the ability to regulate gene expression.
- Expression constructs may also include sequences encoding one or more selectable markers that permit identification of host cells bearing the construct. Expression constructs may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell. In some embodiments, expression constructs of the can also include sequences necessary for replication in a host cell.
- Exemplary expression control sequences include promoter/enhancer sequences, e.g., cytomegalovirus promoter/enhancer (Lehner et al. , J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41: 521-530, 1985); Rous sarcoma virus promoter (Davis et al., Hum. Gene Then, 4: 151, 1993); Tie promoter (Korhonen et al., Blood, 86(5): 1828-1835, 1995); simian virus 40 promoter; DRA (downregulated in adenoma; Alrefai et al., Am. J. Physiol.
- promoter/enhancer sequences e.g., cytomegalovirus promoter/enhancer (Lehner et al. , J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41
- MCT1 monocarboxylate transporter 1 ; Cuff et al., Am. J. Physiol. Gastrointet. Liver Physiol., G977-G979. 2005
- Mathl mime atonal homolog 1; Shroyer et al., Gastroenterology, 132: 2477-2478, 2007
- the promoter is an epithelial-specific promoter or endothelial-specific promoter.
- Polynucleotides may also optionally include a suitable polyadenylation sequence (e.g., the SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (e.g., 3’) of the polypeptide coding sequence.
- a suitable polyadenylation sequence e.g., the SV40 or human growth hormone gene polyadenylation sequence
- the one or more polynucleotides also optionally comprise nucleotide sequences encoding secretory signal peptides fused in frame with the polypeptide sequences.
- the secretory signal peptides direct secretion of the antibody polypeptides by the cells that express the one or more polynucleotides, and are cleaved by the cell from the secreted polypeptides.
- the one or more polynucleotides may further optionally comprise sequences whose only intended function is to facilitate large scale production of the vector.
- polynucleotides may further comprise additional sequences to facilitate uptake by host cells and expression of the antibody or fragment thereof (and/or any other peptide).
- a “naked” transgene encoding an antibody or fragment thereof described herein e.g., a transgene without a viral, liposomal, or other vector to facilitate transfection is employed.
- Any suitable vectors may be used to introduce one or more polynucleotides that encode an antibody or fragment thereof into the host.
- Exemplary vectors that have been described include replication deficient retroviral vectors, including but not limited to lentivirus vectors (Kim et al., J. Virol., 72(1): 811- 816, 1998; Kingsman & Johnson, Scrip Magazine, October, 1998, pp. 43-46); parvoviral vectors, such as adeno-associated viral (AAV) vectors (U.S. Patent Nos. 5,474,935; 5,139,941 ; 5,622,856; 5,658,776; 5,773,289; 5,789,390; 5,834,441; 5,863,541; 5,851 ,521 ; 5,252,479; Gnatenko et al., J. Invest.
- AAV adeno-associated viral
- adenoviral vectors U.S. Patent Nos. 5,792,453; 5,824,544; 5,707,618; 5,693,509; 5,670,488; 5,585,362; Quantin et al., Proc. Natl. Acad. Sci. USA, 89: 2581-2584, 1992; Stratford Perricaudet et al., J. Clin. Invest., 90: 626-630, 1992; and Rosenfeld et al., Cell, 68: 143-155, 1992); an adenoviral adeno-associated viral chimeric (U.S. Patent No.
- viral vectors are rendered replication-deficient by, e.g., deleting or disrupting select genes required for viral replication.
- An expression vector (or the antibody or fragment thereof discussed herein) may be entrapped in a liposome. See, e.g., Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104 (1991); Radler et al., Science, 275(5301): 810-814, 1997). Also contemplated are various commercial approaches involving “Npofection” technology.
- the liposome may be complexed with a hemagglutinating virus (HVJ).
- the liposome is complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al., J. Biol. Chem., 266: 3361-3364, 1991).
- HMG-1 nuclear nonhistone chromosomal proteins
- the liposome are complexed or employed in conjunction with both HVJ and HMG-1.
- SARS-CoV-2 binding agent e.g ., antibody
- an agent that binds to a SARS-CoV-2 spike glycoprotein is included in the liposome to target the liposome to cells.
- a cell may comprise one or more polynucleotide or vectors, e.g., the cell is transformed or transfected with one or more polynucleotides encoding a SARS-CoV- 2 binding agent ⁇ e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, or one or more vectors comprising the one or more polynucleotides.
- cells express a SARS-CoV-2 binding agent (e.g., antibody), containing one or more, including six CDRs having at least 75% identity to the CDRs identified in Tables 1-8.
- the cells express a SARS-CoV-2 binding agent (e.g., antibody) containing a VH and/or a VL comprising CDRs as identified in Tables 1-8.
- SARS-CoV-2 binding agent e.g., antibody
- the cells may be prokaryotic cells, such as Escherichia coli (see, e.g., Pluckthun et al.
- eukaryotic cells such as an animal cell (e.g., a myeloma cell, Chinese Hamster Ovary cell, or hybridoma cell), yeast (e.g., Saccharomyces cerevisiae), or a plant cell (e.g., a tobacco, corn, soybean, or rice cell).
- animal cell e.g., a myeloma cell, Chinese Hamster Ovary cell, or hybridoma cell
- yeast e.g., Saccharomyces cerevisiae
- a plant cell e.g., a tobacco, corn, soybean, or rice cell.
- Use of mammalian host cells may provide for translational modifications (e.g., glycosylation, truncation, lipidation, and phosphorylation) that may be desirable to confer optimal biological activity on recombinant expression products.
- polypeptides e.g., SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein
- polypeptides may be glycosylated or non-glycosylated and/or have been covalently modified to include one or more water soluble polymer attachments such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
- Methods for introducing DNA or RNA into a host cell include transformation, transfection, electroporation, nuclear injection, or fusion with carriers such as liposomes, micelles, ghost cells, and protoplasts.
- host cells are useful for amplifying polynucleotides and also for expressing polypeptides encoded by the polynucleotides.
- a process for the production of a SARS-CoV-2 binding agent may comprise culturing a host cell as described herein and isolating the SARS-CoV-2 binding agent.
- Transferring a naked DNA expression construct into cells can be accomplished using particle bombardment, which depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327: 70-73, 1987).
- particle bombardment depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them.
- Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990).
- the microprojectiles used have consisted of biologically inert substances such as tungsten or gold beads.
- a host cell may be isolated and/or purified.
- a host cell also may be a cell transformed in vivo to cause transient or permanent expression of the polypeptide in vivo.
- a host cell may also be an isolated cell transformed ex vivo and introduced post-transformation, e.g., to produce the polypeptide in vivo for therapeutic purposes.
- the definition of host cell explicitly excludes a transgenic human being.
- a SARS-CoV-2 binding agent e.g., antibody
- an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof is produced using any suitable method, e.g., isolated from an immunized animal, recombinantly or synthetically generated, or genetically- engineered, including as described above.
- Antibody fragments derived from an antibody are obtained by, e.g., proteolytic hydrolysis of an antibody. For example, papain or pepsin digestion of whole antibodies yields a 5S fragment termed F(ab’)2 or two monovalent Fab fragments and an Fc fragment, respectively.
- F(ab)2 can be further cleaved using a thiol reducing agent to produce 3.5S Fab monovalent fragments.
- Methods of generating antibody fragments are further described in, for example, Edelman et al., Methods in Enzymology, 1 : 422 Academic Press (1967); Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244, 1960; Porter, Biochem. J., 73: 119-127, 1959; U.S. Patent No. 4,331 ,647; and by Andrews, S.M. and Titus, J.A. in Current Protocols in Immunology (Coligan et al. , eds), John Wiley & Sons, New York (2003), pages 2.8.1 2.8.10 and 2.10A.1 2.10A.5.
- a SARS-CoV-2 binding agent e.g., antibody
- an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof e.g., SARS-CoV-2- S1 , SARS-CoV-2-RBD
- a SARS-CoV-2 binding agent or an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof comprises, e.g., a variable region domain generated by recombinant DNA engineering techniques.
- variable region is optionally modified by insertions, deletions, or changes in the amino acid sequence of the antibody to produce an antibody of interest, including as described above.
- Polynucleotides encoding complementarity determining regions (CDRs) of interest are prepared, for example, by using polymerase chain reaction to synthesize variable regions using mRNA of antibody producing cells as a template (see, for example, Courtenay Luck, “Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al.
- Humanized antibodies are antibodies in which CDRs of heavy and light variable chains of non-human immunoglobulin are transferred into a human variable domain. Constant regions need not be present, but if they are, they optionally are substantially identical to human immunoglobulin constant regions, e.g., at least about 85-90%, about 95%, 96%, 97%, 98%, 99% or more identical, in some embodiments. Hence, in some instances, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences.
- humanized antibodies are human immunoglobulins ⁇ e.g., host antibody) in which hypervariable region residues of the host antibody are replaced by hypervariable region residues from a non human species (donor antibody) such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
- the antibody is a human antibody, including, but not limited to, an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences as described, for example, in Kabat et al. (1991) Sequences of proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242. If the antibody contains a constant region, the constant region also preferably is derived from human germline immunoglobulin sequences.
- Human antibodies may comprise amino acid residues not encoded by human germline immunoglobulin sequences, for example, to enhance the activity of the antibody, but do not comprise CDRs derived from other species (e.g., a mouse CDR placed within a human variable framework region).
- SARS-CoV-2 binding agents e.g., antibodies
- agents that bind to a SARS-CoV-2 spike glycoprotein e.g., homotrimer, protomer
- an S1 domain of a SARS-CoV-2 spike glycoprotein e.g., SARS-CoV-2-S1
- a receptor binding domain e.g., SARS- CoV-2-RBD
- SARS-CoV-2-RBD receptor binding domain of a SARS-CoV-2 spike glycoprotein
- kits for treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition, in a subject by administering to the subject an effective amount of a SARS CoV-2 binding agent (e.g., antibody) disclosed herein.
- a SARS CoV-2 binding agent e.g., antibody
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are used to prevent a SARS-CoV-2 related disease, disorder, or condition (e.g., infection).
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are administered to a subject prior to or at an early stage of disease (e.g., prior to infection).
- SARS-CoV-2 binding agents (e.g ., antibodies) disclosed herein are administered to a subject as a prophylactic to prevent a SARS-CoV-2 related disease ⁇ e.g., infection).
- administration of SARS-CoV-2 binding agents ⁇ e.g., antibodies) disclosed herein can occur prior to SARS-CoV-2 related disease ⁇ e.g., infection) or prior to manifestation of symptoms characteristic of SARS-CoV-2 related disease ⁇ e.g., infection).
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 related disease e.g., infection
- subjects who are at high risk of exposure to SARS-CoV-2 including, for example, medical professionals such as doctors, nurses, parmedics, medical technicians and assistants).
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are administered to a subject at elevated risk for a SARS-CoV-2 related disease, including mortality from such disease.
- subjects are at elevated risk for SARS-CoV-2 related mortality if one or more coexisting factors or disorders is present, including elevated age, elevated body mass index, history of smoking, chronic obstructive pulmonary disease, diabetes, hypertension, coronary heart disease, cerebrovascular disease, hepatitis B infection, cancer, chronic renal disease, and immunodeficiency.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 agents e.g., antibodies
- SARS-CoV-2 related disease e.g., infection
- SARS-CoV-2 related disease e.g., infection
- manifestation of symptoms such that SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition is prevented or delayed in its progression.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are administered to treat a subject diagnosed with a SARS-CoV-2 related disease (e.g., infection).
- a subject may be diagnosed with a SARS-CoV-2 related disease (e.g., infection) using any method known or developed in the art.
- SARS-CoV-2 binding agents (e.g., antibodies) provided herein are used in treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition, in a subject who has undergone confirmatory testing for a SARS-CoV-2 related disease (. e.g ., infection), using any testing known in the art including molecular testing (e.g ., PCR), serological testing (ELISA), and viral culture.
- molecular testing e.g ., PCR
- serological testing ELISA
- SARS-CoV-2 binding agents ⁇ e.g., antibodies
- SARS-CoV-2 binding agents are useful in a method of treating, preventing or alleviating one or more symptoms of a SARS-CoV-2-related disease, disorder, or condition in a subject, wherein the method comprises administering a SARS-CoV-2 agent ⁇ e.g., antibody) disclosed herein to the subject.
- Symptoms of a SARS-CoV-2-related disease, disorder, or condition can include cough, dyspnea, chest tightness, fever, adverse Gl effects, fatigue, myalgia, arthralgia, lymphocytopenia, conjunctival congestion, nasal congestion, headache, sore throat, sputum production, hemoptysis, shortness of breath, nausea, vomiting, diarrhea, chills, throat congestion, tonsil swelling, lymph node enlargement, rash, pain or pressure in the chest, difficulty in breathing, reduced clarity of vision, loss of taste or smell, and confusion.
- SARS-CoV-2 related diseases, disorders, or conditions related by SARS-CoV-2 include pneumonia (e.g., atypical pneumonia, acute respiratory distress syndrome (ARDS), multiple-organ failure, and cytokine storm).
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are administered to a subject who has symptoms of a SARS-CoV-2 related disease, disorder, or condition (e.g., an infection such as a viral respiratory infection), for example, symptoms associated with SARS-CoV-2 related disease (e.g., infection) based on a clinical assessment (e.g., to distinguish an influenza infection or other pneumonia).
- one or more symptoms of a SARS-CoV-2 related disease, disorder, or condition are assessed using any methods known in the art.
- symptoms are assessed using radiologic assessments including chest radiography or computed tomography (CT) and/or using laboratory assessments known in the art, including complete blood count, blood chemical analysis, coagulation testing, assessment of liver and renal function, and measures of electrolytes, C-reactive protein, procalcitonin, lactate dehydrogenase, and creatine kinase.
- CT computed tomography
- administration of SARS-CoV-2 binding agents prevents or reduces morbidity and/or mortality in subjects with a SARS-CoV-2 related disease, disorder, or condition.
- administration of SARS-CoV-2 binding agents e.g antibodies
- SARS-CoV-2 binding agents ⁇ e.g., antibodies) disclosed herein bind with high affinity ⁇ e.g., in vitro and/or in vivo) to SARS-CoV-2 ⁇ e.g., SARS-CoV- 2 receptor binding domain (RBD)).
- SARS-CoV-2 binding agents ⁇ e.g., antibodies
- SARS-CoV-2 bind to SARS-CoV-2 ⁇ e.g., SARS-CoV-2 receptor binding domain (RBD)) and neutralize SARS-CoV-2 ⁇ e.g., in vitro and/or in vivo).
- RBD SARS-CoV-2 receptor binding domain
- SARS-CoV-2 binding agents ⁇ e.g., antibodies
- SARS-CoV-2 RBD SARS-CoV-2 receptor-associated ICso of less than about 1 pg/mL, about 0.1 pg/mL, about 0.01 pg/mL, about 1 ng/mL, about 0.1 ng/ml, or about 0.01 ng/ml as assessed by methods described herein or known to one of skill in the art.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease burden in SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein provides disease ameliorating effects in vivo, for example, on viral load (e.g., lung viral load) and/or body weight as a clinical symptom.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease severity, including, for example, at a histological level in vivo, in SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces susceptibility to and/or pathogenesis of SARS-CoV-2 infection in a subject.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces pulmonary monocyte-macrophage infiltration, decreases viral load, and/or decreases pulmonary pathology in SARS-CoV-2 infected subjects.
- ROS reactive oxygen species
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces generation of ROS and/or phospholipid peroxidation. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces oxidative stress in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g ., antibodies) disclosed herein prevents or reduces signaling associated with oxidative stress in SARS-CoV-2 infected subjects.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents prevents or reduces induction of Toll-like receptor 4 expression and signaling in SARS-CoV-2 infected subjects, including, for example, by macrophages that in turn upregulate pro-inflammatory cytokine production.
- macrophages that in turn upregulate pro-inflammatory cytokine production.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the amount of oxidized lipids in macrophage-rich inflammatory exudates from SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of pro-atherogenic cytokines and/or chemokines, including, for example, upon their stimulation with oxidized low-density lipoprotein (oxLDL), in SARS-CoV-2 infected subjects.
- oxLDL oxidized low-density lipoprotein
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of TNF, IL-6, IL-8 and/or CD36 in SARS-CoV-2 infected subjects.
- administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the interaction of CD36 with oxidized low-density lipoprotein (oxLDL) in SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces CD36-mediated signaling cascades for inflammatory responses in SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the recognition and/or internalization of oxLDL by CD36 in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces macrophage activation in affected tissues of SARS-CoV-2 infected subjects.
- SARS-CoV-2 binding agents e.g., antibodies
- administration of SARS-CoV-2 binding agents prevents or reduces macrophage activation in non-affected tissues of SARS-CoV-2 infected subjects, including, for example, where pro-atherogenic stimuli have induced a population of long-lasting inflammatory monocytes in the circulation of subjects producing a “trained innate immune response”.
- administration of SARS-CoV-2 binding agents (. e.g ., antibodies) disclosed herein decreases the number of activated monocytes, for example, in microcirculation of infected tissues including in the pulmonary circulation of SARS-CoV-2 infected subjects.
- administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein ameliorates disease severity, including, for example, in the pulmonary parenchyma of SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents modify the immunometabolism of monocyte/macrophage populations in subjects (e.g., in atherosclerotic subjects) with SARS-CoV-2 infection.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are administered to a subject who has a cytokine storm associated with or in response to SARS-CoV-2 infection.
- administration of SARS-CoV-2 binding agents prevents or suppresses a cytokine storm, including, for example, by preventing or suppressing the monocyte-macrophage system (e.g., by reducing viral load and/or accumulation with macrophages such as lung macrophages) in SARS-CoV-2 infected subjects.
- SARS-CoV-2 binding agents e.g., antibodies
- administration of SARS-CoV-2 binding agents prevents or reduces release of cytokines, including, for example, cytokines that directly or indirectly lead to vascular endothelial damage (e.g., inflammatory and coagulation sequelae of SARS-CoV-2 infection including within parenchymatous organs such as lung, hear, kidneys, and liver).
- cytokines including, for example, cytokines that directly or indirectly lead to vascular endothelial damage (e.g., inflammatory and coagulation sequelae of SARS-CoV-2 infection including within parenchymatous organs such as lung, hear, kidneys, and liver).
- SARS-CoV-2 binding agents e.g., antibodies
- are administered to subjects e.g., children with Kawasaki-like disease associated with or in response to SARS-CoV-2 infection.
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents are administered to subjects predisposed to atherosclerosis, including, for example, atherosclerosis due to underlying conditions of hypertension and/or diabetes mellitus.
- administration of SARS-CoV-2 binding agents (e.g ., antibodies) disclosed herein prevents or reduces inflammation associated with or in response to SARS-CoV-2 infection in a subject.
- administration of SARS-CoV-2 binding agents ⁇ e.g., antibodies reduces the number of infiltrating macrophages in SARS-CoV-2 infected subjects.
- SARS-CoV-2 binding agents e.g., antibodies
- a hyperinflammatory response e.g., cytokine storm
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the contribution of hyperactivated monocytes to coagulation and/or activation of polymorph nuclear leukocytes (PMN), including, for example, in affected lungs of SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces microthrombi of the lungs, brain, heart, kidneys, liver and/or limbs of SARS-CoV-2 infected subjects.
- administration of SARS-CoV-2 binding agents prevents or reduces intravascular coagulation, including, for example, disseminated intravascular coagulation (DIC) that primarily or secondarily takes place in microcirculation (e.g., in the lungs) associated with or in response to SARS-CoV-2 infection.
- DIC disseminated intravascular coagulation
- SARS-CoV-2 binding agents e.g., antibodies
- SARS-CoV-2 binding agents e.g., antibodies
- cytokine storm fever
- intravascular coagulation e.g., DIC
- cardiac ischemia stroke
- neuropsychological effects e.g., acute lung injury, acute respiratory distress syndrome, septic shock, sepsis, multi-organ dysfunction or failure.
- SARS-CoV-2 binding agents e.g., antibodies
- An administration regimen of SARS-CoV-2 binding agents for a particular subject will depend, in part, upon the agent used, the amount of agent administered, the route of administration, and the cause and extent of any side effects.
- the amount of agent administered to a subject should be sufficient to effect the desired response over a reasonable time frame.
- SARS-CoV-2 binding agents e.g., antibodies
- the administration is on a schedule such as three times daily, twice daily, once daily, once every two days, once every three days, once weekly, once every two weeks, once every month, once every two months, once every three months, and once every six months, nine months, 12 months, 15 months, 18 months, 21 months, two years, or more.
- the antibody is administered continuously, e.g., via a minipump.
- Suitable routes of administering a composition such as a physiologically- acceptable composition, comprising a SARS-CoV-2 binding agent (e.g., antibody), are well known in the art. Although more than one route are used to administer an agent, a particular route can provide a more immediate and more effective reaction than another route. Depending on the circumstances, a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) is applied or instilled into body cavities, absorbed through the skin or mucous membranes, ingested, inhaled, and/or introduced into circulation.
- a SARS-CoV-2 binding agent e.g., antibody
- a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) through injection by intravenous, subcutaneous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems, or by implantation devices.
- the antibody may be administered locally or systemically.
- a SARS-CoV-2 binding agent e.g., antibody
- a SARS-CoV-2 binding agent e.g., antibody
- a SARS-CoV-2 binding agent may be administered locally via implantation of a membrane, sponge, or another appropriate material on to which the desired agent has been absorbed or encapsulated.
- the device is, one aspect, implanted into any suitable tissue or organ, and delivery of a SARS-CoV-2 binding agent (e.g., antibody) is for example, via diffusion, timed-release bolus, or continuous administration.
- any delivery route known to those skilled in the art may be used, and other delivery routes for SARS-CoV-2 binding agents (e.g., antibodies) include via the pulmonary route using a powder inhaler or metered dose inhaler, via the buccal route formulated into a tablet or a buccal patch, via the rectal route formulated into suppositories; and via the oral route in the form of a tablet, a capsule or a pellet.
- the SARS-CoV-2 binding agents e.g ., antibodies
- the SARS-CoV-2 binding agents ⁇ e.g., antibodies may be administered as part of a composition as described herein.
- the dosage of antibody may be in the range of 0.1-100 mg/kg, alternatively 0.5-50 mg/kg, 1-20 mg/kg, or 1-10 mg/kg.
- the serum concentration of the antibody may be measured by any method known in the art.
- SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject in combination with one or more additional agents.
- the one or more additional agents are independently useful in treating, preventing or alleviating a SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition (e.g., resulting from infection).
- the effect of the one or more additional agents may synergize with the effect of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein.
- the one or more additional agents may be selected by one skilled in the art.
- the method further comprises administering one or more additional agents, which may be present in a composition comprising a SARS- CoV-2 binding agent (e.g., antibody) or provided in a separate composition using the same or a different route of administration.
- Co-administration of SARS-CoV-2 binding agents (e.g., antibodies) with one or more additional agents (combination therapy) may encompass administering a composition comprising SARS-CoV-2 binding agents (e.g., antibodies) and the one or more additional agents as well as administering two or more separate compositions, one comprising the SARS-CoV-2 binding agents (e.g., antibodies) and the other(s) comprising the additional agent(s).
- SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at the same time as one another. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at different times. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) may be administered, for example, once every three days, while an additional agent is administered once daily. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) are administered prior to or subsequent to treatment with the one or more additional agents, for example after a subject has failed therapy with the additional agent.
- the SARS-CoV-2 binding agents (e.g ., antibodies) and one or more additional agents ⁇ e.g., combination therapy) may be administered once, twice or at least the period of time until the SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition ⁇ e.g., resulting from infection) is treated, prevented, alleviated, or cured.
- the SARS-CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered multiple times.
- SARS- CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered via any routes of administration disclosed herein or known in the art.
- the one or more additional agents may comprise agents for influenza (e.g., Favipiravir, Fujifilm Toyama Chemical), H IV-1 protease inhibitor (e.g., ritonavir (Abbvie), prezcobix, ASC09 (Ascletis)), FI IV-1 nucleoside analog reverse transcriptase inhibitor (e.g., emtricitabine and tenofovir), hepatitis C virus protease inhibitor (e.g., danoprevir), a neuraminiase inhibitor.
- influenza e.g., Favipiravir, Fujifilm Toyama Chemical
- H IV-1 protease inhibitor e.g., ritonavir (Abbvie), prezcobix, ASC09 (Ascletis)
- FI IV-1 nucleoside analog reverse transcriptase inhibitor e.g., emtricitabine and tenofovir
- the one or more additional agents are remdesivir (Gilead), galidesivir (BioCryst Pharma), umifenovir, vicromax, ISR-50, oseltamivir (Tamiflu), virazole (Bausch Health), EIDD-2801 (Ridgeback Biotherapeutics), clevudine (Levovir), AB001 (Agastiya Biotech), BTL-tml (Beech Tree Labs), DAS181 (Ansun Biopharma), emetine hydrochloride (Acer Therapeutics), AT-527 (Atea Pharma), ruxolitinib (Novartis), transmembrane protease serine 2 (TMPRSS2) inhibitor (e.g., camostat mesylate), an NMDA receptor glutamate receptor antagonist targeting Glu2NB (e.g., ifenprodil (Algernon Pharma)), soluble human angio
- the one or more additional agents comprise an anti-viral compound ⁇ e.g., an anti-coronaviral compound).
- anti-viral agents include an antibody, an inhibitor of viral RNA-dependent RNA polymerase, an inhibitor of a virus-encoded protease (e.g., a protease that affects processing of a viral RNA-dependent RNA polymerase), an inhibitor of viral budding from host cells, an inhibitor of vial release from host cells (e.g., by altering the activity of hemagglutinin-esterase), an inhibitor of viral binding to a cell surface receptor, an inhibitor of receptor-induced conformational changes in virus spike glycoprotein, or an inhibitor of viral entry into cells.
- a virus-encoded protease e.g., a protease that affects processing of a viral RNA-dependent RNA polymerase
- an inhibitor of viral budding from host cells e.g., an inhibitor of vial release from host cells (e.g., by altering
- the anti-viral compound is a nucleoside/nucleotide reverse transcriptase inhibitor. In some embodiments, the anti-viral compound is a protease inhibitor. In some embodiments, any anti-viral compounds or anti-viral drug combination disclosed herein or known in the art may be used as an additional agent.
- the one or more additional agents comprise a cell- based therapy.
- the cell based therapy may include placenta-based cell therapy (e.g., PLX cell product (PlurStem Therapeutics), mesenchymal stem cells, autologous adipose-tissue derived mesenchymal stem cells (ADMSs), allogenic mesenchymal stem cells (e.g., remestemcel-L (Ryoncil), bone marrow stem cells, allogenic T-cell therapies, natural killer cell-based therapy (e.g., CYNK-001 (Cularity), haNK (ImmunityBio)), allogenic cardiosphere-derived cell therapy (e.g., CAP-1002 (Capricor)), bone marrow-derived mesenchymal stem cells (BM-Allo- MSC), adipose-derived mesenchymal stem cells, (e.g ., Astrostem-V (NatureCell)
- placenta-based cell therapy
- the one or more additional agents comprise a RNA-based treatment.
- the RNA based therapy may include RNAi, siRNA (e.g., VIR-2703 (Vir Biotech)), rintatolimod (AIM ImmunoTech), TGF-beta antisense drug (e.g., OT-101 (Mateon Therapeutics)), inhaled mRNA, and antisense oligonucleotides.
- the one or more additional agents comprise a previously identified agent for coronavirus (e.g., agents for a SARS-CoV-1 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition).
- the one or more additional agents is an antibody against SARS-CoV-1, e.g., CR022 (Tian et al. , Emerg Microbes Infect. 20209:382-385).
- the one or more additional agents is a SARS-associated inflammatory cytokine inhibitor or a tumor necrosis factor (TNF) inhibitor (e.g., a TNF pathway antagonist), nonsteroidal anti inflammatory drugs (NSAIDs), disease-modifying antirheumatic drugs (DMARDs, e.g., hydroxychloroquine, leflunomide, methotrexate, mycophenolate, sulfasalazine), analgesics, topical steroids, systemic steroids (e.g., prednisone), other cytokines, antagonists of inflammatory cytokines (e.g., IL-1, TNF-a, IL-6, IL-12, and IFN-y), antibodies against T cell surface proteins, oral retinoids, salicylic acid, and hydroxyurea.
- TNF tumor necrosis factor
- DMARDs disease-modifying antirheumatic drugs
- topical steroids e.g., prednisone
- other cytokines
- the SARS-CoV-2 binding agents e.g., antibodies
- the SARS-CoV-2 binding agents may be used to treat, prevent, or alleviate a SARS-CoV-2 related disease, disorder, or condition, including a symptom thereof, for example, a cytokine storm, by inhibiting or suppressing the onset or progression of a cytokine storm.
- Mechanisms of cytokine storm by pathogenic SARS-CoV are known in the art, and the one or more additional agents may suppress any pathway or mechanism known in the art (see, e.g., Ye Q, Wang B, Mao J. J Infect.
- the SARS-CoV-2 binding agents and/or one or more additional agents may affect high levels of inflammatory cytokines (e.g., IL-1 B, IFN-g, IP-10, and monocyte chemoattractant protein 1 (MCP-1), activation of T-helper type 1 (Th1) cell response, elevated levels of Th2 cell-secreted cytokines (e.g ., IL-4 and IL-10), elevated serum levels of IL-2R, IL-6, granulocyte colony-stimulating factor, IP-10, MCP-1, macrophage inflammatory protein-1 A, and TNF-a.
- inflammatory cytokines e.g., IL-1 B, IFN-g, IP-10, and monocyte chemoattractant protein 1 (MCP-1
- MCP-1 monocyte chemoattractant protein 1
- Th1 monocyte chemoattractant protein 1
- Th2 cell-secreted cytokines e.g ., IL-4 and IL-10
- the one or more additional agents is an interferon ⁇ e.g., IFN-l).
- one or more additional agents may activate epithelial cells, reduce the mononuclear macrophage-mediated proinflammatory activity of IFN-ab, inhibit recruitment of neutrophils to the sites of inflammation, and/or activate the anti-viral genes in epithelial cells.
- the additional agent is interferon alpha-2b ⁇ e.g., Peglntron (Zydus Cadila)), novaferon (Flu’nan Flaiyao hongxingtan Pharmacueticals), interferon beta 1-a ⁇ e.g., traumakine (Faron Pharma) and SNG001 (Synairgen)), interferon alpha-1 b, abd peginterferon lambda (Eiger BioPharma).
- interferon alpha-2b e.g., Peglntron (Zydus Cadila)
- novaferon Felu’nan Flaiyao hongxingtan Pharmacueticals
- interferon beta 1-a ⁇ e.g., traumakine (Faron Pharma) and SNG001 (Synairgen)
- interferon alpha-1 b abd peginterferon lambda (Eiger BioPharma).
- the SARS-CoV-2 binding agents and/or one or more additional agents may affect dysregulated and excessive immune responses, elevated serum cytokine and chemokine levels, elevated number of neutrophils and monocytes in lung tissues and peripheral blood, delayed release of interferons in the early stages of SARS-CoV infection, thereby reducing excessive infiltration of inflammatory cells into lung tissue that leads to lung injury.
- the one or more additional agents have anti inflammatory functions (e.g., corticosteroids). In some embodiments, the one or more additional agents inhibit excessive inflammation (e.g., during cytokine storm), prevent or inhibit ARDS, and/or protect organ function. Any corticosteroid therapy known in the art is used. For example, in some embodiments, the corticosteroid therapy is methylprednisolone.
- the one or more additional agents includes an immune substitution and/or immunomodulation therapy (e.g., administration of intravenous immunoglobulin (IVIG)).
- IVIG intravenous immunoglobulin
- the one or more additional agents is an inhibitor of IL-1 family cytokines (e.g., IL-1 b, IL-18, and IL-33).
- the additional agent is an antagonist of IL-1 b (e.g., Anakinra).
- the one or more additional agents is an inhibitor of IL-6 (e.g., Tocilizumab), a TNF blocker, an IFN-ab inhibitor, chloroquine (e.g., hydroxychloroquine, chloroquine phosphate), ulinastatin, an oxidized phospholipid inhibitor (e.g., eritoran), a sphingosine-1 -phosphate receptor 1 agonist, or an inhibitors of mononuclear macrophage recruitment and function (e.g ., small interfering RNA (siRNA)-mediated silencing of C-C chemokine receptor type 2 (CCR2) or TLR7 agonists).
- IL-6 e.g., Tocilizumab
- TNF blocker e.g., TNF blocker
- chloroquine e.g., hydroxychloroquine, chloroquine phosphate
- ulinastatin e.g., an oxidized phospholipid inhibitor
- the one or more additional agents include stem cell therapy.
- the one or more additional agents include a medical device (e.g., blood purification system, respiratory assist systems, cytokine adsorber).
- the one or more additional agents include a blood purification system (e.g., plasma exchange, adsorption, perfusion, blood/plasma filtration).
- the one or more additional agents strengthen the vascular barrier (e.g., by activation of the endothelial Slit-Robo4 pathway).
- the one or more additional agents comprise a vaccine.
- the additional agent may be a replicating bacterial vector vaccine, virus-like particle (VLP) vaccine, RNA-based vaccine, replicating viral vector vaccine (e.g., viral vector expressing RBD or spike), protein subunit vaccine (e.g., RBD-based, S protein subunit, peptide-derived from spike protein), non-replicating viral vector, live attenuated virus, inactivated virus, or DNA-based vaccine.
- VLP virus-like particle
- viral vector vaccine e.g., viral vector expressing RBD or spike
- protein subunit vaccine e.g., RBD-based, S protein subunit, peptide-derived from spike protein
- non-replicating viral vector e.g., live attenuated virus, inactivated virus, or DNA-based vaccine.
- the one or more additional agents comprise an antibody.
- the one or more additional agents are antibodies that target a coronavirus spike protein, potential mutations of SARS-CoV-2, vascular endothelial growth factor inhibitor (e.g., bevacizumab), programmed cell death protein (PD-1) or PD-L1, CCR5, interleukin-6 receptor (e.g., sarilumab or tocilizumab), granulocyte- macrophage colony stimulating factor, complement, interleukin-1 -beta, interferon gamma, CD147, angiopoietin-2, C5a, granulocyte macrophage colony-stimulating factor (GM-CSF), TLR4, CXC10, CD14, and interleukin 33.
- vascular endothelial growth factor inhibitor e.g., bevacizumab
- PD-1 or PD-L1 programmed cell death protein
- CCR5 receptor e.g., sariluma
- the one or more additional agents comprise hyperimmune globulin (H-IG) or hyperimmune gammaglobulin. In some embodiments, the one or more additional agents may comprise antibodies from recovered COVID-19 patients or an antibody cocktail.
- the one or more additional agents comprise one or more antibodies (e.g., monospecific or multispecific, including bispecific) with different binding specificities than the SARS-CoV-2 binding agents (e.g., antibodies) as disclosed herein.
- one or more additional antibodies may be used in combination with SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein to simultaneously target one or more epitopes and prevent the emergence of viral escape mutants.
- one or more epitopes may include regions of SARS-CoV-2 spike glycoprotein (e.g ., homotrimer, protomer), S1 or S2 domain of SARS-CoV-2 spike glycoprotein, other SARS-CoV proteins, S protein receptors, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
- one or more additional antibodies e.g., monospecific or multispecific, including bispecific
- SARS-CoV-2 binding agents disclosed herein may be used in combination with SARS-CoV-2 binding agents disclosed herein to simultaneously target multiple viral strains.
- SARS-CoV-2 binding agents disclosed herein and/or one or more additional therapeutic antibodies may bind to a single strain or multiple strains of SARS-CoV-2.
- Recombinant receptor binding domain (RBD) of SARS-CoV-2 spike protein encompassing residues Arg319 to Asn532 (SARS-CoV-2-RBD; SEQ ID NO:27) and carrying a His tag and Avi-tag at the C-terminus and the spike-S1 domain encompassing residues Gln14 to Arg 683 (SEQ ID NO:28) both in biotinylated format (Kactus BioSystems, Woburn MA) were used to screen synthetic fully human antibody libraries displayed on yeast (see, e.g., US Patent No.
- Recombinant SAR-CoV-1 RBD encompassing residues Arg306-Phe527 (SEQ ID NO:29) (Kactus Biosystems) and recombinant human ACE2 extracellular domain encompassing residues Gln18- Ser760 (SEQ ID NO:30) fused to human Fc (Kactus BioSystems) were also used during fluorescence-activated cell sorting (FACS).
- the six library pools were grown up to 3-fold of the original library titer and induced for antibody expression and screened in parallel.
- the screening process involved a preliminary enrichment for antigen-binding antibody clones using magnetic bead activated cell sorting (MACS) followed by FACS.
- MCS magnetic bead activated cell sorting
- yeast cells were grown and induced to express antibodies culturing in induction medium (0.74 g amino acids without tryptophan, 7 g yeast nitrogen base with ammonium sulfate, 2 g glucose, 20 raffinose, 20 g galactose, 8.4 g NaFI2P04-7FI20 and 7.3 g Na2FIP04, pH 6.25) at 20°C for 16 hours to induce the expression of the scFab.
- Biotinylated SARS-CoV-2-RBD plus biotinylated SARS-CoV-2-S1 was added in binding buffer (PBS plus 5g/l BSA, but without Ca2+ or Mg2+) to a final concentration of 100 nM each.
- binding buffer PBS plus 5g/l BSA, but without Ca2+ or Mg2+
- the cells were incubated on ice for 10 min, washed 3 times with 50 ml binding buffer, followed by incubation with streptavidin-magnetic beads for 10 min on ice. The cells were then washed once with binding buffer and resuspended in binding buffer, before being passed through a magnetic sorting column.
- the column was washed 3 times with 7 ml binding buffer. Captured cells were eluted in 10 ml of binding buffer per column by turning off the magnetic field, then pelleted and resuspended in selective medium. The collected cells were grown up and induced for Fab expression as described above and used for a second round of magnetic bead sorting using the same conditions.
- Fab-expressing yeast cells was were incubated with 100 nM biotinylated SARS-CoV-2- RBD plus 100 nM biotinylated SARS-CoV-2-S1 and bound SARS-CoV-2-RBD and SARS-CoV-2-S1 antigens were detected with phycoerythrin (PE)-conjugated streptavidin, while the displayed Fab was detected with goat anti-human Kappa or Lambda followed by APC-conjugated donkey anti-goat antibody. Double positive cells were identified and collected using a FACSAria II (Becton Dickenson) sorter at a rate of 20,000 events per second.
- PE phycoerythrin
- the harvested cells were expanded and used for the next round of sorting that included a presort using biotinylated baculovirus detected with PE-conjugated streptavidin to remove polyspecific (or non-specific, sticky) antibody clones, then taking the antibody-only positive cells and subjecting them to a positive sort in the presence of 100 nM biotinylated SARS-CoV-2-RBD.
- the antigen (biotin) and Fab positive cells were collected and then used for a 3 rd round of FACS, which was designed to select for the subset of SARS-CoV-2-RBD- positive antibody clones that could block binding of the human ACE2 receptor to SARS-CoV-2-RBD antigen captured by the antibody clone displayed at the yeast cell surface.
- the harvested cells were then subjected to a fourth round of FACS using 50 nM biotinylated SARS-CoV-2-S1 detected with PE-conjugated streptavidin and 100 nM human ACE2-Fc (ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc) detected with Dylight 647-conjugated goat anti-human Fc.
- ACE2-Fc ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc
- a final round of FACS was performed to separate the subset of antibody clones expressing antibody that was specific to SARS-CoV-2 RBD from those that expressed antibody that could also bind biotinylated SARS-CoV-1-RBD (residues Arg306 - Phe 537-Avi tag; Kactus Biosystems) at a concentration of 100 nM.
- EXAMPLE 2 SELECTION OF ANTIBODY CLONES
- the yeast antibody clones isolated from the final two rounds of FACS were plated on selective media plates and incubated at 30°C for 2 days. Individual colonies were randomly picked from the agar plates and grown in selective medium overnight at 30°C. The medium was replaced with induction medium and cells cultured at 20°C overnight to induce the expression of Fab antibodies.
- Fab antibody is secreted into the culture medium in addition to those displayed Fab antibodies on the yeast cell surface.
- the secreted Fab in the culture medium can be used directly for binding assays.
- a preliminary ELISA was performed to determine binding activity of individual antibody clones to SARS-CoV-1 RBD, SARS-CoV-2 RBD and to baculovirus to identify antibody clones that bound antigen but did not show background binding to baculovirus.
- a total of 2124 antibody clones were analyzed for SARS-CoV-2 RBD binding and 490 antibody clones from the subset of antibody clones from the harvested pool that bound SARS-CoV-1 RBD were also analyzed. Only 2 of the antibody clones exhibited non-specific binding to baculovirus.
- a competition ELISA was performed to determine the ability of the secreted Fab from individual antibody clones to block SARS-CoV-2 RBD binding to immobilized ACE2 receptor.
- 100 ng of human ACE2-Fc in 100 pi PBS was used to coat the wells of Immulon 2 HB ELISA plates at 4°C overnight. The next day, unbound ACE2 receptor was removed, and the wells were blocked with PBS containing 3% BSA for 1 hour at room temperature then washed.
- the secreted Fab antibodies in 50 mI culture media were mixed with 2 ng of biotinylated SARS-COV-2-RBD or SAR- CoV-1-RBD in 2x binding buffer (0.5 M HEPES, 0.5 M NaCI, 5% BSA, pH 7.5) in a final volume of 100, mI for 30 mins at room temperature, then added to washed ACE2-coated wells. The plates were incubated at 30°C for 1 hr, and the bound biotinylated SARS-RBD detected with HRP-labeled streptavidin (FIG. 2).
- 2x binding buffer 0.5 M HEPES, 0.5 M NaCI, 5% BSA, pH 7.5
- Inhibition of binding was determined by assessing the ratio of the signal for antigen binding in the presence of the Fab-containing culture media compared to the signal for antigen binding in the presence of yeast culture media alone in the absence of Fab.
- Antibody clones that yielded a >50% decrease in signal were considered to be inhibitory antibody clones. From a total of 2122 yeast antibody clones tested, 667 expressed Fab that blocked SARS-CoV-2-RBD binding to ACE2-coated wells by >50%. Of these, 205 antibody clones also bound to SARS-CoV-1 RBD.
- antibody clones were also tested by ELISA for binding to baculovirus to eliminate those antibody clones exhibiting non-specific binding.
- Yeast antibody clones expressing specific antibody clones that exhibited > 70% inhibition of SARS-CoV-2-RBD binding to ACE2-coated wells were then combined into 5 new plates and the culture media tested for the ability of the secreted Fab to bind to full-length spike protein expressed as a spike-green- fluorescent protein (GFP) fusion in 293 cells, which should more faithfully represent the conformation of native trimeric spike protein on the virus particle than the isolated RBD domain.
- GFP spike-green- fluorescent protein
- GFP green fluorescent protein
- the cells were then incubated in 50 pi Fab-containing culture supernatant from individual yeast antibody clones for 45 mins with rotation at 4°C, washed 3 times in ice-cold PBSM and then bound Fab detected with either goat anti-human kappa-A647 (SouthernBiotech cat# 2060-31) or goat anti-human lambda-A647 (SouthernBiotech cat# 2070-31)
- the cells were then washed three times with ice cold PBSM, the washed cell pellet resuspended in ice-cold PBSM and the cell-bound Dylight-647 analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius).
- EXAMPLE 3 VIRAL NEUTRALIZATION ACTIVITY [00355]
- the sixty-three (63) antibody clones that represented the unique antibody clones in the set of 65 testing positive for binding to spike glycoprotein expressed by 293F cells were selected for production as full-length IgGl
- the light and heavy chains were separately cloned into different expression vectors carrying the constant regions of human lgG1 heavy chain and either the kappa or lambda chain (depending of the VL identity of the isolated antibody clone).
- the heavy and light chain plasmids were co-transfected into Expi293 suspension cells.
- Secreted antibody was then purified from the culture supernatants by Protein A chromatography, buffer-exchanged into PBS pH 7.4 and its concentration determined by Nanodrop A280 assay. The quality of each IgG was assessed by SDS-PAGE and by HPLC.
- a viral cytopathic effect (CPE) assay was performed to assess the ability of the 63 selected antibody clones to inhibit cell death of Vero E6 epithelial cells, which naturally express ACE2, upon viral infection in the presence of SARS-CoV-2.
- CPE viral cytopathic effect
- Vero E6 cells are seeded into wells of a 96-well plate and grown to confluence then infected with SARS-CoV-2 virus (Washington state SARS-CoV-2 isolate WA1 -F6/2020). After 4 days culture, the cytopathic effect of the virus is clearly visible by microscopy (FIG. 4A).
- each test antibody clone was diluted into DMEM (FlyClone Characterized) with routine antibiotics and supplements (pen/strep, sodium pyruvate, L-glutamine) to give 20 pg/ml in 100 pi. Then 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was added to each well, thus diluting the antibody in each well to 10 pg/ml.
- DMEM FelyClone Characterized
- pen/strep sodium pyruvate, L-glutamine
- the plates were incubated at 37°C with 5% CO2 in a humidified incubator for 1 hour then the media in the wells with the Vero E6 cell monolayers was removed and the antibody- virus mixtures transferred to the corresponding Vero E6 cell wells.
- One well on the plate had control irrelevant IgG with virus and one well served as the non-virus control well.
- the plates were incubated for 48 hrs at 37°C with 5% CO2 in a humidified incubator then each well scored by microscopic analysis for the presence of live cells. Out of the 63 antibody clones tested, 12 showed neutralizing activity at 10 pg/ml.
- the assay was repeated with the 12 antibody clones that exhibited neutralizing activity, this time using a log3 dilution series ranging from 10 to 0.0045 pg/ml in triplicate of each of the 12 antibody clones that had exhibited neutralizing activity at 10 pg/ml to determine the lowest concentration that could provide protection from cell death, the IC100 value.
- the wells were scored for absence or presence of viral-induced cell death. The lowest concentration providing protection from cell death for each of the antibody clones is shown in Table 11. Five antibody clones, clone A, B, C, D and E conferred full protection from cell death at concentrations below 0.4 pg/ml.
- 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was mixed with test antibody in DMEM at concentrations ranging from 10 pg/ml to 0.0005 pg/ml and pre-incubated together for 1 hr.
- the mixture was then added to the wells with confluent Vero E6 cells and the plates cultured for 4 days.
- a separate set of wells were cultured in the presence of antibody alone. Each condition was run in 5 replicate wells. Then 3 days later the number of viable cells in each well was measured using the CellTitreAq assay according to the manufacturer’s protocol.
- the ratio of the viable cell signal in the virus+antibody treated wells to the corresponding antibody-only treated wells at each dilution was plotted and the ICso determined using Prism software.
- the curve fit plots are shown in FIGS. 4B-4D and the ICso values in Table 12, which indicated that antibody clones B, C and F had ICso values in the 10 to 20 ng/ml range.
- the plates were incubated at room temperature for 1 hr, washed and bound antigen detected with HRP-labeled streptavidin.
- the OD values versus test antibody concentration were plotted and curve fitted using Prism software.
- the ICso curve for Clone B (AvGn-B) is shown in FIG. 5C.
- the ICso values for 4 clones assessed in this assay ranged from 2.2 nM to 23 nM (Table 13).
- the binding affinity to full- length native spike protein expressed on transiently transfected 293 cells expressing spike-GFP protein was determined as follows. Following transfection as described above, cells were harvested and washed with ice cold PBSM (phosphate-buffered saline containing EDTA and 0.5% BSA). The cells were blocked in PBSM for 45 min at 4°C with rotation. The cells were transferred to a 96-well plate (80,000 cells/well) and pelleted by centrifugation.
- PBSM phosphate-buffered saline containing EDTA and 0.5% BSA
- Anti-SARS-CoV-2-RBD, control IgGs or ACE2-Fc were each serially diluted in ice cold PBSM, and the cell pellets were resuspended and incubated in these IgG/PBSM solutions for 45 min at 4°C with rotation. After the incubation, the cells were washed three times with ice cold PBSM by centrifugation then resuspended in fresh buffer.
- the washed cell pellets were then resuspended and incubated in the dark, at 4 °C with rotation in PBSM containing goat anti-hlgG- Fc-APC (Jackson ImmunoResearch Laboratories, Inc.cat# 109-135-098) or goat anti-hlgG-Fc-A647 (Jackson ImmunoResearch Laboratories, cat# 109-605-008).
- the cells were then washed three times with ice cold PBSM and the washed cell pellet resuspended in ice cold PBSM and analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius).
- BIOPHYSICAL PROPERTIES HPLC analysis of 6 antibody clones indicated that they showed a single discrete peak consistent with monomeric IgG. Thermostability analysis of the 6 antibody clones was performed using by differential scanning fluorimetry (DSF). All DSF assays were carried out using the LightCycler 480 II Real-Time PCR instrument (Roche Applied Science, (Pleasanton, CA)) with filtered PBS buffer. Each test antibody was mixed with 100x SYPRO Orange solution (Invitrogen) to give a final concentration of 1.6mM protein and 20x SYPRO Orange. Twenty-five microliters of this mixture were then added to each well of a white LightCycler 48096-well plate.
- DSF differential scanning fluorimetry
- the plate was heated from 20°C to 99°C at a rate of 2.4°C/min, and the resulting fluorescence data were collected.
- the negative first derivative of the melt curve was calculated, and the minima values were defined as melting temperatures (Tm). Where multiple unfolding transitions were observed, the first (lowest) melting transition was reported as Tm1 , the next lowest as Tm2 and in some cases the third as Tm3.
- Tm1 melting temperatures
- Tm2 melting temperatures
- Tm3 melting temperatures
- a large scale preparation of Clone B (AvGn-B) was generated as described in Example 3.
- An aliquot of the purified Clone B (AvGn-B) lgG1 was then tested for endotoxin levels using a Limulus Amoebocyte Lysate (LAL) assay (ThermoFisher Scientific, catalogue # A39552) to ensure endotoxin content per dose was well below the threshold that could trigger untoward effects in vivo.
- LAL Limulus Amoebocyte Lysate
- the lungs were then extirpated en bloc and fixed whole in 10% neutral buffered formalin for at least 3 days to ensure virus inactivation before processing for histological analysis.
- Four transverse whole-lung sections per animal were stained with fast red and slides were counterstained with hematoxylin or processed for IHC.
- All lung sections were digitalized using a Nikon Eclipse 80i microscope and Nikon Digital Sight DS-FI1 camera (Nikon instruments, USA). Quantitative and qualitative microscopic analysis was determined using micrographs and morphological methods to quantify pulmonary lesions with the use of NIS-Elements (Nikon, Americas, USA).
- Lungs from the two (2) uninfected AvGn-B treated hamsters did not show significant bronchiolar or parenchymal inflammation.
- Distal trachea and main stem bronchi contained microscopic hemorrhages and there were variable degrees of iatrogenic atelectasis, especially in cranial and middle portions of the lungs.
- Occasional peribronchiolar lymphoid follicles of moderate cellularity were present around bronchioles.
- Other organs, namely, tracheobronchial and hilar lymph nodes, heart and kidneys were within normal histologic limits.
- lung parenchyma In virus-infected and untreated hamsters, approximately 50-75% of lung parenchyma, especially the inner parenchyma (i.e. , peribronchial lung tissue), was consolidated, dark red and heavier than outer inflated lung parenchyma. Massive cellular infiltrates of predominantly macrophages, 60-70%, intermixed with neutrophils, lymphocytes and plasma cells partially filled the lumina of terminal bronchioles and adjacent alveolar and perivascular spaces to varying degrees. In the most affected lobes, there was near complete obliteration of air spaces ( FIG 7A, panel B) compared to lungs from uninfected hamsters (FIG. 7A, panel A).
- FI&E sections were manually screened for pattern recognition of affected versus unaffected pulmonary parenchyma. At least 6 representative regions of interest (ROI) were defined (1088 x 816 pm) and subjectively delineated (annotated) by a trained single veterinary pathologist based upon hypercellularity and consolidation of alveolar spaces. Manual annotation was compiled for digital quantification of affected areas of the lung to compare individual hamsters. Data were expressed as mean ( ⁇ SEM). Statistical analyses were performed using one-way ANOVA multiple comparison test p values less than 0.05 were considered significant.
- ROI regions of interest
- Sections were stained for DAP I (Sigma) and images were captured using an Olympus BX63 fluorescence microscope equipped with a motorized stage and Flamamatsu ORCA-flash 4.0 LT CCD camera. Images were collected with Olympus cellSens software (v 1.18). Regions of interest (ROIs) were drawn around the perimeter of each tissue section and intensity thresholds were kept constant across groups analyses were performed blinded. Co-localization and intensity measurements were obtained using the Count and Measure feature of cellSens. [00376] Lungs were examined for the extent of macrophage infiltration and SARS- CoV-2 viral load at 5 days post infection by histopathological examination and by immunofluorescence imaging.
- SARS-CoV-2 virus has been identified with mutations in the RBD region. These include the SARS-CoV-2 B.1.1.7, B.1.427 and P.1 variants which carry mutations that have been linked to increased transmissibility, namely the N501Y, K417N and E484K mutations.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid; and/or
- VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
- VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
- VL light chain variable
- VL CDR1 having the amino acid sequence of
- VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X 2 are each independently a naturally occurring amino acid
- VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X 3 are each independently a naturally occurring amino acid.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid;
- VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
- VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- VL light chain variable
- VL CDR1 having the amino acid sequence of
- VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X 2 are each independently a naturally occurring amino acid;
- VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid;
- VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
- VL light chain variable
- VL CDR1 having the amino acid sequence of RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
- VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X 2 are each independently a naturally occurring amino acid;
- VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X 2 , and X 3 are each independently a naturally occurring amino acid.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or
- VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and/or
- VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
- VL light chain variable
- VL CDR1 having the amino acid sequence of RASQSVRX1 TYLA (SEQ ID NO: 115) wherein Xi is S, G or D; and/or
- VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X 2 is S or T; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X 2 A or L, and X3 is Y or F.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
- VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
- VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
- VL light chain variable
- VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D;
- VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X 2 is S or T;
- VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X 2 A or L, and X3 is Y or F.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
- VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
- VL light chain variable
- VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D;
- VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X 2 is S or T;
- VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X 2 A or L, and X3 is Y or F.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:32
- VH CDR2 having the amino acid sequence of SEQ ID NO:33
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:34;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:52;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:58
- VH CDR2 having the amino acid sequence of SEQ ID NO:59
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:52;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:52;
- VL CDR3 having the amino acid sequence of SEQ ID NO:68.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:78
- VH CDR2 having the amino acid sequence of SEQ ID NO:66
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:85;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:52;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1
- VH CDR2 having the amino acid sequence of SEQ ID NO:99
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR3 having the amino acid sequence of SEQ ID NO:100.
- An antibody or fragment thereof that binds to SARS-CoV-2 wherein the antibody or fragment thereof comprises:
- VH heavy chain variable
- VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
- VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24;
- VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20;
- VL light chain variable
- VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
- VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22;
- VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1;
- VH CDR2 having the amino acid sequence of SEQ ID NO:2;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR2 having the amino acid sequence of SEQ ID NO:5;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:7;
- VH CDR2 having the amino acid sequence of SEQ ID NO:8;
- VH CDR3 having the amino acid sequence of SEQ ID NO:9;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO: 10;
- VL CDR2 having the amino acid sequence of SEQ ID NO:11;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO: 12;
- VH CDR2 having the amino acid sequence of SEQ ID NO:2;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR2 having the amino acid sequence of SEQ ID NO:5;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO: 13;
- VH CDR2 having the amino acid sequence of SEQ ID NO: 14;
- VH CDR3 having the amino acid sequence of SEQ ID NO:15;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO: 16;
- VL CDR2 having the amino acid sequence of SEQ ID NO:11;
- VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO: 18;
- VH CDR2 having the amino acid sequence of SEQ ID NO: 19;
- VH CDR3 having the amino acid sequence of SEQ ID NO:20;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:21;
- VL CDR2 having the amino acid sequence of SEQ ID NO:22;
- VL CDR3 having the amino acid sequence of SEQ ID NO:23.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1;
- VH CDR2 having the amino acid sequence of SEQ ID NO:24;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR2 having the amino acid sequence of SEQ ID NO:5;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- An antibody or fragment thereof that binds to SARS-CoV-2 wherein the antibody or fragment thereof comprises: (a) a heavy chain variable (VH) region comprising:
- VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18;
- VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24;
- VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20;
- VL light chain variable
- VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
- VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22;
- VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:7;
- VH CDR3 having the amino acid sequence of SEQ ID NO:9;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:10;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:12;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:13;
- VH CDR3 having the amino acid sequence of SEQ ID NO:15;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:16;
- VL CDR3 having the amino acid sequence of SEQ ID NO:17.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:18;
- VH CDR3 having the amino acid sequence of SEQ ID NO:20;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:21 ;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:4;
- VL CDR3 having the amino acid sequence of SEQ ID NO:6.
- VH heavy chain variable
- VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
- VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48;
- VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20;
- VL light chain variable
- VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46;
- VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:32;
- VH CDR2 having the amino acid sequence of SEQ ID NO:33;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:34;
- VL CDR2 having the amino acid sequence of SEQ ID NO:35;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:37;
- VH CDR2 having the amino acid sequence of SEQ ID NO:38;
- VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising:
- VL CDR1 having the amino acid sequence of SEQ ID NO:39;
- VL CDR2 having the amino acid sequence of SEQ ID NO:40;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO: 12;
- VH CDR2 having the amino acid sequence of SEQ ID NO:33;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:34;
- VL CDR2 having the amino acid sequence of SEQ ID NO:35;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:41;
- VH CDR2 having the amino acid sequence of SEQ ID NO: 14;
- VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or (b) a light chain variable (VL) region comprising:
- VL CDR1 having the amino acid sequence of SEQ ID NO:42;
- VL CDR2 having the amino acid sequence of SEQ ID NO:40;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO: 18;
- VH CDR2 having the amino acid sequence of SEQ ID NO:44;
- VH CDR3 having the amino acid sequence of SEQ ID NO:20;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:45;
- VL CDR2 having the amino acid sequence of SEQ ID NO:46;
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or
- VH CDR2 having the amino acid sequence of SEQ ID NO:48;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising:
- VL CDR1 having the amino acid sequence of SEQ ID NO:34;
- VL CDR2 having the amino acid sequence of SEQ ID NO:35;
- An antibody or fragment thereof that binds to SARS-CoV-2 wherein the antibody or fragment thereof comprises:
- VH heavy chain variable
- VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
- VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48;
- VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20;
- VL light chain variable
- VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45;
- VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46;
- VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
- VH heavy chain variable
- VH CDR1 having the amino acid sequence of SEQ ID NO:32;
- VH CDR3 having the amino acid sequence of SEQ ID NO:3;
- VL light chain variable
- VL CDR1 having the amino acid sequence of SEQ ID NO:34;
- VH heavy chain variable
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pulmonology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
The present disclosure provides SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such binding agents are useful, including in compositions and in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
Description
SARS-COV-2 BINDING AGENTS AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS [0001] This application claims the benefit of U.S. Provisional Application No. 63/081,893, filed September 22, 2020, U.S. Provisional Application No. 63/031,565, filed May 28, 2020, U.S. Provisional Application No. 63/031,564, filed May 28, 2020, and U.S. Provisional Application No. 63/031,560, filed May 28, 2020, the disclosure of each of which is incorporated by reference herein in its entirety.
SEQUENCE LISTING
[0002] This application incorporates by reference a Sequence Listing submitted with this application as a text file, entitled 13366-010-228_SEQ_LISTING.txt, created on May 26, 2021 , and is 83,447 bytes in size.
FIELD
[0003] Provided herein are SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such binding agents are useful, including in compositions and in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
BACKGROUND
[0004] Coronavirus are positive-sense, single-stranded RNA viruses that have been classified into 4 groups, a, b, yand d coronaviruses. They infect birds and mammals; common human coronaviruses include the b-coronaviruses HCovOC43 and HCoV-HKU1 and the a-coronaviruses HCoV-229E and HCoV-NL63 that cause common colds and more severe lower respiratory tract infections in the very young and the elderly. Over the past two decades, three serious b-coronaviral infections have arisen by zoonotic transmission of b-coronavirus from animals, most likely originating from bats: SARS-CoV, MERS-CoV and now SARS-CoV-2.
[0005] Cellular infection of coronaviruses is mediated by the viral homotrimeric spike glycoprotein binding to specific host cell receptors. Each protomer consists of an S1 domain which mediates receptor binding and an S2 domain that mediates membrane fusion and cell infection following conformational changes induced by host cell receptor binding. In the case of SARS-CoV-1 , SARS-CoV-2 and HCoV-
NL63, the host receptor is the angiotensin converting enzyme 2 (ACE2) expressed on mucosal epithelia of the lungs and the Gl tract. The spike glycoprotein protomer for SARS-CoV-2 is a 1273 amino acid protein, wherein the S1 domain comprises residues 13 - 685 and the S2 domain comprises residues 686 -1273. Previous structural studies with recombinant SARS-CoV-1 S1 domain interactions with ACE2 indicated that a receptor binding domain within the S1 domain encompassing residues 318 - 510 itself consists of two subdomains with a core domain and an extended loop domain consisting of residues 424 - 494 as the receptor binding motif (RBM) that interacts with the ACE2 receptor forming a shallow concave binding surface. Previous structural studies have also indicated that within the native conformation of spike homotrimers, the RBD can exist in either an up or down position, with the number of RBDs within the spike glycoprotein trimer being in the up conformation at any one time being in dynamic flux. Binding to ACE2 can only occur when the RBD is in the up postion. When all three RBDs are in the down conformation, this prevents any interaction with ACE2.
[0006] Many studies are ongoing to understand more about SARS-CoV-2, including its interaction with the ACE2 receptor and there is an urgent need for agents that can be used in methods for treating, preventing, or ameliorating a SARS- CoV-2 related disease, disorder, or condition.
SUMMARY
[0007] The present disclosure provides SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. Such antibodies (e.g., monospecific or multispecific, including bispecific) may bind to a SARS-CoV-2 spike glycoprotein (e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
[0008] The present disclosure also provides compositions comprising a SARS- CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein. Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein. [0009] The present disclosure also provides methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or
more symptoms of the disease, disorder, or condition with a SARS-CoV-2 binding agent or a composition comprising the SARS-CoV-2 binding agent, including an agent that binds to a SARS-CoV-2 spike glycoprotein or composition comprising such an agent. Such compositions comprise agents that include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein.
BRIEF DESCRIPTION OF THE DRAWINGS [0010] FIG. 1 illustrates exemplary results from assays for separation of potential inhibitors of receptor binding from non-inhibitors, including from FACS identification of a subset of SARS-CoV-2-RBD positive antibody clones that inhibit ACE2 receptor binding to captured antigen. Left panel: unstained yeast cells. Right panel: yeast cells after induction of antibody display were stained with biotinylated SARS-CoV-2 RBD and Phycoerythrin (PE)-conjugated streptavidin (P1 gate), followed by incubation with human ACE2-human Fc fusion protein (which had been shown to bind to SARS-CoV-2-RBD with high affinity). Bound ACE2-human Fc was then detected by Dylight 647 conjugated goat anti-human Fc. Antibody clones that could bind ACE2 in the presence of bound antigen appear double positive (P3 gate). Antibody clones that bind biotinylated SARS-CoV-2 RBD in a manner that prevents binding of ACE2-Fc to antigen (P1 gate) are potential inhibitory antibody clones that block the RBD-receptor interaction.
[0011] FIG. 2 illustrates exemplary results from ELISA screening assays to identify antibody clones that inhibit the interaction of SARS-CoV-2-RBD with ACE2, including from characterization of individual antibody clone Fab-containing culture media. Exemplary results of ELISA competition assays testing the ability of secreted Fab from individual yeast antibody clones to inhibit binding of SARS-CoV-2-RBD to ACE2 coated wells are shown. Secreted Fab in culture medium was used directly for assessing the ability of the Fab to block SARS-CoV-2-RBD binding to ACE2-Fc coated wells and compared with the level of binding in the presence of yeast media alone as the null effect control. An aliquot (50 pi) of the culture media was preincubated with 2 nM of biotinylated SARS-CoV-2-RBD in a final volume of 100 mI for 30 mins at room temperature, then added to washed ACE2-coated wells. After incubating for 1 hour at room temperature, the wells were washed and bound antigen detected with HRP-labeled streptavidin. Well H12 was treated with plain yeast media and served as the negative reference control. The results of the
antibody clones that resulted in a >50% reduction in biotinylated SARS-CoV-2-RBD binding to the ACE2 coated wells are shaded.
[0012] FIG. 3 illustrates exemplary results from assays of Fab supernatant binding to 293F cells that were transfected to express a SARS-CoV-2 spike glycoprotein, including from evaluation of the Fab in individual clone culture media to bind to SARS-CoV-2 spike glycoprotein expressed in the 293F cells. 293F cells transiently transfected with a vector encoding full-length spike protein as a green fluorescent protein (GFP) fusion were incubated in the presence of 50 pi of clone culture media, a negative control clone culture media, or plain culture media (for secondary detection staining alone) added to 50 mI DMEM. After incubating with rotation for 1 hr at 4°C, cells were washed and bound Fab detected with Alexa-647 labeled goat anti-human light chain (LC). Selected panels from a 96-well plate flow cytometry assessment of Fab binding compared to controls. Upper row: SARS-CoV-2 spike glycoprotein-GFP fusion protein transfected cells. Lower row: non transfected control 293F cells. GFP fluorescence intensity, a measure of SARS-CoV-2-spike glycoprotein-GFP fusion protein expression is shown along the Y axis; Alexa 657 fluorescence intensity, a measure of Fab binding, is shown along the X axis.
[0013] FIGS. 4A-4D illustrates exemplary results from viral neutralization assays. Vero E6 cells were plated in 96-well plates at 20,000 cells per well and assessed for viral induced cytopathic effects 2-4 days after addition of SARS-CoV-2 isolate WA1- F6/2020 equivalent to 100 TCID50. FIG. 4A: Phase contrast of uninfected Vero E6 cells, or SARS-CoV-2 infected Vero E6 cells 4 days after infection. FIGS. 4B-4D:
To determine the ICso values, the antibody clones were diluted in Complete DMEM and serially diluted 1:3 ranging from 10 pg/ml to 0.00005 pg/ml. The dilutions of antibody were incubated with 100 TCIDso per 50 pL of SARS-CoV-2 for 1 hr and added to the assay plates. The plates were incubated for 4 days at 37°C, 5% CO2 and 95% relative humidity and the inhibitory effects of the antibodies were measured using an MTS colorimetric cell viability method and the IC50 values were determined using Prism software (GraphPad, San Diego CA).
[0014] FIGS. 5A-5C illustrate the binding properties of Clone B (AvGn-B). FIG.
5A: Binding of monomeric biotinylated SARS-CoV-2-RBD at different concentrations to immobilized Clone B (AvGn-B) coated on wells of Immobilon plates. FIG. 5B: Binding of ACE-2-Fc and Clone B (AvGn-B) to SARS-COV-2 spike-protein expressing transfected 293 cells versus concentration. FIG. 5C: Inhibitory activity
versus concentration curve measuring the ability of Clone B (AvGn-B) to block SARS-CoV-2-RBD binding to wells coated with ACE2-Fc. Curve fitting and determination of KD and IC50 values were performed using Prism software.
[0015] FIGS. 6A and 6B illustrate the effect of dosing Clone B (AvGn-B) on body weight and lung viral load in SARS-CoV-2 infected hamsters. Of the 20 hamsters,
18 were intranasally infected with 2.5x104 TCIDso/mL equivalents of SARS-CoV-2 (strain 2019-nCoV/USA-WA1/2020) and divided into treatment groups as follows: 2.5mg Clone B (AvGn-B) (n=5), 1 mg Clone B (AvGn-B) (n=5), “Untreated” (no antibody) (n=6), and “Ab Control” (2.5 mg isotype control lgG1) (n=2). Two uninfected hamsters received 2.5 mg Clone B (AvGn-B). Each animal was dosed intraperitoneally with corresponding treatment at 24 and 72 hours post-infection.
Each hamster was weighed daily and then euthanized at Day 5. FIG. 6A: Body weight changes post infection. Hamster body weights were recorded daily (0-5 days post-infection [dpi]), and weight loss was defined as percentage loss from 0dpi. Weight loss of infected groups compared to the uninfected control group was analyzed using two-way ANOVA in Prism GraphPad for each day (p<0.0001). FIG. 6B: Quantification of viral load (gene copy number/reaction) in infected hamster lung was compared between treatment groups (analyzed by Mann-Whitney U Test in Prism GraphPad) (*P< 0.05). U = Untreated, virus infected; Hi = high dose (2.5 mg) Clone B (AvGn-B); Lo = low dose (1 mg) Clone B (AvGn-B); and Ctl = Ab Control (2.5 mg isotype control IgG).
[0016] FIGS. 7A and 7B illustrate the effect of Clone B (AvGn-B) on lung histology 5 days post-infection compared with lungs from uninfected hamsters. FIG. 7A: H&E stained whole lung lobe section from uninfected control (panel A), infected with no treatment (Untreated, panel B), infected treated with 2.5 mg control lgG1 (panel C), and infected treated with 1 mg Clone B (AvGn-B) (panel D). FIG. 7B: Quantification of bronchiointerstitial pneumonia within regions of interest delineated from each lung lobe of each animal. (*P< 0.05, **P<0.01,***P<0.001, ****P<0.0001). [0017] FIG. 8 illustrates the effect of Clone B (AvGn-B) on SARS-CoV-2 viral content of hamsters 5 days post infection (dpi). Staining for the nucleocapsid protein of SARS-CoV-2 in lungs of an infected, untreated (panel A) and control lgG1 treated (2.5 mg/dose) treated (panel C) compared with lungs from infected, clone B (AvGn- B) treated hamsters at 1 mg/dose (panel B) or 2.5 mg/dose (panel D).
[0018] FIGS. 9A and 9B illustrate the effect of Clone B (AvGn-B) on macrophage activity within lungs of hamsters 5 days post infection with SARS-CoV-2 virus compared to uninfected hamsters. FIG. 9A: Macrophage content/pm determined using IBA1 staining to identify monocytes and macrophages within lung tissue measured using a scanning digital microscope and cellSens software. FIG. 9B: Colocalization of SARS-CoV-2 virus and monocytes/macrophages within the lung of infected hamsters determined using IBA1 staining for monocytes and macrophages and anti-SARS-CoV-2 nucleocapsid protein to stain for virus. (*P< 0.05,
**P<0.01 ,***P<0.001 , ****P<0.0001 ; N=2 animals/group).
[0019] FIGS. 10A and 10B illustrate the comparison of Clone B (AvGn-B) with an exemplary engineered variant. FIG. 10A: Binding of ACE-2-Fc, Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) to SARS-COV-2 spike-protein expressing transfected 293 cells or control non-transfected 293 cells versus concentration. FIG. 10B: Neutralization activity of Clone B (AvGn-B) or Clone B-G2 (AvGn-B-G2) in the CPE assay measured as percent of viable cells remaining 4 days after addition of virus plus the different concentrations of antibody as indicated to the confluent Vero-E6 cells in culture wells. KD and ICso values were determined using Prism software. [0020] FIGS. 11 A and 11 B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone G2 (AvGn-B-G2), Clone G4 (AvGn-B-G4), Clone H1 (AvGn-B-H1), Clone H2 (AvGn- B-H2), Clone A1 (AvGn-B-A1), Clone F2 (AvGn-B-F2), and Clone F11 (AvGn-B- F11 ), including consensus sequences for VFI CDR1 , VFI CDR2, VFI CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
[0021] FIGS. 12A and 12B show a sequence alignment of heavy chain variable regions and light chain variable regions, respectively, of Clone B (AvGn-B), Clone C (AvGn-C), and Clone F (AvGn-F), including sequences for VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and VL CDR3. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT and AHon numbering.
DETAILED DESCRIPTION
[0022] The present disclosure provides SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein. Such agents include antibodies that bind to SARS-CoV-2, including antibodies that bind to a SARS-CoV-2
spike glycoprotein. Such antibodies ( e.g ., monospecific or multispecific, including bispecific) may bind to a SARS-CoV-2 spike glycoprotein {e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. Such binding agents {e.g., antibodies) are useful in compositions and in methods of treating, preventing, or alleviating a coronavirus-mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
[0023] The present disclosure provides SARS-CoV-2 binding agents such as agents the bind to a SARS-CoV-2 spike glycoprotein, including agents that are antibodies or antibody fragments, and methods of using SARS-CoV-2 binding agents such as agents that bind to a SARS-CoV-2 spike glycoprotein, in methods of treating, preventing, or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
For example, SARS-CoV-2 binding agents such as agents, including antibodies, that bind to a SARS-CoV-2 spike glycoprotein (e.g., monospecific or multispecific antibodies, including bispecific antibodies) are useful in such methods of treatment, prevention, or alleviation.
[0024] Provided herein are binding agents (e.g., antibodies) which bind to SARS- CoV-2, including agents (e.g., antibodies) that bind to a SARS-CoV-2 spike glycoprotein (e.g., with an amino acid sequence of SEQ ID NO:31). A SARS-CoV-2 binding agent (e.g., antibody) may bind to a SARS-CoV-2 spike glycoprotein or portion thereof such as an S1 domain (e.g., with an amino acid sequence of SEQ ID NO:28) or receptor binding domain (e.g., with an amino acid sequence of SEQ ID NO:27). An exemplary amino acid sequence of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 {see, e.g., amino acids 13-1273). An exemplary amino acid sequence of an S1 domain of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 {see, e.g., amino acids 13(Ser)-685(Arg)). An exemplary amino acid sequence of a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein is provided by UniProtKB accession number P0DTC2 {see.e.g., amino acids 319(Arg)-532(Asn)). An exemplary SARS-CoV-2 binding agent (e.g., antibody) is provided herein which comprises an amino acid sequence that is YYVGWGWFDV (SEQ ID NO:3). An exemplary anti-SARS-CoV-2 antibody is provided herein which comprises a heavy chain variable (VFI) region, for example, comprising a VFI CDR1 , VFI CDR2, and VFI
CDR3, and a light chain variable (VL) region, for example, comprising a VL CDR1 ,
VL CDR2, and VL CDR3, wherein the VH CDR3 has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
[0025] The term “antibody,” “immunoglobulin,” or “Ig” is used interchangeably herein, and is used in the broadest sense and specifically covers, for example polyclonal antibodies, monoclonal antibodies (including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies), antibody compositions with polyepitopic or monoepitopic specificity, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), synthetic antibodies, chimeric antibodies, humanized antibodies, or human versions of antibodies having full length heavy and/or light chains.
Antibodies and fragments thereof as disclosed herein include antibodies and fragments thereof that bind to SARS-CoV-2, including, for example, a SARS-CoV-2 spike glycoprotein ( e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. Antibodies may be neutralizing antibodies. The present disclosure includes antibody fragments (and/or polypeptides that comprise antibody fragments) that retain SARS-CoV-2 binding characteristics. Non-limiting examples of antibody fragments include antigen-binding regions and/or effector regions of the antibody, e.g., F(ab)2, F(ab')2, Fab, Fab', Fd, Fc, and Fv fragments (e.g., fragments consisting of the variable regions of the heavy and light chains that are non-covalently coupled), disulfide-linked Fvs (dsFv), or single-domain antibodies {e.g., nanobodies). In general terms, a variable (V) region domain may be any suitable arrangement of immunoglobulin heavy (VH) and/or light (VL) chain variable domains. For example, the present disclosure also includes tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, and an antibody heavy chain monomer. Thus, for example, the V region domain may be dimeric and contain VH-VH, VH-VL, or VL-VL dimers that bind SARS CoV-2, including a SARS CoV-2 spike glycoprotein or portion thereof (e.g., S1 domain, receptor binding domain). If desired, the VH and VL chains may be covalently coupled either directly or through a linker to form a single chain Fv (scFv). For ease of reference, scFv proteins are referred to herein as included in the category “antibody fragments.” Antibody fragments (e.g., single-chain antibodies or other binding domains) can exist alone or in combination with one or more of the following:
hinge region, CH1, CH2, CH3, or CH4 domains, J chain, or secretory component. Another form of an antibody fragment is a peptide comprising one or more complementarity determining regions (CDRs) of an antibody. CDRs (also termed "minimal recognition units" or "hypervariable region") can be obtained by constructing polynucleotides that encode the CDR of interest. Such polynucleotides are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA of antibody-producing cells as a template (see, for example, Larrick et al. , Methods: A Companion to Methods in Enzymology, 2:106 (1991); Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies," in Monoclonal Antibodies Production, Engineering and Clinical Application, Ritter et al. (eds.), page 166, Cambridge University Press (1995); and Ward et al., "Genetic Manipulation and Expression of Antibodies," in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), page 137, Wiley-Liss, Inc. (1995)). Antibody fragments may be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, variable domains of new antigen receptors (v-NAR), and bis-single chain Fv regions (see, e.g., Hollinger and Hudson, Nature Biotechnology, 23(9): 1126-1136, 2005). The binding agent, in some embodiments, contains a light chain and/or a heavy chain constant region, such as one or more constant regions, including one or more lgG1, lgG2, lgG3 and/or lgG4 constant regions. In some embodiments, antibodies can include epitope-binding fragments of any of the above. The antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., lgG1, lgG2, lgG3, lgG4, lgA1, and lgA2) of immunoglobulin molecule. Antibodies may be neutralizing antibodies.
[0026] The term "monospecific" antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen. The term "bispecific" means that the antibody is able to specifically bind to at least two distinct antigenic determinants, for example two binding sites each formed by a pair of an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL) binding to different antigens or to different epitopes on the same antigen. Such a bispecific antibody may have a 1+1 format. Other bispecific antibody formats may be 2+1 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding
sites for a second antigen or epitope). When a bispecific antibody comprises two antigen binding sites, each may bind to a different antigenic determinant. Such a bispecific antibody may bind to two different epitopes on the same antigen (e.g., epitopes on a SARS-CoV-2 spike glycoprotein).
[0027] The terms “identical” or percent “identity” in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity can be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that can be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variants thereof. In some embodiments, two nucleic acids or polypeptides are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection. In some embodiments, identity exists over a region of the amino acid sequences that is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues in length or any integral value there between. In some embodiments, identity exists over a longer region than 60- 80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a target protein or an antibody. In some embodiments, identity exists over a region of the nucleotide sequences that is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases in length or any integral value there between. In some embodiments, identity exists over a longer region than 60-80 bases, such as at least about 80-1000 bases or more, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as a nucleotide sequence encoding a protein of interest.
[0028] A “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a side chain with similar chemical characteristics. Families of amino acid residues having similar side chains have been generally defined in the art, including basic side chains ( e.g ., lysine, arginine, histidine), acidic side chains {e.g., aspartic acid, glutamic acid), uncharged polar side chains {e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains {e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains {e.g., threonine, valine, isoleucine) and aromatic side chains {e.g., tyrosine, phenylalanine, tryptophan, histidine). For example, substitution of a phenylalanine for a tyrosine is a conservative substitution. Generally, conservative substitutions in the sequences of the polypeptides, soluble proteins, and/or antibodies of the disclosure do not abrogate the binding of the polypeptide, soluble protein, or antibody containing the amino acid sequence, to the target binding site. Methods of identifying amino acid conservative substitutions which do not eliminate binding are well-known in the art. [0029] The terms “polypeptide” refers to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can include {e.g., be interrupted by) non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as linkage to or conjugation with (directly or indirectly) a moiety such as a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids), as well as other modifications known in the art. It is understood that, because the polypeptides of this disclosure can be based upon antibodies or other members of the immunoglobulin superfamily, in some embodiments, the polypeptides can occur as single chains.
[0030] As used herein, an “antigen” is a moiety or molecule that contains an epitope to which an antibody can bind. As such, an antigen is also is bound by an antibody. In some embodiments, the antigen, to which an antibody described herein binds is SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein), or a fragment thereof.
[0031] As used herein, an “epitope” is a term in the art and refers to a localized region of an antigen to which an antibody can bind. An epitope can be a linear epitope or a conformational, non-linear, or discontinuous, epitope. In the case of a polypeptide antigen, for example, an epitope can be contiguous amino acids of the polypeptide (a “linear” epitope) or an epitope can comprise amino acids from two or more non-contiguous regions of the polypeptide (a “conformational,” “non-linear” or “discontinuous” epitope), e.g., a SARS-CoV-2 spike glycoprotein. It will be appreciated by one of skill in the art that, in general, a linear epitope may or may not be dependent on secondary, tertiary, or quaternary structure. For example, in some embodiments, an antibody binds to a group of amino acids regardless of whether they are folded in a natural three dimensional protein structure. In other embodiments, an antibody requires amino acid residues making up the epitope to exhibit a particular conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
[0032] As used herein, the terms “specifically binds,” “specifically recognizes,” “immunospecifically binds,” “selectively binds,” “immunospecifically recognizes” and “immunospecific” are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., epitope) as such binding is understood by one skilled in the art. In some embodiments , “specifically binds” means, for instance that a polypeptide or molecule interacts more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to the epitope, protein, or target molecule than with alternative substances, including related and unrelated proteins. For example, a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, generally with lower affinity as determined by, e.g., immunoassays, Biacore™, KinExA 3000 instrument (Sapidyne Instruments, Boise, ID), or Bio-Layer Interferometry (BLI) assays, Gator™ instrument (Probe Life, Inc., Palo Alto, CA), or other assays known in the art. In some embodiments, an antibody or antigen binding domain binds to or specifically binds to an antigen when it binds to an antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs). Typically, a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed.,
2d ed. 1989) for a discussion regarding binding specificity. In some embodiments,
the extent of binding of an antibody or antigen binding domain to a “non-target” protein is less than about 10% of the binding of the antibody or antigen binding domain to its particular target antigen, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA. In some embodiments, molecules that specifically bind to an antigen bind to the antigen with a Ka that is at least 2 logs, 2.5 logs, 3 logs, 4 logs or greater than the Ka when the molecules bind to another antigen. In some embodiments, molecules that specifically bind to an antigen do not cross react with other proteins. In some embodiments “specifically binds” means, for instance, that a polypeptide or molecule binds a protein or target with a KD of about 0.1 mM or less, but more usually less than about 1mM. In some embodiments, “specifically binds” means that a polypeptide or molecule binds a target with a KD of at least about 0.1 mM or less, at least about 0.01 mM or less, or at least about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include a polypeptide or molecule that recognizes a protein or target in more than one species. Likewise, because of homology within certain regions of polypeptide sequences of different proteins, specific binding can include a polypeptide or molecule that recognizes more than one protein or target. It is understood that, in some embodiments, a polypeptide or molecule that specifically binds a first target may or may not specifically bind a second target. As such, “specific binding” does not necessarily require (although it can include) exclusive binding, e.g., binding to a single target. Thus, a polypeptide or molecule can, in some embodiments, specifically bind more than one target. In some embodiments, multiple targets can be bound by the same antigen-binding site on the polypeptide or molecule. For example, an antibody can, in certain instances, comprise two identical antigen-binding sites, each of which specifically binds the same epitope on two or more proteins. In certain alternative embodiments, an antibody can be bispecific and comprise at least two antigen-binding sites with differing specificities. Generally, but not necessarily, reference to “binding” means “specific binding”.
[0033] As used herein, the term “constant region” or “constant domain” is a well- known antibody term of art and refers to an antibody portion, e.g., for example, a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor. The term refers to a portion of an immunoglobulin molecule having a generally more conserved amino acid sequence
relative to an immunoglobulin variable domain. The term “Fc region” or “Fc domain” is used herein to refer to a portion of a constant region or one or more constant regions.
[0034] As used herein, the term “heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino- terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy-terminal portion includes one or more constant regions. The “heavy chain” can refer to any distinct types, e.g., for example, alpha (a), delta (d), epsilon (e), gamma (y) and mu (m), based on the amino acid sequence of the constant domain, which give rise to IgA, IgD, IgE, IgG and IgM classes of antibodies, respectively, including subclasses of IgG, e.g., lgG1, lgG2, lgG3 and lgG4.
[0035] As used herein, the term “light chain” when used in reference to an antibody can refer to a polypeptide chain of about 25 kDa, wherein the amino- terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy-terminal portion includes a constant region. The approximate length of a light chain is 211 to 217 amino acids. There are two distinct types, e.g., kappa (K) of lambda (l) based on the amino acid sequence of the constant domains. Light chain amino acid sequences are well known in the art. As used herein, an “isolated” or “purified” antibody or antigen binding fragment is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the antibody or antigen binding fragment is derived, or substantially free of chemical precursors or other chemicals when the antibody or antigen binding fragment is chemically synthesized.
[0036] As used herein, the term “secretory component” refers to a protein that specifically binds to J-chain-containing antibody, and is related to, derivable from, or identical to an extracellular portion of the polymeric immunoglobulin receptor (plgR), preferably a human plgR. Preferably, the secretory component confers increased stability to the J-chain containing immunoglobulin. During secretion, the secretory component can become associated with an antibody (e.g., dimeric or polymeric IgA or pentameric IgM) comprising a J chain. The secretory component may confer increased stability to the J-chain containing antibody.
[0037] As used herein, the term “J-chain” refers to J-chain polypeptide of about 15kDa of IgM or IgA antibodies of any animal species, including mature human J- chain. The amino acid sequence of mature human J-chain is well known in the art.
The J chain sequence may be modified, for example, to comprise a fragment or variant of the J chain native sequence or to comprise a heterologous moiety or peptide. The J chain may be a full-length native J chain, but may also contain amino acid alterations, such as substitutions, insertions, deletions, truncations, including J chain fragments. In some embodiments, the J-chain is modified to comprise a heterologous moiety or peptide. The heterologous moiety may be attached directly or indirectly (e.g., through a linker). In some embodiments, the J chain may comprise a moiety that is a binding domain. See, e.g., U.S. Patent Nos. 10,400,038 and 9,951 , 134. In some embodiments, the J chain may comprise a moiety that confers a desired characteristic to the antibody. For example, the J-chain may comprise a moiety that affects the absorption, distribution, metabolism, or excretion (ADME) characteristics of an antibody. See, e.g., U.S. Patent No. 10,618,978. In certain embodiments, the heterologous moiety does not affect polymerization of the antibody (e.g., pentamerization of IgM and dimerization of IgA) and binding of the antibody to a target.
[0038] The terms “antigen binding fragment,” “antigen binding domain,” “antigen binding region,” and similar terms refer to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding fragment, domain, or region its specificity and affinity for the antigen (e.g., the CDRs). “Antigen binding fragment” as used herein include “antibody fragment,” which comprise a portion of an intact antibody including one or more CDRs, such as the antigen binding or variable region of the intact antibody. Examples of antibody fragments include, without limitation, Fab, Fab’, F(ab’)2, and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger et al., Proc Natl Acad Sci 1993, 90:6444-48; Lu et al., J Biol Chem, 2005, 280:19665-72; Hudson et al., Nat Med, 2003, 9:129-34; WO 93/11161; and U.S. Pat. Nos. 5,837,242 and 6,492,123); single-chain antibody molecules (see, e.g., U.S. Pat. Nos. 4,946,778; 5,260,203; 5,482,858; and 5,476,786); dual variable domain antibodies (see, e.g., U.S. Pat. No. 7,612,181); single variable domain antibodies (sdAbs) (see, e.g., Woolven etal., Immunogenetics, 1999, 50: 98-101 ; and Streltsov et al., Proc Natl Acad Sci USA. 2004, 101:12444-49); and multispecific antibodies formed from antibody fragments. [0039] As used herein, the terms “antibody” and “immunoglobulin” and “Ig” are terms of art and can be used interchangeably herein and refer to a molecule with one or more antigen binding sites that bind an antigen.
[0040] In some embodiments, a SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein can bind to a SARS-CoV-2 spike glycoprotein ( e.g ., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein.
[0041] In some embodiments, an SARS-CoV-2 binding agent such as an agent that binds to a SARS-CoV-2 spike glycoprotein {e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. Such a SARS-CoV-2 binding agent includes an antibody, antibody fragment, or other peptide-based molecule.
Antibodies provided herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab’) fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-ld) antibodies, and epitope binding fragments of any of the above.
[0042] In some embodiments, antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, including molecules that contain one or more antigen binding sites that bind to a SARS-CoV-2 antigen.
[0043] Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA or IgY), any class, (e.g., lgG1, lgG2, lgG3, lgG4, lgA1 or lgA2), or any subclass (e.g., lgG2a or lgG2b) of immunoglobulin molecule. Antibodies may be neutralizing antibodies. In some embodiments, antibodies described herein are IgG antibodies (e.g., human IgG), or a class (e.g., human lgG1 , lgG2, lgG3 or lgG4) or subclass thereof. In some embodiments, antibodies described herein are IgA antibodies (e.g., human IgA), or a class (e.g., human lgA1 or lgA2) or subclass thereof. Antibody classes and subclasses, including lgG1, lgG2, lgG3, lgG4, lgA1, lgA2, are well known in the art and are known to confer functional specialization. Modified versions of each of these classes and subclasses may be prepared by those skilled in the art. In some embodiments, antibodies are hybrid antibodies with properties of more than one class or subclass of antibody. Methods for making hybrid antibodies (e.g., IgA/lgG and IgM/lgG) are known in the art. Antibodies include those of all isotypes, sub-
classes and forms, including their fragments, for example, SARS-CoV-2 binding fragments. An antibody can include a J-chain and/or a secretory component. Antibodies may be modified to include sequences from other isotypes, such as IgG to produce chimeric antibodies. An antibody encompasses anything ranging from a small binding fragment of an antibody to a full sized antibody, including a multimeric antibody, for example, an IgA antibody that includes four complete heavy chains and four complete light chains and optionally includes a J chain and/or a secretory component, or an IgM antibody that includes ten or twelve complete heavy chains and ten or twelve complete light chains and, optionally, includes a J-chain and/or a secretory component.
[0044] In some embodiments, an antibody is a 4-chain antibody unit comprising two heavy (H) chain / light (L) chain pairs, wherein the amino acid sequences of the H chains are identical and the amino acid sequences of the L chains are identical. In some embodiments, the H and L chains comprise constant regions, for example, human constant regions. In some embodiments, the L chain constant region of such antibodies is a kappa or lambda light chain constant region, for example, a human kappa or lambda light chain constant region. In some embodiments, the H chain constant region of such antibodies comprise a gamma heavy chain constant region, for example, a human gamma heavy chain constant region. In some embodiments, such antibodies comprise IgG constant regions, for example, human IgG constant regions ( e.g lgG1, lgG2, lgG3, and/or lgG4 constant regions).
[0045] An antibody or fragment thereof may preferentially bind to SARS-CoV-2 meaning that the antibody or fragment thereof binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein and/or binds SARS-CoV-2 with greater affinity than it binds to an unrelated control protein. For example, the antibody or fragment thereof may specifically recognize and bind a SARS-CoV-2 spike glycoprotein or a portion thereof. “Specific binding” means that the antibody or fragment thereof binds to SARS-CoV-2 with an affinity that is at least 5, 10, 15, 20, 25, 50, 100, 250, 500, 1000, or 10,000 times greater than the affinity for an unrelated control protein (e.g., hen egg white lysozyme). In some embodiments, the antibody or fragment thereof may bind SARS-CoV-2 substantially exclusively (e.g., is able to distinguish SARS-CoV-2 from other known polypeptides such other SARS-CoV-2, for example, by virtue of measurable differences in binding affinity). The term “hypervariable region”, “HVR”, or “HV”, when used herein refers to the regions of an
antibody variable region that are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six hypervariable regions; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3). A number of hypervariable region delineations are in use and are encompassed herein. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (see, e.g., Kabat etal., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The end of the Chothia CDR- H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag). The “contact” hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions or CDRs are noted below.
[0046] A universal numbering system has been developed and widely adopted, ImMunoGeneTics (IMGT) Information System® (Lefranc etal., Dev. Comp. Immunol. 27(1 ):55-77 (2003)). IMGT is an integrated information system specializing in immunoglobulins (IG), T cell receptors (TR) and major histocompatibility complex (MHC) of human and other vertebrates. Herein, the CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain. As the “location” of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues and are readily identified. This information can be used in grafting and replacement of CDR residues from immunoglobulins of one species into an acceptor framework from, typically, a human antibody. An additional numbering system (AHon) has been developed by Honegger and Pltickthun, J. Mol. Biol. 309: 657-670 (2001). Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT
unique numbering system, is well known to one skilled in the art (see, e.g., Kabat, supra ; Chothia and Lesk, supra ; Martin, supra ; Lefranc etai, supra) and is also illustrated below. An Exemplary system, shown herein, combines Kabat and Chothia.
[0047] Hypervariable regions may comprise “extended hypervariable regions” as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 or 26-35A (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH. As used herein, the terms “HVR” and “CDR” are used interchangeably. [0048] In some embodiments, a SARS-CoV-2 binding agent ( e.g ., antibody), including an agent {e.g., antibody) that binds to a SARS-CoV-2 spike glycoprotein, comprises a VH region which comprises VH CDR1 , VH CDR2, and/or VH CDR3, and a VL region which comprises VL CDR1 , VL CDR2, and/or VL CDR3 of any one of the binding agents described herein (see, e.g., Tables 1-8). In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody), including an agent (e.g., antibody) that binds to a SARS-CoV-2 spike glycoprotein, comprises a VH region and/or a VL region, wherein the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, the SARS-CoV-2 binding agent (e.g., antibody) provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8. In some embodiments, the SARS-CoV-2 binding agent (e.g., antibody) provided herein is bispecific and comprises a first binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from Tables 1-8 and a second binding site that comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from another antibody, including, for example, another antibody that binds to SARS-CoV-2 and/or SARS-CoV-1.
Table 1 : Antibody Clone B (AvGn-B)
[0049] In some embodiments, SARS-CoV-2 binding agents ( e.g ., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VH region or VH domain. In other embodiments, SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise a VL region or VL chain. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein have a combination of (i) a VH domain or VH region and (ii) a VL domain or VL region.
[0050] In some embodiments, the CDRs disclosed herein include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-8). As described herein, a “consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and/or variable amino acids that vary within a given amino acid sequence. The CDR consensus sequences provided include CDRs corresponding to VH CDR1, VH CDR2, VH CDR3, VL CDR1 , VL CDR2 and/or VL CDR3. Consensus sequences of CDRs of SARS-CoV-2 binding agents, including an agent that binds to a SARS-CoV-2 spike glycoprotein, are shown in FIGS. 11A and 11 B. Accordingly, in some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region and/pr (b) a light chain variable (VL) region, wherein the VH region comprises a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; and/or (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino
acid. In some embodiments, a SARS-CoV-2 binding agent ( e.g ., antibody) described herein comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein X-i, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, a SARS-CoV-2 binding agent {e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, a SARS- CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; (2) a VL CDR2 having the amino acid sequence of XiAX2SRAT (SEQ ID NO:111) wherein Xi and X2 are each independently a naturally occurring amino acid; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each
independently a naturally occurring amino acid. In some embodiments, the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, the VL CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO: 110) wherein Xi is a naturally occurring amino acid. In some embodiments, the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of Xi AX2SRAT (SEQ ID NO: 111) wherein Xi and X2 are each independently a naturally occurring amino acid. In some embodiments, the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid. In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X2 A, I, L orV, and X3 is Q or R; and/or (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:115) wherein Xi is S, G or D; and/or (2) a VL CDR2 having the amino acid sequence of Xi AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S or T; and/or (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F. In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X2 A, I, L orV, and X3 is Q or R; and (3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, a SARS-CoV-2 binding agent (e.g., antibody) described herein comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX-iTYLA (SEQ ID NO:115) wherein Xi is S, G or D; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S orT;
and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F. In some embodiments, a SARS-CoV-2 binding agent ( e.g ., antibody) described herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; (2) a VFI CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R orV, X2 A, I, L orV, and X3 is Q or R; and (3) a VFI CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D; (2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 116) wherein Xi is S, G or D, and X2 is S orT; and (3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F. In some embodiments, the VH CDR1 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H. In some embodiments, the VH CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R. In some embodiments, the VH CDR3 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3). In some embodiments, the VL CDR1 of a SARS- CoV-2 binding agent described herein has the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D. In some embodiments, the VL CDR2 of a SARS-CoV-2 binding agent described herein has the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T. In some embodiments, the VL CDR3 of SARS-CoV-2 binding agent described herein has the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
[0051] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six CDRs, for example, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 identified in Tables 1-8. In some embodiments, SARS-CoV-2 binding agents {e.g.,
antibodies, including bispecific antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, provided herein comprise a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
[0052] In some embodiments, SARS-CoV-2 binding agents ( e.g ., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8. In other embodiments, SARS-CoV-2 binding agents {e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six CDRs, VL CDRs listed in Tables 1-8. In yet other embodiments, SARS-CoV-2 binding agents (e.g., antibodies, including bispecific antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein comprise one or more CDRs, including six VH CDRs listed in Tables 1-8 and one or more CDRs, including six VL CDRs listed in Tables 1-8.
[0053] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58- 64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32- 48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises four or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises five or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a
group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises six or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105.
[0054] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24. In some embodiments, the SARS- CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1-3, 7-9, 12-15, 18-20, and 24 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4-6, 10-11, 16-17, and 21-23.
[0055] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[0056] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0057] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18; and/or (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable region (VL) comprising
(i) a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21; and/or
(ii) a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22; and/or (iii) a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0058] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of
SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0059] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0060] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0061] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11 ; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[0062] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b)
a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[0063] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0064] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:1, 7, 12, 13, and 18; (ii) a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:2, 8, 14, 19, and 24; and/or (iii) a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20; and (b) a light chain variable region (VL) comprising (i) a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21; (ii) a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:5, 11 , and 22; and (iii) a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0065] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid
sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0066] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO: 11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:7; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:8; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:9; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 10; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11 ; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0067] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid
sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 12; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:2; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0068] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 13; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 14; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO: 16; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:11; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO: 17.
[0069] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino
acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent (. e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO: 18; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO: 19; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:20; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:21 ; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:22; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:23.
[0070] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable region (VH) comprising (i) a VH CDR1 comprising an amino acid sequence of SEQ ID NO:1 ; (ii) a VH CDR2 comprising an amino acid sequence of SEQ ID NO:24; and (iii) a VH CDR3 comprising an amino acid sequence of SEQ ID NO:3; and (b) a light chain variable region (VL) comprising (i) a VL CDR1 comprising an amino acid sequence of SEQ ID NO:4; (ii) a VL CDR2 comprising an amino acid sequence of SEQ ID NO:5; and (iii) a VL CDR3 comprising an amino acid sequence of SEQ ID NO:6.
[0071] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:25 and/or a VL comprising an amino acid sequence of SEQ ID NO:26. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising
an amino acid sequence of SEQ ID NO:25 and a VL comprising an amino acid sequence of SEQ ID NO:26.
[0072] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35,
36, 39, 40, 42, 43, 45, 46, and 47. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 32, 33, 37, 38, 41, 44, and 48 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:34, 35, 36, 39, 40, 42, 43, 45, 46, and 47.
[0073] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 32, 37, and 41. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 33, 38, 44, and 48. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[0074] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:34, 39, 42, and 45. In some embodiments, the
SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:36, 43, and 47.
[0075] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
[0076] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0077] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid
sequence of SEQ ID NO:39; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0078] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0079] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
[0080] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
[0081] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48;
and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0082] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
[0083] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0084] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0085] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0086] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
[0087] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
[0088] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a
VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
[0089] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and/or a VL comprising an amino acid sequence of SEQ ID NO:50. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:49 and a VL comprising an amino acid sequence of SEQ ID NO:50.
[0090] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 38, 44, 48, and 51 and a light chain variable region (VL) comprising one or more VL complementarity
determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
[0091] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 38, 44, 48, and 51. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[0092] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[0093] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group
consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [0094] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0095] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0096] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[0097] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b)
a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[0098] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[0099] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00100] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 38,
44, 48, and 51 ; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00101] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00102] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00103] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00104] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00105] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a
VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00106] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00107] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:56 and/or a VL comprising an amino acid sequence of SEQ ID NO:57. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising
an amino acid sequence of SEQ ID NO:56 and a VL comprising an amino acid sequence of SEQ ID NO:57.
[00108] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 12, 14, 15, 18, 20, 58, 59, 60, 61, 62, 63, and 64 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 35, 40, 46, 52, 53, 54, and 55.
[00109] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 12, 18, 58, 60, and 62. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 59, 61, 63, and 64. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00110] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the
SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[00111] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [00112] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00113] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid
sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00114] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00115] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[00116] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00117] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64;
and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00118] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61, 63, and 64; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00119] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00120] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00121] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00122] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00123] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00124] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a
VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00125] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and/or a VL comprising an amino acid sequence of SEQ ID NO:57. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:65 and a VL comprising an amino acid sequence of SEQ ID NO:57.
[00126] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53,
54, 55, 67, 68, 70, 71, 73, and 74. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 66, 69, 72, and 75 and a light chain variable region (VL) comprising one or more VL complementarity
determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:52, 53, 54, 55, 67, 68, 70, 71, 73, and 74.
[00127] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00128] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:67, 70, and 73. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a selected from a group consisting group consisting of SEQ ID NO:68, 71, and 74.
[00129] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71 , and 74. [00130] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00131] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00132] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00133] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14;
and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
[00134] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
[00135] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00136] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 66,
69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70,
and 73; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71 , and 74.
[00137] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00138] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00139] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00140] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
[00141] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
[00142] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
[00143] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and/or a VL comprising an amino acid sequence of SEQ ID NO:77. In some embodiments, the SARS-CoV-2 binding agent {e.g., an
antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:76 and a VL comprising an amino acid sequence of SEQ ID NO:77.
[00144] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21, 23, 35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 66, 69, 72, 75, 78, 79, 80, 81, and 82 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 6, 10, 16, 17, 21 , 23, 35, 40, and 46.
[00145] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:78, 79, 80, 81 , and 82. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 66, 69, 72 and 75. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15 and 20.
[00146] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from
a group consisting of SEQ ID NO:4, 10, 16, and 21. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[00147] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00148] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00149] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b)
a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00150] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00151] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[00152] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00153] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID
NO:78; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00154] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81 , and 82; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00155] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00156] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00157] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00158] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00159] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00160] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a
VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00161] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and/or a VL comprising an amino acid sequence of SEQ ID NO:84. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:83 and a VL comprising an amino acid sequence of SEQ ID NO:84.
[00162] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:3, 9, 14, 15, 20, 85, 86, 88, 89, 91, 92, 93, 94, and 96 and a light chain variable region (VL) comprising one or more VL complementarity
determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:6, 17, 23, 52, 53, 54, 55, 87, 90, and 95.
[00163] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:85, 88, 91 , 92, and 93. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 14, 86, 89, 94, and 96. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00164] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:52, 53, 54, and 55. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:87, 90, and 95. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:6, 17, and 23.
[00165] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or (2) a VL CDR2 having an amino acid sequence selected from the group
consisting of SEQ ID NO:87, 90, and 95; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23. [00166] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00167] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00168] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00169] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b)
a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
[00170] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00171] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00172] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
[00173] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00174] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00175] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00176] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 17.
[00177] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a
VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
[00178] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
[00179] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO:97 and/or a VL comprising an amino acid sequence of SEQ ID NO:98. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising
an amino acid sequence of SEQ ID NO:97 and a VL comprising an amino acid sequence of SEQ ID NO:98.
[00180] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 1 , 3, 7, 9, 12, 13, 14, 15, 18, 20, 99, 101, 103, and 105 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:4, 10, 16, 21, 35, 40, 46, 100, 102, and 104.
[00181] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 1, 7, 12, 13, and 18. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 14, 99, 101, 103, and 105. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:3, 9, 15, and 20.
[00182] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity
determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:4, 10, 16, and 21. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:35, 40, and 46. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 100, 102, and 104. [00183] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101 , 103, and 105; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104. [00184] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00185] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101 ;
and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00186] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00187] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
[00188] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
[00189] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
[00190] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:14, 99, 101 , 103, and 105; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
[00191] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of
SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00192] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 101 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00193] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00194] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 102.
[00195] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
[00196] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable
(VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 1 ; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 100.
[00197] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and/or a VL comprising an amino acid sequence of SEQ ID NO: 107. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 106 and a VL comprising an amino acid sequence of SEQ ID NO: 107.
[00198] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:118, 119, 120, 124, 125, 126, 129, 130, 131 , 132, 135, 136, 137, and 141. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid
sequence selected from a group consisting of SEQ ID NOS: 118, 119, 120, 124, 125, 126, 129, 130, 131, 132, 135, 136, 137, and 141 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:121 , 122, 123, 127, 128, 133, 134, 138, 139, and 140.
[00199] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 118, 124, 129, 130, and 135. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 119, 125, 131, 136, and 141. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:120, 126, 132, and 137.
[00200] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 121, 127, 133, and 138. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 122, 128, and 139. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 123, 134, and 140. [00201] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:119, 125, 131, 136, and 141; and/or (3) a VH CDR3 having an amino
acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
[00202] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00203] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 126; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00204] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00205] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 130; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
[00206] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 135; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 137; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140.
[00207] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 120; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123.
[00208] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131 , 136, and 141 ; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126,
132, and 137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121 , 127, 133, and 138; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
[00209] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00210] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID
NO: 124; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00211] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00212] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID
NO:130; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 132; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
[00213] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 140. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:135; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:136; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
[00214] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 123. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID
NO: 118; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
[00215] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and/or a VL comprising an amino acid sequence of SEQ ID NO: 143. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 142 and a VL comprising an amino acid sequence of SEQ ID NO: 143.
[00216] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a heavy chain variable region (VH) comprising one or more VH complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS: 144, 145, 146, 150, 151, 152, 154, 155, 156, 157, 160, 161, 162, and 166 and a light chain variable region (VL) comprising one or more VL complementarity determining regions (CDRs) comprising an amino acid sequence selected from a group consisting of SEQ ID NOS:90, 147, 148, 149, 153, 158, 159, 163, 164, and 165.
[00217] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 1 (VH CDR1) comprising an amino acid sequence selected from
a group consisting of SEQ ID NO: 144, 150, 154, 155, and 160. In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 2 (VH CDR2) comprising an amino acid sequence selected from a group consisting selected from a group consisting of SEQ ID NO: 145, 151 , 156, 161 , and 166. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH complementarity determining region 3 (VH CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 146, 152, 157, and 162.
[00218] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 1 (VL CDR1) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 147, 153, 158, and 163. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 2 (VL CDR2) comprising an amino acid sequence selected from a group consisting of SEQ ID NO:90, 148, and 164. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VL complementarity determining region 3 (VL CDR3) comprising an amino acid sequence selected from a group consisting of SEQ ID NO: 149, 159, and 165. [00219] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and/or (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and/or (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
[00220] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
[00221] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 150; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 151 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00222] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 154; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
[00223] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 157; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; and/or (2) a VL CDR2 having the amino acid
sequence of SEQ ID NO:90; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
[00224] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 160; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 162; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165.
[00225] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and/or (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or (b) a light chain variable (VL) region comprising: (1 ) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; and/or (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149.
[00226] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:145, 151 , 156, 161 , and 166; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
[00227] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00228] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:150; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 152; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00229] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:154; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:145; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00230] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 159. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
[00231] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 165. In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:160; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:161 ; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
[00232] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and/or (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 149. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises (a) a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having the amino acid sequence of SEQ ID NO:144; (2) a VH CDR2 having the amino acid sequence of SEQ ID NO:166; and (3) a VH CDR3 having the amino acid sequence of SEQ ID NO:146; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147; (2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and (3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
[00233] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and/or a VL comprising an amino acid sequence of SEQ ID NO: 168. In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises a VH comprising an amino acid sequence of SEQ ID NO: 167 and a VL comprising an amino acid sequence of SEQ ID NO:168.
[00234] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and a light chain variable region having an amino acid sequence of SEQ ID NO:77; (vi) a heavy chain variable region having an amino acid sequence of SEQ ID NO:83 and a light chain variable region having an amino acid sequence of SEQ ID NO:84; (vii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:97 and a light chain variable region having an amino acid sequence of SEQ ID NO:98; and/or (viii) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 106 and a light chain variable region having an amino acid sequence of SEQ ID NO: 107; and/or (B)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and a light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (C)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:167 and a light chain variable region having an amino acid sequence of SEQ ID NO:168.
[00235] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that competes for binding to SARS-CoV-2 with the antibody comprising: (i)
the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO:167 and the light chain variable region having an amino acid sequence of SEQ ID NO: 168.
[00236] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 107; (ix) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 142, and/or a VL CDR1 , a VL CDR2, and a VL
CDR3 as set forth in SEQ ID NO: 143; or (x) a VH CDR1 , a VH CDR2, and a VH
CDR3 as set forth in SEQ ID NO: 167, and/or a VL CDR1 , a VL CDR2, and a VL
CDR3 as set forth in SEQ ID NO: 168.
[00237] In some embodiments, the SARS-CoV-2 binding agent (e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49,
and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; or (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:107.
[00238] In some embodiments, the SARS-CoV-2 binding agent ( e.g ., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143.
[00239] In some embodiments, the SARS-CoV-2 binding agent {e.g., an antibody, including a bispecific antibody) provided herein comprises an antibody or fragment thereof that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
[00240] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies), including SARS-CoV-2 binding agents, are provided that compete with one of the exemplified SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein. Such binding agents may also bind to the same or essentially the same epitope as one of the herein exemplified SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, or an overlapping epitope. SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS- CoV-2 spike glycoprotein, that compete with or bind to the same or essentially the same epitope as the exemplified SARS-CoV-2 binding agents are expected to show similar functional properties. The exemplified SARS-CoV-2 binding agents (e.g., antibodies) include those with the VH and VL regions, and CDRs provided herein
(see, e.g., Tables 1-8). Thus, as a specific example, the SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, that are provided include those that compete with an antibody comprising: (a) 1, 2, 3, 4, 5 or all 6 of the VH and VL CDRs identified in Tables 1-8; (b) a VH and a VL identified in Tables 1-8; or (c) two light chains each comprising a VL and two heavy chains each comprising a VH, including the VL and VH identified in Tables 1-8.
[00241] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the Kabat system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
[00242] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the Chothia system, which will be referred to herein as the “Chothia CDRs” (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al- Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1): 175-82; and U.S.
Patent No. 7,709,226).
[00243] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the ImMunoGeneTics (IMGT) system, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7:132-136 and Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27:209-212 (“IMGT CDRs”).
[00244] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be determined according to the AbM system, which will be referred to herein as the “AbM CDRs,” for example as described in MacCallum et al., 1996, J. Mol. Biol., 262:732-745. See also, e.g., Martin, A., “Protein Sequence and Structure Analysis of Antibody Variable Domains,” in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001).
[00245] In certain aspects, the CDRs of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, can be
determined according to the Contact system, which will be referred to herein as the “Contact CDRs” (see, e.g., MacCallum RM et al. , 1996, J Mol Biol 5: 732-745). The Contact CDRs are based on an analysis of the available complex crystal structures. [00246] In some embodiments, the position of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1 , CDR2, or CDR3) region of a SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary by one, two, three, four, five, or six amino acid positions so long as binding to SARS-CoV-2 (e.g., a SARS- CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). For example, in some embodiments, the position defining a CDR as identified in Tables 1-8 may vary by shifting the N-terminal and/or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the current CDR position, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the length of one or more CDRs along the VH (e.g., CDR1 , CDR2, or CDR3) and/or VL (e.g., CDR1, CDR2, or CDR3) region of an SARS-CoV-2 binding agent (e.g., an antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, described herein may vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). For example, in some embodiments, a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, a VH and/or VL CDR1, CDR2, and/or CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99- 105, so long as binding to SARS-CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%,
at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78- 82, 85-96 and 99-105, so long as binding to SARS-CoV-2 ( e.g ., a SARS-CoV-2 spike glycoprotein) is maintained {e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51- 55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In other embodiments, the amino terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained {e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). In some embodiments, the carboxy terminus of a VH and/or VL CDR1 , CDR2, and/or CDR3 described herein may be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described by SEQ ID NOS: 1-24, 32-48, 51-55, 58-64, 66-75, 78-82, 85-96 and 99-105, so long as binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained {e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%). Any method known in the art can be used to ascertain whether binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) is maintained, for example, the binding assays and conditions described in the Examples provided herein. For example, Examples 1 and 2 provided herein describe assays for measuring binding to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein).
[00247] In other embodiments, the SARS-CoV-2 binding agents (e.g., antibodies), including an agent that binds to a SARS-CoV-2 spike glycoprotein, presented herein that bind to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein) comprise
conservative sequence modifications as described herein. With respect to polypeptides that are SARS-CoV-2 binding agents ( e.g ., antibodies), including agents that binds to a SARS-CoV-2 spike glycoprotein, conservative sequence modifications include conservative amino acid substitutions that include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains {e.g., aspartic acid, glutamic acid), uncharged polar side chains {e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains {e.g., threonine, valine, isoleucine) and aromatic side chains {e.g., tyrosine, phenylalanine, tryptophan, histidine). In some embodiments, a predicted nonessential amino acid residue is replaced with another amino acid residue from the same side chain family. Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art {see, e.g., Brummell et al. , Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)). In some embodiments, the conservative sequence modifications described herein modify the amino acid sequences of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, by 50%, or 55%, or 60%, or 65%, or 70%, or 75%, or 80%, or 85%, or 90%, or 95%, or 98%, or 99%. In some embodiments, the nucleotide and amino acid sequence modifications refer to at most 1 , 2, 3, 4, 5, or 6 amino acid substitutions to the CDRs described in Tables 1-8. Thus, for example, each such CDR may contain up to 5 conservative amino acid substitutions, for example up to (not more than) 4 conservative amino acid substitutions, for example up to (not more than) 3 conservative amino acid substitutions, for example up to (not more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution.
[00248] The present disclosure also provides conjugates, including immunoconjugates comprising any one of the SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD), of the present disclosure, including those directly or indirectly linked another agent. For example,
SARS-CoV-2 binding agents ( e.g ., antibodies), such agents that bind to a SARS- CoV-2 spike glycoprotein or a fragment thereof {e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD), of the present disclosure may be covalently bound by a synthetic linker to one or more agents.
[00249] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, described herein which bind to SARS-CoV-2 {e.g., a SARS-CoV-2 spike glycoprotein), may be linked or conjugated (directly or indirectly) to a polypeptide. In some embodiments, an SARS-CoV-2 binding agent (e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, is linked or conjugated (directly or indirectly) to an agent.
[00250] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein are conjugated or recombinantly linked (directly or indirectly) to a therapeutic agent or to a diagnostic or detectable agent. The conjugated or recombinantly linked antibodies can be useful, for example, for treating or preventing a disease or disorder such as an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition. The conjugated or recombinantly linked SARS-CoV-2 binding agents (e.g., antibodies) can be useful, for example, for monitoring or prognosing the onset, development, progression, and/or severity of an SARS-CoV-2 mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
[00251] Such diagnosis and detection can be accomplished, for example, by coupling the SARS-CoV-2 binding agent (e.g., an antibody) to detectable substances including, for example: enzymes, including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, including, but not limited to, streptavidin/biotin or avidin/biotin; fluorescent materials, including, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; luminescent materials, including, but not limited to, luminol; bioluminescent materials, including, but not limited to, luciferase, luciferin, or aequorin; chemiluminescent material, including, but not limited to, an acridinium based compound or a HALOTAG; radioactive materials, including, but not limited to, iodine (1311, 1251, 1231, and 1211), carbon (14C), sulfur (35S), tritium (3H), indium
(1151h, 1131h, 1121h, and 1111h), technetium (99Tc), thallium (201 Ti), gallium (68Ga and 67Ga), palladium (103Pd), molybdenum (99Mo), xenon (133Xe), fluorine (18F), 153Sm, 177Lu, 159Gd, 149Pm, 140La, 175Yb, 166Ho, 90Y, 47Sc, 186Re, 188Re, 142Pr, 105Rh, 97Ru, 68Ge, 57Co, 65Zn, 85Sr, 32P, 153Gd, 169Yb, 51 Cr, 54Mn, 75Se, 113Sn, or 117Sn; positron emitting metals using various positron emission tomographies; and non-radioactive paramagnetic metal ions.
[00252] Also provided herein are SARS-CoV-2 binding agents ( e.g ., antibodies) that are recombinantly linked or conjugated (covalent or non-covalent conjugations, directly or indirectly) to a heterologous protein or polypeptide (or fragment thereof, for example, to a polypeptide {e.g., of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids) to generate fusion proteins, as well as uses thereof. In particular, provided herein are fusion proteins comprising an antigen-binding fragment of SARS-CoV-2 binding agents (e.g., an antibody), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein (e.g., comprising CDR1 , CDR2, and/or CDR3 of VH and/or VL) and a heterologous protein, polypeptide, or peptide. In some embodiments, the heterologous protein, polypeptide, or peptide that the SARS-CoV-2 binding agent (e.g., antibody) is linked to is useful for targeting the SARS-CoV-2 binding agent to a particular cell.
[00253] Moreover, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein can be linked (directly or indirectly) to marker or “tag” sequences, such as a peptide, to facilitate purification. In some embodiments, the marker or tag amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (see, e.g., QIAGEN, Inc.), among others, many of which are commercially available. For example, as described in Gentz et al., 1989, Proc. Natl. Acad. Sci. USA 86:821-24, hexa-histidine provides for convenient purification of a fusion protein. Other peptide tags useful for purification include, but are not limited to, the hemagglutinin (‘ΉA”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767-78), and the “FLAG” tag.
[00254] Fusion proteins may be generated, for example, through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”). DNA shuffling may be employed to alter the activities of the SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2
spike glycoprotein, as provided herein, including, for example, SARS-CoV-2 binding agents with higher affinities and lower dissociation rates (see, e.g., U.S. Pat. Nos. 5,605,793; 5,811,238; 5,830,721; 5,834,252; and 5,837,458; Patten etal., 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol. 16(2):76- 82; Hansson etal., 1999, J. Mol. Biol. 287:265-76; and Lorenzo and Blasco, 1998, Biotechniques 24(2):308-13). In some embodiments, SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination. One or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., antibody) provided herein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
[00255] SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein can also be linked or conjugated (directly or indirectly) to a second antibody to form an antibody heteroconjugate (see, e.g., U.S. Pat. No. 4,676,980).
[00256] SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein may also be attached to solid supports, which are useful for immunoassays or purification of the target antigen. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene.
[00257] The linker may be a “cleavable linker” facilitating release of the linked or conjugated agent in a cell, but non-cleavable linkers are also contemplated herein. Linkers for use in conjugates of the present disclosure include, without limitation, acid labile linkers (e.g., hydrazone linkers), disulfide-containing linkers, peptidase- sensitive linkers (e.g., peptide linkers comprising amino acids, for example, valine and/or citrulline such as citrulline-valine or phenylalanine-lysine), photolabile linkers, dimethyl linkers (see, e.g., Chari etai, 1992, Cancer Res. 52:127-31; and U.S. Pat. No. 5,208,020), thioether linkers, or hydrophilic linkers designed to evade multidrug transporter-mediated resistance (see, e.g., Kovtun etai, 2010, Cancer Res. 70:2528-37).
[00258] Conjugates of an antibody and agent may be made using a variety of bifunctional protein coupling agents such as BMPS, EMCS, GMBS, HBVS, LC- SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-
GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate). The present disclosure further contemplates that conjugates of antibodies and agents may be prepared using any suitable methods as disclosed in the art (see, e.g., Bioconjugate Techniques (Hermanson ed., 2d ed. 2008)).
[00259] Conventional conjugation strategies for antibodies and agents have been based on random conjugation chemistries involving the e-amino group of Lys residues or the thiol group of Cys residues, which results in heterogeneous conjugates. Recently developed techniques allow site-specific conjugation to antibodies, resulting in homogeneous loading and avoiding conjugate subpopulations with altered antigen-binding or pharmacokinetics. These include engineering of “thiomabs” comprising cysteine substitutions at positions on the heavy and light chains that provide reactive thiol groups and do not disrupt immunoglobulin folding and assembly or alter antigen binding (see, e.g., Junutula et at., 2008, J. Immunol. Meth. 332: 41-52; and Junutula etai, 2008, Nature Biotechnol. 26:925- 32). In another method, selenocysteine is cotranslationally inserted into an antibody sequence by recoding the stop codon UGA from termination to selenocysteine insertion, allowing site specific covalent conjugation at the nucleophilic selenol group of selenocysteine in the presence of the other natural amino acids (see, e.g., Hofer etai, 2008, Proc. Natl. Acad. Sci. USA 105:12451-56; and Hofer et a/., 2009, Biochemistry 48(50): 12047-57).
[00260] SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein, provided herein may be monospecific, bispecific, trispecific or of greater multispecificity. Such agents may include antibodies. Multispecific antibodies such as bispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens (e.g., SARS-CoV-2 and SARS-CoV-1) or two different epitopes on the same antigen (e.g., a SARS-CoV-2 spike glycoprotein). In some embodiments, the multispecific antibodies can be constructed based on the sequences of the antibodies provided herein, e.g., the CDR sequences listed in Tables 1-8. In some embodiments, the multispecific antibodies provided herein are bispecific antibodies. In some embodiments, bispecific antibodies are mouse, chimeric, human or humanized antibodies. In some embodiments, multispecific antibody molecules can comprise more than one antigen-binding site, in which different sites are specific for different antigens. In
some embodiments, multispecific antibody molecules can bind more than one ( e.g ., two or more) epitopes on the same antigen. In some embodiments, one of the binding specificities is for SARS-CoV-2 and the other is for any other antigen {e.g., SARS-CoV-1). Bispecific antibodies can be prepared in various antibody formats, including as full length antibodies or antibody fragments {e.g., F(ab’)2 bispecific antibodies).
[00261] Methods for making multispecific antibodies are known in the art, such as, by co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (see, e.g., Milstein and Cuello, 1983, Nature 305:537-40). For further details of generating multispecific antibodies (e.g., bispecific antibodies), see, for example, Bispecific Antibodies (Kontermann ed., 2011 ).
[00262] Exemplary structures of multispecific antibodies are known in the art and are further described in Weidle et a!., 2013, Cancer Genom ics & Proteom ics 10: 1- 18; Brinkman etal., 2017, MABS, 9:2, 182-212; Godar etal., 2018, Expert Opinion on Therapeutic Patents, 28:3, 251-276; and Spiess etai, 2015, Mol. Immunol. 67 95-106.
[00263] For example, bispecific antibody molecules can be classified into different structural groups: (i) bispecific immunoglobulin G (BslgG); (ii) IgG appended with an additional antigen-binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates. As a non-limiting example, BslgG formats can include crossMab, DAF (two-in-one), DAF (four-in-one),
DutaMab, DT-lgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair, Fab-arm exchange, SEEDbody, triomab, LUZ-Y, Fcab, kl-body, orthogonal Fab.
[00264] In some embodiments, BslgG comprises heavy chains that are engineered for heterodimerization. For example, heavy chains can be engineered for heterodimerization using a "knobs-into-holes" strategy, a SEED platform, a common heavy chain (e.g., in kl-bodies), and use of heterodimeric Fc regions. Strategies are known in the art to avoid heavy chain pairing of homodimers in BslgG, including knobs-into-holes, duobody, azymetric, charge pair, FIA-TF, SEEDbody, and differential protein A affinity.
[00265] Another bispecific antibody format is IgG appended with an additional antigen-binding moiety. For example, monospecific IgG can be engineered to have
bispecificity by appending an additional antigen-binding unit onto the monospecific IgG, e.g., at the N- or C- terminus of either the heavy or light chain. Exemplary additional antigen-binding units include single domain antibodies {e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable domains {e.g., single chain variable fragments or variable fragments). Non-limiting examples of appended IgG formats include dual variable domain IgG (DVD-lg), lgG(H)-scFv, scFv-(H)lgG, lgG(L)-scFv, scFv-(L)lgG, lgG(L,H)-Fv, lgG(H)-V, V(H)-lgG, lgG(L)-V, V(L)-lgG, KIH IgG-scFab, 2scFv-lgG, lgG-2scFv, scFv4-lg, zybody, and DVI-lgG (four- in-one). See, Spiess et al. Mol. Immunol. 67(2015):95-106.
[00266] Bispecific antibody fragments (BsAb) are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region. In embodiments, bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell. Non-limiting examples of bispecific antibody fragments include, but are not limited to, nanobody, nanobody- FIAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CFI3, Diabody-CFI3, triple body, miniantibody, minibody, TriBi minibody, scFv-CFI3 KIH, Fab-scFv, scFv- CH-CL-scFv, F(ab')2, F(ab')2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody.
[00267] Bispecific fusion proteins include antibody fragments linked to other proteins. For example bispecific fusion proteins can be linked to other proteins to add additional specificity and/or functionality. In some embodiments, the dock-and- lock (DNL) method can be used to generate bispecific antibody molecules with higher valency. For example, bispecific antibody fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments. In embodiments, chemical conjugation, for example, chemical conjugation of antibodies and/or antibody fragments, can be used to create BsAb molecules. An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof. In embodiments, the conjugation improves the serum half-life.
[00268] Methods of production of multispecific antibodies, including bispecific antibodies, are known in the art. For example, multispecific antibodies, including
bispecific antibodies can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly or by expression of the component antibodies in a single host cell. Purification of multispecific antibody molecules can be performed by various methods known in the art, such as affinity chromatography.
[00269] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, disclosed herein can be provided in any antibody format disclosed herein or known in the art. As a non limiting example, in some embodiments, SARS-CoV-2 binding agents (e.g., antibodies), including agents that bind to a SARS-CoV-2 spike glycoprotein, can be selected from Fabs-in-tandem-lg (FIT-lg); DVD-lg; hybrid hybridoma (quadroma or tetradoma); anticalin platform (Pieris); diabodies; single chain diabodies; tandem single chain Fv fragments; TandAbs, Trispecific Abs (Affimed); Darts dual affinity retargeting (Macrogenics); Bispecific Xmabs (Xencor); Bispecific T cell engagers (Bites; Amgen; 55kDa); Triplebodies; Tribody = Fab-scFv Fusion Protein multifunctional recombinant antibody derivates (CreativeBiolabs); Duobody platform (Genmab); dock and lock platform; knobs-into-holes (KIH) platform; Flumanized bispecific IgG antibody (REGN1979) (Regeneron); Mab2 bispecific antibodies (F- Star); DVD-lg = dual variable domain immunoglobulin (Abbott); kappa-lambda bodies; TBTI = tetravalent bispecific tandem Ig; and CrossMab (Roche).
[00270] In some embodiments, a multispecific {e.g., bispecific) antibody disclosed herein comprises an SARS-CoV-2 binding agent and a second binding agent, wherein the SARS-CoV-2 binding agent (e.g., antibody) comprises a VL and/or VH amino acid sequence of Tables 1 -8. In some embodiments, a bispecific antibody disclosed herein comprises an SARS-CoV-2 binding agent that comprises a VL and/or VH amino acid sequence of Tables 1-8 and further comprises a VL and/or VH amino acid sequence of another antibody.
[00271] In some embodiments, provided herein is a bispecific antibody which binds to SARS -CoV-2 (e.g., a SARS-CoV-2 spike glycoprotein) that comprises VL and VH CDRs (e.g., VL CDR1, VL CDR2, VL CDR3, VH CDR1, VH CDR2, VH CDR3), wherein at least one VH CDR3 of the bispecific antibody comprises the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
[00272] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 1 (SEQ ID
NOS:1, 2, 3, 4, 5 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:7, 8, 9, 10, 11 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS:12, 2, 3, 4, 5, and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 13, 14, 15, 16,
11 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 18, 19, 20, 21, 22 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 1 (SEQ ID NOS: 1 , 24, 3, 4, 5 and/or 6).
[00273] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 2 (SEQ ID NOS:32, 33, 3, 34, 35 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:37, 38, 9, 39, 40 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:12, 33, 3, 34, 35 and/or 36). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:41 , 14, 15, 42, 40 and/or 43). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS: 18, 44, 20, 45, 46 and/or 47). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 2 (SEQ ID NOS:32, 48, 3, 34, 35 and/or 36). [00274] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 3 (SEQ ID NOS:1 , 51 , 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:7, 38, 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:12, 51, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-
CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 13, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS: 18, 44, 20, 55, 46 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 3 (SEQ ID NOS:1 , 48, 3, 52, 35 and/or 6). [00275] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 4 (SEQ ID NOS:58, 59, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:60, 61 , 9, 53, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:12, 59, 3, 52, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:62, 14, 15, 54, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS: 18, 63, 20, 55, 46, and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 4 (SEQ ID NOS:58, 64, 3, 52, 35 and/or 6). [00276] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 5 (SEQ ID NOS:1 , 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:7, 69, 9, 53, 70 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:12, 66, 3, 52, 67 and/or 68). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS: 13, 14, 15, 54, 70 and/or 71). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:18, 72, 20, 55, 73 and/or 74). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 5 (SEQ ID NOS:1 , 75, 3, 52, 67 and/or 68).
[00277] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 6 (SEQ ID NOS:78, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:79, 69, 9, 10, 40 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:80, 66, 3, 4, 35 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:81 , 14, 15, 16, 40 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:82, 72, 20, 21 , 46 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 6 (SEQ ID NOS:78, 75, 3, 4, 35 and/or 6). [00278] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 7 (SEQ ID NOS:85, 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:88, 89, 9, 53, 90 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:91 , 86, 3, 52, 87 and/or 6). In some embodiments, provided herein is a bispecific antibody which binds to SARS- CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:92, 14, 15, 54, 90 and/or 17). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:93, 94, 20, 55, 95 and/or 23). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 7 (SEQ ID NOS:85, 96, 3, 52, 87 and/or 6). [00279] In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set forth in Table 8 (SEQ ID NOS:1, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS:7, 101, 9, 10, 40 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2
that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 12, 99, 3, 4, 35 and/or 100). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 13, 14, 15, 16, 40 and/or 102). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 18, 103, 20, 21 , 46 and/or 104). In some embodiments, provided herein is a bispecific antibody which binds to SARS-CoV-2 that comprises VL and VH CDRs as set for in Table 8 (SEQ ID NOS: 1 , 105, 3, 4, 35 and/or 100).
[00280] Antibodies that bind SARS-CoV-2, including antibodies that bind to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be obtained by any suitable method, such as (but not limited to) immunization with whole cells expressing a SARS-CoV-2 spike glycoprotein or a fragment thereof and collection of antibodies, recombinant techniques, or screening libraries of antibodies or antibody fragments using a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD). Monoclonal antibodies may be generated using a variety of known techniques (see, for example, Coligan et al. (eds.), Current Protocols in Immunology, 1:2.5.12.6.7 (John Wiley & Sons 1991); Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol (eds.) (1980); Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press (1988); and Picksley et al., “Production of monoclonal antibodies against proteins expressed in E. coli," in DNA Cloning 2: Expression Systems, 2nd Edition, Glover et al. (eds.), page 93 (Oxford University Press 1995)). One exemplary technique for generating monoclonal antibodies comprises immunizing an animal with a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) and generating a hybridoma from spleen cells taken from the animal. A hybridoma may produce a monoclonal antibody or antibody fragment that binds SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD).
[00281] Likewise, human antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be generated by any of a number of techniques including, but not limited to,
Epstein Barr Virus (EBV) transformation of human peripheral blood cells ( e.g ., containing B lymphocytes), in vitro immunization of human B cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein. Methods for obtaining human antibodies from transgenic animals are further described, for example, in Bruggemann et al. , Curr. Opin. Biotechnol., 8: 45558, 1997; Jakobovits et al., Ann. N. Y. Acad. Sci., 764: 52535, 1995; Green et al., Nature Genet., 7: 13- 21, 1994; Lonberg et al., Nature, 368: 856-859, 1994; Taylor et al., Int. Immun. 6: 579-591, 1994; and U.S. Patent No. 5,877,397.
[00282] For example, human antibodies that bind SARS-CoV-2 and/or a SARS- CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1, SARS-CoV- 2-RBD) may be obtained from transgenic animals that have been engineered to produce specific human antibodies in response to antigenic challenge. For example, International Patent Publication No. WO 98/24893 discloses transgenic animals having a human Ig locus, wherein the animals do not produce functional endogenous immunoglobulins due to the inactivation of endogenous heavy and light chain loci. Transgenic non-primate mammalian hosts capable of mounting an immune response to an immunogen, wherein the antibodies have primate constant and/or variable regions, and wherein the endogenous immunoglobulin encoding loci are substituted or inactivated, also have been described. International Patent Publication No. WO 96/30498 discloses the use of the Cre/Lox system to modify the immunoglobulin locus in a mammal, such as to replace all or a portion of the constant or variable region to form a modified antibody molecule. International Patent Publication No.
WO 94/02602 discloses non-human mammalian hosts having inactivated endogenous Ig loci and functional human Ig loci. U.S. Patent No. 5,939,598 discloses methods of making transgenic mice in which the mice lack endogenous heavy chains, and express an exogenous immunoglobulin locus comprising one or more xenogeneic constant regions. Using a transgenic animal, such as a transgenic animal described herein, an immune response can be produced to a selected antigenic molecule, and antibody producing cells can be removed from the animal and used to produce hybridomas that secrete human-derived monoclonal antibodies. Immunization protocols, adjuvants, and the like are known in the art, and are used in immunization of, for example, a transgenic mouse as described in International
Patent Publication No. WO 96/33735. The monoclonal antibodies can be tested for the ability to inhibit or neutralize the biological activity or physiological effect of the corresponding protein.
[00283] Humanized antibodies that bind SARS-CoV-2 and/or a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) may be produced using techniques known to those skilled in the art (Zhang et al., Molecular Immunology, 42(12): 1445-1451, 2005; Hwang et al., Methods, 36(1): 35- 42, 2005; Dall'Acqua et al., Methods, 36(1): 43-60, 2005; Clark, Immunology Today, 21(8): 397-402, 2000, and U.S. Patent Nos. 6,180,370; 6,054,927; 5,869,619; 5,861,155; 5,712,120; and 4,816,567.
[00284] Further provided are the materials for generating SARS-CoV-2 binding agents, including agents that bind a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD). For example, an isolated cell (e.g., a hybridoma) may produce an SARS-CoV-2 binding agent (e.g., antibody or antibody fragment). In this regard, a cell (e.g., an isolated cell) may produce an antibody or fragment thereof comprising a VH and a VL as shown in Tables 1 -8. In some embodiments, one or more polynucleotides comprising one or more nucleic acid sequences encoding a SARS-CoV-2 binding agent (e.g., antibody or antibody fragment) may be generated. In some embodiments, the one or more polynucleotides are isolated and/or recombinant polynucleotides. In some embodiments, the one or more isolated polynucleotides comprise one or more nucleotide sequences that encode an antibody heavy chain variable region (VH) and/or an antibody light chain variable region (VL), wherein the VH and the VL comprise complementarity determining regions (CDRs) as shown in Tables 1-8. [00285] In some embodiments, one or more vectors (e.g., expression vectors) may comprise one or more polynucleotides for expression of one or more polynucleotides in a suitable host cell. Such vectors are useful, e.g., for amplifying the polynucleotides in host cells to create useful quantities thereof, and for expressing binding agents, such as antibodies or antibody fragments, using recombinant techniques. Vectors also are useful in “gene therapy” treatment regimens, wherein, for example, one or more polynucleotides encoding a SARS-CoV-2 binding agent (e.g., an antibody, including a multispecific antibody such as a bispecific antibody), is introduced into a subject suffering from or at risk of suffering from a SARS-CoV-2
mediated disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition.
[00286] In some embodiments, one or more vectors are expression vectors wherein one or more polynucleotides are operatively linked to one or more polynucleotides comprising expression control sequences. Autonomously replicating recombinant expression constructs such as plasmid and viral DNA vectors incorporating one or more polynucleotides encoding antibody sequences that bind SARS-CoV-2 are specifically contemplated. Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression construct is to be utilized. Promoter and enhancer sequences are generally selected for the ability to increase gene expression, while operator sequences are generally selected for the ability to regulate gene expression. Expression constructs may also include sequences encoding one or more selectable markers that permit identification of host cells bearing the construct. Expression constructs may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell. In some embodiments, expression constructs of the can also include sequences necessary for replication in a host cell.
[00287] Exemplary expression control sequences include promoter/enhancer sequences, e.g., cytomegalovirus promoter/enhancer (Lehner et al. , J. Clin. Microbiol., 29: 2494-2502, 1991; Boshart et al., Cell, 41: 521-530, 1985); Rous sarcoma virus promoter (Davis et al., Hum. Gene Then, 4: 151, 1993); Tie promoter (Korhonen et al., Blood, 86(5): 1828-1835, 1995); simian virus 40 promoter; DRA (downregulated in adenoma; Alrefai et al., Am. J. Physiol. Gastrointest. Liver Physiol., 293: G923-G934, 2007); MCT1 (monocarboxylate transporter 1 ; Cuff et al., Am. J. Physiol. Gastrointet. Liver Physiol., G977-G979. 2005); and Mathl (mouse atonal homolog 1; Shroyer et al., Gastroenterology, 132: 2477-2478, 2007), for expression in mammalian cells, the promoter being operatively linked upstream (e.g., 5’) of a polypeptide coding sequence. In another variation, the promoter is an epithelial-specific promoter or endothelial-specific promoter. Polynucleotides may also optionally include a suitable polyadenylation sequence (e.g., the SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (e.g., 3’) of the polypeptide coding sequence.
[00288] If desired, the one or more polynucleotides also optionally comprise nucleotide sequences encoding secretory signal peptides fused in frame with the polypeptide sequences. The secretory signal peptides direct secretion of the antibody polypeptides by the cells that express the one or more polynucleotides, and are cleaved by the cell from the secreted polypeptides. The one or more polynucleotides may further optionally comprise sequences whose only intended function is to facilitate large scale production of the vector. One can manufacture and administer polynucleotides for gene therapy using procedures that have been described in the literature for a variety of transgenes. See, e.g., Isner et al. , Circulation, 91: 2687-2692, 1995; and Isner et al., Human Gene Therapy, 7: 989- 1011, 1996.
[00289] In some embodiments, polynucleotides may further comprise additional sequences to facilitate uptake by host cells and expression of the antibody or fragment thereof (and/or any other peptide). In some embodiments, a “naked” transgene encoding an antibody or fragment thereof described herein (e.g., a transgene without a viral, liposomal, or other vector to facilitate transfection) is employed.
[00290] Any suitable vectors may be used to introduce one or more polynucleotides that encode an antibody or fragment thereof into the host.
Exemplary vectors that have been described include replication deficient retroviral vectors, including but not limited to lentivirus vectors (Kim et al., J. Virol., 72(1): 811- 816, 1998; Kingsman & Johnson, Scrip Magazine, October, 1998, pp. 43-46); parvoviral vectors, such as adeno-associated viral (AAV) vectors (U.S. Patent Nos. 5,474,935; 5,139,941 ; 5,622,856; 5,658,776; 5,773,289; 5,789,390; 5,834,441; 5,863,541; 5,851 ,521 ; 5,252,479; Gnatenko et al., J. Invest. Med., 45: 87-98, 1997); adenoviral (AV) vectors (U.S. Patent Nos. 5,792,453; 5,824,544; 5,707,618; 5,693,509; 5,670,488; 5,585,362; Quantin et al., Proc. Natl. Acad. Sci. USA, 89: 2581-2584, 1992; Stratford Perricaudet et al., J. Clin. Invest., 90: 626-630, 1992; and Rosenfeld et al., Cell, 68: 143-155, 1992); an adenoviral adeno-associated viral chimeric (U.S. Patent No. 5,856,152) or a vaccinia viral or a herpesviral vector (U.S. Patent Nos. 5,879,934; 5,849,571; 5,830,727; 5,661,033; 5,328,688); Lipofectin mediated gene transfer (BRL); liposomal vectors (U.S. Patent No. 5,631,237); and combinations thereof. Any of these expression vectors can be prepared using recombinant DNA techniques as described in, e.g., Sambrook et al., Molecular
Cloning, a Laboratory Manual, 2d edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989), and Ausubel et al. , Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New York, N.Y. (1994). Optionally, viral vectors are rendered replication-deficient by, e.g., deleting or disrupting select genes required for viral replication.
[00291] Other non-viral delivery mechanisms contemplated include calcium phosphate precipitation (Graham and Van Der Eb, Virology, 52: 456-467, 1973;
Chen and Okayama, Mol. Cell Biol., 7: 2745-2752, 1987; Rippe et al., Mol. Cell Biol., 10: 689-695, 1990) DEAE-dextran (Gopal, Mol. Cell Biol., 5: 1188-1190, 1985), electroporation (Tur-Kaspa et al., Mol. Cell Biol., 6: 716-718, 1986; Potter et al.,
Proc. Nat. Acad. Sci. USA, 81: 7161-7165, 1984), direct microinjection (Harland and Weintraub, J. Cell Biol., 101: 1094-1099, 1985, DNA-loaded liposomes (Nicolau and Sene, Biochim. Biophys. Acta, 721: 185-190, 1982; Fraley et al., Proc. Natl. Acad. Sci. USA, 76: 3348-3352, 1979; Feigner, Sci Am., 276(6): 102-6, 1997; Feigner,
Hum Gene Ther., 7(15): 1791-3, 1996), cell sonication (Fechheimer et al., Proc. Natl. Acad. Sci. USA, 84: 8463-8467, 1987), gene bombardment using high velocity microprojectiles (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990), and receptor-mediated transfection (Wu and Wu, J. Biol. Chem., 262: 4429-4432, 1987; Wu and Wu, Biochemistry, 27: 887-892, 1988; Wu and Wu, Adv. Drug Delivery Rev., 12: 159-167, 1993).
[00292] An expression vector (or the antibody or fragment thereof discussed herein) may be entrapped in a liposome. See, e.g., Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104 (1991); Radler et al., Science, 275(5301): 810-814, 1997). Also contemplated are various commercial approaches involving “Npofection” technology. In some embodiments, the liposome may be complexed with a hemagglutinating virus (HVJ). This has been shown to facilitate fusion with the cell membrane and promote cell entry of liposome-encapsulated DNA (Kaneda et al., Science, 243: 375-378, 1989). In other embodiments, the liposome is complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al., J. Biol. Chem., 266: 3361-3364, 1991). In some embodiments, the liposome are complexed or employed in conjunction with both HVJ and HMG-1. Such expression constructs have been successfully employed in transfer and expression of nucleic acid in vitro and in vivo. In some embodiments,
an SARS-CoV-2 binding agent ( e.g ., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, is included in the liposome to target the liposome to cells.
[00293] A cell may comprise one or more polynucleotide or vectors, e.g., the cell is transformed or transfected with one or more polynucleotides encoding a SARS-CoV- 2 binding agent {e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein, or one or more vectors comprising the one or more polynucleotides. In some embodiments, cells express a SARS-CoV-2 binding agent (e.g., antibody), containing one or more, including six CDRs having at least 75% identity to the CDRs identified in Tables 1-8. In some embodiments, the cells express a SARS-CoV-2 binding agent (e.g., antibody) containing a VH and/or a VL comprising CDRs as identified in Tables 1-8. The cells may be prokaryotic cells, such as Escherichia coli (see, e.g., Pluckthun et al. , Methods EnzymoL, 178: 497- SIS, 1989), or eukaryotic cells, such as an animal cell (e.g., a myeloma cell, Chinese Hamster Ovary cell, or hybridoma cell), yeast (e.g., Saccharomyces cerevisiae), or a plant cell (e.g., a tobacco, corn, soybean, or rice cell). Use of mammalian host cells may provide for translational modifications (e.g., glycosylation, truncation, lipidation, and phosphorylation) that may be desirable to confer optimal biological activity on recombinant expression products. Similarly, polypeptides (e.g., SARS-CoV-2 binding agents, including agents that bind to a SARS-CoV-2 spike glycoprotein) may be glycosylated or non-glycosylated and/or have been covalently modified to include one or more water soluble polymer attachments such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
[00294] Methods for introducing DNA or RNA into a host cell are well known and include transformation, transfection, electroporation, nuclear injection, or fusion with carriers such as liposomes, micelles, ghost cells, and protoplasts. Such host cells are useful for amplifying polynucleotides and also for expressing polypeptides encoded by the polynucleotides. In this regard, a process for the production of a SARS-CoV-2 binding agent (e.g., antibody) may comprise culturing a host cell as described herein and isolating the SARS-CoV-2 binding agent. Transferring a naked DNA expression construct into cells can be accomplished using particle bombardment, which depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327: 70-73, 1987). Several devices for
accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., Proc. Natl. Acad. Sci USA, 87: 9568-9572, 1990). The microprojectiles used have consisted of biologically inert substances such as tungsten or gold beads. A host cell may be isolated and/or purified. A host cell also may be a cell transformed in vivo to cause transient or permanent expression of the polypeptide in vivo. A host cell may also be an isolated cell transformed ex vivo and introduced post-transformation, e.g., to produce the polypeptide in vivo for therapeutic purposes. The definition of host cell explicitly excludes a transgenic human being.
[00295] A variety of methods for producing antibodies from polynucleotides are generally well-known. For example, basic molecular biology procedures are described by Maniatis et al., Molecular Cloning, A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, New York, 1989 (see also Maniatis et al, 3rd ed., Cold Spring Harbor Laboratory, New York, 2001). Additionally, numerous publications describe techniques suitable for the preparation of antibodies by manipulation of DNA, creation of expression vectors, and transformation and culture of appropriate cells (see, e.g., Mountain and Adair, Chapter 1 in Biotechnology and Genetic Engineering Reviews, Tombs ed., Intercept, Andover, UK, 1992); and Current Protocols in Molecular Biology, Ausubel ed., Wiley Interscience, New York, 1999). [00296] A SARS-CoV-2 binding agent (e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2- S1, SARS-CoV-2-RBD), is produced using any suitable method, e.g., isolated from an immunized animal, recombinantly or synthetically generated, or genetically- engineered, including as described above. Antibody fragments derived from an antibody are obtained by, e.g., proteolytic hydrolysis of an antibody. For example, papain or pepsin digestion of whole antibodies yields a 5S fragment termed F(ab’)2 or two monovalent Fab fragments and an Fc fragment, respectively. F(ab)2 can be further cleaved using a thiol reducing agent to produce 3.5S Fab monovalent fragments. Methods of generating antibody fragments are further described in, for example, Edelman et al., Methods in Enzymology, 1 : 422 Academic Press (1967); Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244, 1960; Porter, Biochem. J., 73: 119-127, 1959; U.S. Patent No. 4,331 ,647; and by Andrews, S.M. and Titus, J.A. in
Current Protocols in Immunology (Coligan et al. , eds), John Wiley & Sons, New York (2003), pages 2.8.1 2.8.10 and 2.10A.1 2.10A.5.
[00297] A SARS-CoV-2 binding agent (e.g., antibody), including an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2- S1 , SARS-CoV-2-RBD), can be genetically engineered. For example, in various aspects, a SARS-CoV-2 binding agent or an agent that binds to a SARS-CoV-2 spike glycoprotein or a fragment thereof (e.g., SARS-CoV-2-S1 , SARS-CoV-2-RBD) comprises, e.g., a variable region domain generated by recombinant DNA engineering techniques. In this regard, a variable region is optionally modified by insertions, deletions, or changes in the amino acid sequence of the antibody to produce an antibody of interest, including as described above. Polynucleotides encoding complementarity determining regions (CDRs) of interest are prepared, for example, by using polymerase chain reaction to synthesize variable regions using mRNA of antibody producing cells as a template (see, for example, Courtenay Luck, “Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al. (eds.), page 166 (Cambridge University Press 1995); Ward et al., “Genetic Manipulation and Expression of Antibodies,” in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), page 137 (Wiley Liss, Inc. 1995); and Larrick et al., Methods: A Companion to Methods in Enzymology, 2: 106-110, 1991 ). Current antibody manipulation techniques allow construction of engineered variable region domains containing at least one CDR and, optionally, one or more framework amino acids from a first antibody and the remainder of the variable region domain from a second antibody. Such techniques are used, e.g., to humanize an antibody or to improve its affinity for a binding target.
[00298] “Humanized antibodies” are antibodies in which CDRs of heavy and light variable chains of non-human immunoglobulin are transferred into a human variable domain. Constant regions need not be present, but if they are, they optionally are substantially identical to human immunoglobulin constant regions, e.g., at least about 85-90%, about 95%, 96%, 97%, 98%, 99% or more identical, in some embodiments. Hence, in some instances, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences. For example, in one aspect, humanized antibodies are human immunoglobulins {e.g., host antibody) in which hypervariable region residues
of the host antibody are replaced by hypervariable region residues from a non human species (donor antibody) such as mouse, rat, rabbit, or a non-human primate having the desired specificity, affinity, and capacity.
[00299] In some embodiments, the antibody is a human antibody, including, but not limited to, an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences as described, for example, in Kabat et al. (1991) Sequences of proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242. If the antibody contains a constant region, the constant region also preferably is derived from human germline immunoglobulin sequences. Human antibodies may comprise amino acid residues not encoded by human germline immunoglobulin sequences, for example, to enhance the activity of the antibody, but do not comprise CDRs derived from other species (e.g., a mouse CDR placed within a human variable framework region).
[00300] SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein, including agents that bind to a SARS-CoV-2 spike glycoprotein (e.g., homotrimer, protomer), an S1 domain of a SARS-CoV-2 spike glycoprotein (e.g., SARS-CoV-2-S1), and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein (e.g., SARS- CoV-2-RBD), are useful in methods of treating, preventing, or alleviating a SARS- CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition.
[00301] In some embodiments, provided herein are methods of treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition, in a subject by administering to the subject an effective amount of a SARS CoV-2 binding agent (e.g., antibody) disclosed herein.
[00302] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) provided herein are used to prevent a SARS-CoV-2 related disease, disorder, or condition (e.g., infection). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are used for prevention as “prophylactics” or “prophylactic agents.” In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject prior to or at an early stage of disease (e.g., prior to infection). In some embodiments, SARS-CoV-2
binding agents ( e.g ., antibodies) disclosed herein are administered to a subject as a prophylactic to prevent a SARS-CoV-2 related disease {e.g., infection).
[00303] In some embodiments, administration of SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein can occur prior to SARS-CoV-2 related disease {e.g., infection) or prior to manifestation of symptoms characteristic of SARS-CoV-2 related disease {e.g., infection). For example, in some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject at risk for SARS-CoV-2 related disease (e.g., infection) (e.g., subjects who may have come into contact with a SARS-CoV-2 infected person, subjects exhibiting one or more symptoms of SARS-CoV-2 related disease (e.g., infection), or subjects who are at high risk of exposure to SARS-CoV-2, including, for example, medical professionals such as doctors, nurses, parmedics, medical technicians and assistants). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject at elevated risk for a SARS-CoV-2 related disease, including mortality from such disease. For example, subjects are at elevated risk for SARS-CoV-2 related mortality if one or more coexisting factors or disorders is present, including elevated age, elevated body mass index, history of smoking, chronic obstructive pulmonary disease, diabetes, hypertension, coronary heart disease, cerebrovascular disease, hepatitis B infection, cancer, chronic renal disease, and immunodeficiency. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject who may have come in contact with SARS-CoV-2 and is asymptomatic.
[00304] In some embodiments, SARS-CoV-2 agents (e.g., antibodies) disclosed herein are administered prior to a SARS-CoV-2 related disease (e.g., infection) or manifestation of symptoms such that SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition is prevented or delayed in its progression.
[00305] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to treat a subject diagnosed with a SARS-CoV-2 related disease (e.g., infection). A subject may be diagnosed with a SARS-CoV-2 related disease (e.g., infection) using any method known or developed in the art. For example, SARS-CoV-2 binding agents (e.g., antibodies) provided herein are used in treating, preventing or alleviating a SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition, in a
subject who has undergone confirmatory testing for a SARS-CoV-2 related disease (. e.g ., infection), using any testing known in the art including molecular testing ( e.g ., PCR), serological testing (ELISA), and viral culture.
[00306] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) are useful in a method of treating, preventing or alleviating one or more symptoms of a SARS-CoV-2-related disease, disorder, or condition in a subject, wherein the method comprises administering a SARS-CoV-2 agent {e.g., antibody) disclosed herein to the subject.
[00307] Symptoms of a SARS-CoV-2-related disease, disorder, or condition can include cough, dyspnea, chest tightness, fever, adverse Gl effects, fatigue, myalgia, arthralgia, lymphocytopenia, conjunctival congestion, nasal congestion, headache, sore throat, sputum production, hemoptysis, shortness of breath, nausea, vomiting, diarrhea, chills, throat congestion, tonsil swelling, lymph node enlargement, rash, pain or pressure in the chest, difficulty in breathing, reduced clarity of vision, loss of taste or smell, and confusion. SARS-CoV-2 related diseases, disorders, or conditions related by SARS-CoV-2 include pneumonia (e.g., atypical pneumonia, acute respiratory distress syndrome (ARDS), multiple-organ failure, and cytokine storm). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject who has symptoms of a SARS-CoV-2 related disease, disorder, or condition (e.g., an infection such as a viral respiratory infection), for example, symptoms associated with SARS-CoV-2 related disease (e.g., infection) based on a clinical assessment (e.g., to distinguish an influenza infection or other pneumonia).
[00308] In some embodiments, one or more symptoms of a SARS-CoV-2 related disease, disorder, or condition are assessed using any methods known in the art.
For example, symptoms are assessed using radiologic assessments including chest radiography or computed tomography (CT) and/or using laboratory assessments known in the art, including complete blood count, blood chemical analysis, coagulation testing, assessment of liver and renal function, and measures of electrolytes, C-reactive protein, procalcitonin, lactate dehydrogenase, and creatine kinase.
[00309] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces morbidity and/or mortality in subjects with a SARS-CoV-2 related disease, disorder, or condition. In some
embodiments, administration of SARS-CoV-2 binding agents ( e.g antibodies) provides neutralizing activity against SARS-CoV-2 {e.g., in vitro and/or in vivo). In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein bind with high affinity {e.g., in vitro and/or in vivo) to SARS-CoV-2 {e.g., SARS-CoV- 2 receptor binding domain (RBD)).
[00310] In some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein bind to SARS-CoV-2 {e.g., SARS-CoV-2 receptor binding domain (RBD)) and neutralize SARS-CoV-2 {e.g., in vitro and/or in vivo). As a non-limiting example, in some embodiments, SARS-CoV-2 binding agents {e.g., antibodies) disclosed herein bind to SARS-CoV-2 {e.g., SARS-CoV-2 RBD) with an in vitro ICso of less than about 1 pg/mL, about 0.1 pg/mL, about 0.01 pg/mL, about 1 ng/mL, about 0.1 ng/ml, or about 0.01 ng/ml as assessed by methods described herein or known to one of skill in the art.
[00311] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease burden in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein provides disease ameliorating effects in vivo, for example, on viral load (e.g., lung viral load) and/or body weight as a clinical symptom. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces disease severity, including, for example, at a histological level in vivo, in SARS-CoV-2 infected subjects.
[00312] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces susceptibility to and/or pathogenesis of SARS-CoV-2 infection in a subject. As a non-limiting example, in some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces pulmonary monocyte-macrophage infiltration, decreases viral load, and/or decreases pulmonary pathology in SARS-CoV-2 infected subjects. [00313] Without being bound by theory, extensive pulmonary surface area may be exposed to SARS-CoV-2 in infected subjects and result in the generation of reactive oxygen species (ROS), such that phospholipid peroxidation results in extensive damage to the lungs. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces generation of ROS and/or phospholipid peroxidation. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces oxidative
stress in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents ( e.g ., antibodies) disclosed herein prevents or reduces signaling associated with oxidative stress in SARS-CoV-2 infected subjects. As a non-limiting example, in some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) prevents or reduces induction of Toll-like receptor 4 expression and signaling in SARS-CoV-2 infected subjects, including, for example, by macrophages that in turn upregulate pro-inflammatory cytokine production. [00314] Without being bound by theory, in vulnerable groups of subjects, such as subjects with atherosclerosis, subsets of hyperactive macrophages may play a more significant role in heightening the severity of SARS-CoV-2 infection. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the amount of oxidized lipids in macrophage-rich inflammatory exudates from SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of pro-atherogenic cytokines and/or chemokines, including, for example, upon their stimulation with oxidized low-density lipoprotein (oxLDL), in SARS-CoV-2 infected subjects. As a non-limiting example, in some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces production of TNF, IL-6, IL-8 and/or CD36 in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the interaction of CD36 with oxidized low-density lipoprotein (oxLDL) in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces CD36-mediated signaling cascades for inflammatory responses in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces the recognition and/or internalization of oxLDL by CD36 in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces macrophage activation in affected tissues of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces macrophage activation in non-affected tissues of SARS-CoV-2 infected subjects, including, for example, where pro-atherogenic
stimuli have induced a population of long-lasting inflammatory monocytes in the circulation of subjects producing a “trained innate immune response”.
[00315] In some embodiments, administration of SARS-CoV-2 binding agents (. e.g ., antibodies) disclosed herein decreases the number of activated monocytes, for example, in microcirculation of infected tissues including in the pulmonary circulation of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein ameliorates disease severity, including, for example, in the pulmonary parenchyma of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein modify the immunometabolism of monocyte/macrophage populations in subjects (e.g., in atherosclerotic subjects) with SARS-CoV-2 infection.
[00316] Without being bound by theory, severe morbidity and mortality in subjects infected with SARS-CoV-2 who mount cytokine storm responses may involve hyperactivation of the monocyte-macrophage system. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject who has a cytokine storm associated with or in response to SARS-CoV-2 infection. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or suppresses a cytokine storm, including, for example, by preventing or suppressing the monocyte-macrophage system (e.g., by reducing viral load and/or accumulation with macrophages such as lung macrophages) in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces release of cytokines, including, for example, cytokines that directly or indirectly lead to vascular endothelial damage (e.g., inflammatory and coagulation sequelae of SARS-CoV-2 infection including within parenchymatous organs such as lung, hear, kidneys, and liver). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to subjects (e.g., children) with Kawasaki-like disease associated with or in response to SARS-CoV-2 infection.
[00317] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to subjects predisposed to atherosclerosis, including, for example, atherosclerosis due to underlying conditions of hypertension and/or diabetes mellitus. In some embodiments, administration of SARS-CoV-2
binding agents ( e.g ., antibodies) disclosed herein prevents or reduces inflammation associated with or in response to SARS-CoV-2 infection in a subject. In some embodiments, administration of SARS-CoV-2 binding agents {e.g., antibodies) reduces the number of infiltrating macrophages in SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces a hyperinflammatory response (e.g., cytokine storm) in subjects with a SARS-CoV-2 related disease, disorder, or condition, such as SARS-CoV-2 infected subjects.
[00318] In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein reduces the contribution of hyperactivated monocytes to coagulation and/or activation of polymorph nuclear leukocytes (PMN), including, for example, in affected lungs of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces microthrombi of the lungs, brain, heart, kidneys, liver and/or limbs of SARS-CoV-2 infected subjects. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces intravascular coagulation, including, for example, disseminated intravascular coagulation (DIC) that primarily or secondarily takes place in microcirculation (e.g., in the lungs) associated with or in response to SARS-CoV-2 infection. In some embodiments, administration of SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein prevents or reduces inflammatory and coagulation sequelae associated with or in response to SARS-CoV-2 infection, including, for example, cytokine storm, fever, intravascular coagulation (e.g., DIC), cardiac ischemia, stroke, neuropsychological effects, acute lung injury, acute respiratory distress syndrome, septic shock, sepsis, multi-organ dysfunction or failure.
[00319] An administration regimen of SARS-CoV-2 binding agents (e.g., antibodies) for a particular subject will depend, in part, upon the agent used, the amount of agent administered, the route of administration, and the cause and extent of any side effects. The amount of agent administered to a subject (e.g., a mammal, such as a human) should be sufficient to effect the desired response over a reasonable time frame. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) are administered once, but more preferably are administered multiple times, e.g., from three times daily to once every six months or longer. In some embodiments, the administration is on a schedule such as three times daily, twice
daily, once daily, once every two days, once every three days, once weekly, once every two weeks, once every month, once every two months, once every three months, and once every six months, nine months, 12 months, 15 months, 18 months, 21 months, two years, or more. In some embodiments, the antibody is administered continuously, e.g., via a minipump.
[00320] Suitable routes of administering a composition, such as a physiologically- acceptable composition, comprising a SARS-CoV-2 binding agent (e.g., antibody), are well known in the art. Although more than one route are used to administer an agent, a particular route can provide a more immediate and more effective reaction than another route. Depending on the circumstances, a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) is applied or instilled into body cavities, absorbed through the skin or mucous membranes, ingested, inhaled, and/or introduced into circulation. For example, it may be desirable to deliver a composition comprising a SARS-CoV-2 binding agent (e.g., antibody) through injection by intravenous, subcutaneous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems, or by implantation devices. The antibody may be administered locally or systemically. If desired, a SARS-CoV-2 binding agent (e.g., antibody) is administered regionally via intraarterial or intravenous administration feeding the region of interest. Alternatively, a SARS-CoV-2 binding agent (e.g., antibody) may be administered locally via implantation of a membrane, sponge, or another appropriate material on to which the desired agent has been absorbed or encapsulated. Where an implantation device is used, the device is, one aspect, implanted into any suitable tissue or organ, and delivery of a SARS-CoV-2 binding agent (e.g., antibody) is for example, via diffusion, timed-release bolus, or continuous administration.
[00321] Any delivery route known to those skilled in the art may be used, and other delivery routes for SARS-CoV-2 binding agents (e.g., antibodies) include via the pulmonary route using a powder inhaler or metered dose inhaler, via the buccal route formulated into a tablet or a buccal patch, via the rectal route formulated into suppositories; and via the oral route in the form of a tablet, a capsule or a pellet.
[00322] The SARS-CoV-2 binding agents ( e.g ., antibodies) may be administered once, at least twice or for at least the period of time until the SARS-CoV-2 related disease, disorder, or condition is treated, prevented, alleviated, or cured. The SARS-CoV-2 binding agents {e.g., antibodies) may be administered as part of a composition as described herein. The dosage of antibody may be in the range of 0.1-100 mg/kg, alternatively 0.5-50 mg/kg, 1-20 mg/kg, or 1-10 mg/kg. The serum concentration of the antibody may be measured by any method known in the art. [00323] In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein are administered to a subject in combination with one or more additional agents. In some embodiments, the one or more additional agents are independently useful in treating, preventing or alleviating a SARS-CoV-2-related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition (e.g., resulting from infection). In some embodiments, the effect of the one or more additional agents may synergize with the effect of SARS- CoV-2 binding agents (e.g., antibodies) disclosed herein. The one or more additional agents may be selected by one skilled in the art.
[00324] In some embodiments, the method further comprises administering one or more additional agents, which may be present in a composition comprising a SARS- CoV-2 binding agent (e.g., antibody) or provided in a separate composition using the same or a different route of administration. Co-administration of SARS-CoV-2 binding agents (e.g., antibodies) with one or more additional agents (combination therapy) may encompass administering a composition comprising SARS-CoV-2 binding agents (e.g., antibodies) and the one or more additional agents as well as administering two or more separate compositions, one comprising the SARS-CoV-2 binding agents (e.g., antibodies) and the other(s) comprising the additional agent(s). In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at the same time as one another. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and the one or more additional agents are administered at different times. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) may be administered, for example, once every three days, while an additional agent is administered once daily. In some embodiments, SARS-CoV-2 binding agents (e.g., antibodies) are administered prior to or subsequent to treatment with the one or
more additional agents, for example after a subject has failed therapy with the additional agent.
[00325] The SARS-CoV-2 binding agents ( e.g ., antibodies) and one or more additional agents {e.g., combination therapy) may be administered once, twice or at least the period of time until the SARS-CoV-2 related disease, disorder, or condition, including one or more symptoms of such a disease, disorder, or condition {e.g., resulting from infection) is treated, prevented, alleviated, or cured. In some embodiments, the SARS-CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered multiple times. In some embodiments, SARS- CoV-2 binding agents (e.g., antibodies) and one or more additional agents are administered via any routes of administration disclosed herein or known in the art. [00326] In some embodiments, the one or more additional agents may comprise agents for influenza (e.g., Favipiravir, Fujifilm Toyama Chemical), H IV-1 protease inhibitor (e.g., ritonavir (Abbvie), prezcobix, ASC09 (Ascletis)), FI IV-1 nucleoside analog reverse transcriptase inhibitor (e.g., emtricitabine and tenofovir), hepatitis C virus protease inhibitor (e.g., danoprevir), a neuraminiase inhibitor.
[00327] In some embodiments, the one or more additional agents are remdesivir (Gilead), galidesivir (BioCryst Pharma), umifenovir, vicromax, ISR-50, oseltamivir (Tamiflu), virazole (Bausch Health), EIDD-2801 (Ridgeback Biotherapeutics), clevudine (Levovir), AB001 (Agastiya Biotech), BTL-tml (Beech Tree Labs), DAS181 (Ansun Biopharma), emetine hydrochloride (Acer Therapeutics), AT-527 (Atea Pharma), ruxolitinib (Novartis), transmembrane protease serine 2 (TMPRSS2) inhibitor (e.g., camostat mesylate), an NMDA receptor glutamate receptor antagonist targeting Glu2NB (e.g., ifenprodil (Algernon Pharma)), soluble human angiotensin converting enzyme 2 (e.g., APN01 (Apeiron Biologies)), a defensin mimetic (e.g., Brilacidin (Innovation Pharma)), BXT-25 (Bioxytran), peptide targeting NP protein, Bio-1106 (BioMarck Pharma), sphingosine 1 -phosphate receptor modulator (e.g., fingolimod (Novartis), glucose decoy prodrug (e.g., WP1122 (Moleculin Biotech), nafamostat (University of Tokyo), nanoviride drug, angiotensin II receptor blocker (e.g., valsartan), telmisartan (Boehringer Ingelheim), tissue plasminogen activator (e.g., alteplase (Genentech)), rhu-granulocyte macrophage colony stimulating factor (e.g., sargramostim (Partner Therapeutics)), interleukin-1 receptor antagonist (e.g., anakinra (Swedish Orphan Biovitrum)), aldose reductase inhibitor (e.g., AT-001 (Applied Therapeutics)), multiple myeloma therapies (e.g., plitidepsn (PharmaMar)),
anticoagulant ( e.g ., persantine (dipyridamole)), human plasma gelsolin (rhu-pGSN (Bio-Aegis Therpautics)), molecule based on lectin-like domain of human TNF-alpha {e.g., solnatide (Apeptico)), nitric oxide, P-001 (Panoptes Pharma)), AMRS-1 (ARMS Pharmaceutical)), PUL-042 (Pulmotect), Janus kinase (JAK) inhibitor (e.g., Olumiant (baricitinib, NIAID) and Xeljanz (tofacitinib, Pfizer)), colchicine, anticoagulant (e.g., heparin), glycosaminoglycan derivative of heparin (e.g., dociparstat sodium (Chimerix)), LAU-7b (fenretinide, Laurent Pharma), fenretinide (SciTech), selective inhibitor of nuclear export (SINE) compound (e.g., Xpovio (selinexor) Karyopharm Therapeutics), synthetic small molecule inhibitor of calpain (CAPN 1, 2, and 9, e.g., BLD-2660 (Blade Therapeutics)), Calquence (acalabrutinib), Bruton's tyrosine kinase (BTK) inhibitor, biological immunomodulator (nonpolymorphic regions of CD24 attached to the Fc region of human lgG1 , e.g., CD24Fc (Oncolmmune)), synthetic form of Vasoactive Intestinal Polypeptide (e.g., Aviptadil (NeuroRx)), CGRP receptor antagonist (e.g., vazegepant (Biohaven)), calcium release-activated calcium (CRAC) channel inhibitor (e.g., CM4620-IE (CalciMedica)), ivermectin, nitazoxanide, antiprotozoal, oral formulation of highly purified eicosapentaenoic acid free fatty acid (EPA-FFA) (e.g., EPAspire (KD Pharma)), niclosamide reactive aldehyde species (RASP) inhibitor (e.g., ADX-629 (Aldeyra Therapeutics)), FISP 90 inhibitor (e.g., ADX-1612 (Aldeyra Therapeutics)), IL-15 "superagonist" (e.g., N-803 (ImmuntyBio)), A3 adenosine receptor agonist (e.g., piclidenoson (Can-Fite BioPharma)), skeletal muscle relaxant (e.g., Ryanodex (dantrolene sodium) (Eagle Pharma)), Veyonda (NoxoPharm), MRx-4DP0004 (4D Pharma), EDP1815 (Evelo BioSciences), cyclin- dependent kinase (CDK)2/9 inhibitor (e.g., roscovitine seliciclib (Cyclacel Pharma)), cyclin-dependent kinase (CDK)2/9 inhibitor (e.g., fadraciclib (CYC065) (Cyclacel Pharma)), modulator of neuropilin-2 (e.g., ATYR1923 (aTyr)), sodium-glucose cotransporter 2 (SGLTs) inhibitor (e.g., Farxiga (dapagliflozin) (AstraZeneca)), recombinant human C1 esterase inhibitor (e.g., Ruconest (Pharming)), DIBI iron binding polymer (Chelation Partners), reversible inhibitor of dipeptidyl peptidase 1 (DPP1, e.g., brensocatib (Insmed)), histamine-2 (H2) receptor antagonist (e.g., Pepcid/famotidine), neurokinin-1 receptor antagonista (e.g., tradipitant (Vanda Pharma)), small molecule inhibitor of cytokine release (e.g., GP1681 (Quotient Sciences)), Metablok (Arch Biopartners), kinase inhibitor with specificity for JAK2, IRAKI and CSFIR (e.g., pacritinib (CTI BioPharma)), microbiome therapeutic, transepithelial nebulized alkaline treatment, Coronzot (Silkim Pharma), multivalent
carbohydrate binding molecules ( e.g ., Neumifil (Pneumagen)), AXL kinase inhibitor (. e.g ., bemcentinib (BerGenBio)), inhibitor of phosphodiesterase 4 (PDE4) {e.g., Otezla/apremilast (Amgen)), small molecule macrophase migration inhibitory factor (MIF) inhibitor and phosphodiesterase (PDE) -4 and -10 inhibitor {e.g., MN- 166/ibudilast (MediciNova)), oral sphingosine kinase-2 (SK2) selective inhibitor (opaganib/ABC294640 (RedHill Biopharma)), serine protease inhibitor {e.g., RHB- 107 (RedHill BioPharma)), free biologic made from anti-inflammatory proteins secreted by placental cells {e.g., ST266 (Noveome Biotherapeutics)), an antifibrinolytic {e.g., Lysteda/Cyklokapron (University of Alabama)), senicapoc (Aarhus University), a selective serotonin reuptake inhibitor {e.g., Luvox/fluvoxamine (Washington University), Gleevac (imatinib (Exvastat Limited), ABX464 (Abivax), selective oral dihydroorotate dehydrogenase (DHODH) inhibitor {e.g., IMU-838 (Immunic, Inc.)), and sPIF (synthetic pre implantation factor (Biolncept)).
[00328] In some embodiments, the one or more additional agents comprise an anti-viral compound {e.g., an anti-coronaviral compound). Non-limiting examples of anti-viral agents include an antibody, an inhibitor of viral RNA-dependent RNA polymerase, an inhibitor of a virus-encoded protease (e.g., a protease that affects processing of a viral RNA-dependent RNA polymerase), an inhibitor of viral budding from host cells, an inhibitor of vial release from host cells (e.g., by altering the activity of hemagglutinin-esterase), an inhibitor of viral binding to a cell surface receptor, an inhibitor of receptor-induced conformational changes in virus spike glycoprotein, or an inhibitor of viral entry into cells. In some embodiments, the anti-viral compound is a nucleoside/nucleotide reverse transcriptase inhibitor. In some embodiments, the anti-viral compound is a protease inhibitor. In some embodiments, any anti-viral compounds or anti-viral drug combination disclosed herein or known in the art may be used as an additional agent.
[00329] In some embodiments, the one or more additional agents comprise a cell- based therapy. For example, the cell based therapy may include placenta-based cell therapy (e.g., PLX cell product (PlurStem Therapeutics), mesenchymal stem cells, autologous adipose-tissue derived mesenchymal stem cells (ADMSs), allogenic mesenchymal stem cells (e.g., remestemcel-L (Ryoncil), bone marrow stem cells, allogenic T-cell therapies, natural killer cell-based therapy (e.g., CYNK-001 (Celularity), haNK (ImmunityBio)), allogenic cardiosphere-derived cell therapy (e.g., CAP-1002 (Capricor)), bone marrow-derived mesenchymal stem cells (BM-Allo-
MSC), adipose-derived mesenchymal stem cells, ( e.g ., Astrostem-V (NatureCell)), MSCs and cytokines derived from amniotic fluid {e.g., AmnioBoost Lattice Biologies)), and chimeric antigen receptor (CAR)/T cell receptors (TCR)-T cell therapy.
[00330] In some embodiments, the one or more additional agents comprise a RNA-based treatment. For example, the RNA based therapy may include RNAi, siRNA (e.g., VIR-2703 (Vir Biotech)), rintatolimod (AIM ImmunoTech), TGF-beta antisense drug (e.g., OT-101 (Mateon Therapeutics)), inhaled mRNA, and antisense oligonucleotides.
[00331] In some embodiments, the one or more additional agents comprise a previously identified agent for coronavirus (e.g., agents for a SARS-CoV-1 related disease, disorder, or condition, including one or more symptoms of the disease, disorder, or condition). For example, in some embodiments, the one or more additional agents is an antibody against SARS-CoV-1, e.g., CR022 (Tian et al. , Emerg Microbes Infect. 20209:382-385). In some embodiments, the one or more additional agents is a SARS-associated inflammatory cytokine inhibitor or a tumor necrosis factor (TNF) inhibitor (e.g., a TNF pathway antagonist), nonsteroidal anti inflammatory drugs (NSAIDs), disease-modifying antirheumatic drugs (DMARDs, e.g., hydroxychloroquine, leflunomide, methotrexate, mycophenolate, sulfasalazine), analgesics, topical steroids, systemic steroids (e.g., prednisone), other cytokines, antagonists of inflammatory cytokines (e.g., IL-1, TNF-a, IL-6, IL-12, and IFN-y), antibodies against T cell surface proteins, oral retinoids, salicylic acid, and hydroxyurea.
[00332] In some embodiments, the SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein and/or one or more additional agents may be used to treat, prevent, or alleviate a SARS-CoV-2 related disease, disorder, or condition, including a symptom thereof, for example, a cytokine storm, by inhibiting or suppressing the onset or progression of a cytokine storm. Mechanisms of cytokine storm by pathogenic SARS-CoV are known in the art, and the one or more additional agents may suppress any pathway or mechanism known in the art (see, e.g., Ye Q, Wang B, Mao J. J Infect. 2020;80(6):607-613.) For example, in some embodiments, the SARS-CoV-2 binding agents and/or one or more additional agents may affect high levels of inflammatory cytokines (e.g., IL-1 B, IFN-g, IP-10, and monocyte chemoattractant protein 1 (MCP-1), activation of T-helper type 1 (Th1) cell response,
elevated levels of Th2 cell-secreted cytokines ( e.g ., IL-4 and IL-10), elevated serum levels of IL-2R, IL-6, granulocyte colony-stimulating factor, IP-10, MCP-1, macrophage inflammatory protein-1 A, and TNF-a.
[00333] In some embodiments, the one or more additional agents is an interferon {e.g., IFN-l). In some embodiments, one or more additional agents may activate epithelial cells, reduce the mononuclear macrophage-mediated proinflammatory activity of IFN-ab, inhibit recruitment of neutrophils to the sites of inflammation, and/or activate the anti-viral genes in epithelial cells. In some embodiments, the additional agent is interferon alpha-2b {e.g., Peglntron (Zydus Cadila)), novaferon (Flu’nan Flaiyao hongxingtan Pharmacueticals), interferon beta 1-a {e.g., traumakine (Faron Pharma) and SNG001 (Synairgen)), interferon alpha-1 b, abd peginterferon lambda (Eiger BioPharma).
[00334] In some embodiments, the SARS-CoV-2 binding agents and/or one or more additional agents may affect dysregulated and excessive immune responses, elevated serum cytokine and chemokine levels, elevated number of neutrophils and monocytes in lung tissues and peripheral blood, delayed release of interferons in the early stages of SARS-CoV infection, thereby reducing excessive infiltration of inflammatory cells into lung tissue that leads to lung injury.
[00335] In some embodiments, the one or more additional agents have anti inflammatory functions (e.g., corticosteroids). In some embodiments, the one or more additional agents inhibit excessive inflammation (e.g., during cytokine storm), prevent or inhibit ARDS, and/or protect organ function. Any corticosteroid therapy known in the art is used. For example, in some embodiments, the corticosteroid therapy is methylprednisolone.
[00336] In some embodiments, the one or more additional agents includes an immune substitution and/or immunomodulation therapy (e.g., administration of intravenous immunoglobulin (IVIG)).
[00337] In some embodiments, the one or more additional agents is an inhibitor of IL-1 family cytokines (e.g., IL-1 b, IL-18, and IL-33). In some embodiments the additional agent is an antagonist of IL-1 b (e.g., Anakinra).
[00338] In some embodiments, the one or more additional agents is an inhibitor of IL-6 (e.g., Tocilizumab), a TNF blocker, an IFN-ab inhibitor, chloroquine (e.g., hydroxychloroquine, chloroquine phosphate), ulinastatin, an oxidized phospholipid inhibitor (e.g., eritoran), a sphingosine-1 -phosphate receptor 1 agonist, or an
inhibitors of mononuclear macrophage recruitment and function ( e.g ., small interfering RNA (siRNA)-mediated silencing of C-C chemokine receptor type 2 (CCR2) or TLR7 agonists).
[00339] In some embodiments, the one or more additional agents include stem cell therapy. In some embodiments, the one or more additional agents include a medical device (e.g., blood purification system, respiratory assist systems, cytokine adsorber). In some embodiments, the one or more additional agents include a blood purification system (e.g., plasma exchange, adsorption, perfusion, blood/plasma filtration). In some embodiments, the one or more additional agents strengthen the vascular barrier (e.g., by activation of the endothelial Slit-Robo4 pathway).
[00340] In some embodiments, the one or more additional agents comprise a vaccine. For example, the additional agent may be a replicating bacterial vector vaccine, virus-like particle (VLP) vaccine, RNA-based vaccine, replicating viral vector vaccine (e.g., viral vector expressing RBD or spike), protein subunit vaccine (e.g., RBD-based, S protein subunit, peptide-derived from spike protein), non-replicating viral vector, live attenuated virus, inactivated virus, or DNA-based vaccine.
[00341] In some embodiments, the one or more additional agents comprise an antibody. For example, the one or more additional agents are antibodies that target a coronavirus spike protein, potential mutations of SARS-CoV-2, vascular endothelial growth factor inhibitor (e.g., bevacizumab), programmed cell death protein (PD-1) or PD-L1, CCR5, interleukin-6 receptor (e.g., sarilumab or tocilizumab), granulocyte- macrophage colony stimulating factor, complement, interleukin-1 -beta, interferon gamma, CD147, angiopoietin-2, C5a, granulocyte macrophage colony-stimulating factor (GM-CSF), TLR4, CXC10, CD14, and interleukin 33. In some embodiments, the one or more additional agents comprise hyperimmune globulin (H-IG) or hyperimmune gammaglobulin. In some embodiments, the one or more additional agents may comprise antibodies from recovered COVID-19 patients or an antibody cocktail.
[00342] In some embodiments, the one or more additional agents comprise one or more antibodies (e.g., monospecific or multispecific, including bispecific) with different binding specificities than the SARS-CoV-2 binding agents (e.g., antibodies) as disclosed herein. In some embodiments, one or more additional antibodies may be used in combination with SARS-CoV-2 binding agents (e.g., antibodies) disclosed herein to simultaneously target one or more epitopes and prevent the emergence of
viral escape mutants. For example, one or more epitopes may include regions of SARS-CoV-2 spike glycoprotein ( e.g ., homotrimer, protomer), S1 or S2 domain of SARS-CoV-2 spike glycoprotein, other SARS-CoV proteins, S protein receptors, and/or a receptor binding domain (RBD) of a SARS-CoV-2 spike glycoprotein. [00343] In some embodiments, one or more additional antibodies (e.g., monospecific or multispecific, including bispecific) with binding specificities to a plurality of viral strains (e.g., SARS-CoV-2 strains) may be used in combination with SARS-CoV-2 binding agents disclosed herein to simultaneously target multiple viral strains. In some embodiments, SARS-CoV-2 binding agents disclosed herein and/or one or more additional therapeutic antibodies may bind to a single strain or multiple strains of SARS-CoV-2.
EXAMPLES
EXAMPLE 1. GENERATION OF ANTIBODY CLONES [00344] Recombinant receptor binding domain (RBD) of SARS-CoV-2 spike protein encompassing residues Arg319 to Asn532 (SARS-CoV-2-RBD; SEQ ID NO:27) and carrying a His tag and Avi-tag at the C-terminus and the spike-S1 domain encompassing residues Gln14 to Arg 683 (SEQ ID NO:28) both in biotinylated format (Kactus BioSystems, Woburn MA) were used to screen synthetic fully human antibody libraries displayed on yeast (see, e.g., US Patent No.
10,011 ,829) for antibody clones that bound the RBD. Recombinant SAR-CoV-1 RBD encompassing residues Arg306-Phe527 (SEQ ID NO:29) (Kactus Biosystems) and recombinant human ACE2 extracellular domain encompassing residues Gln18- Ser760 (SEQ ID NO:30) fused to human Fc (Kactus BioSystems) were also used during fluorescence-activated cell sorting (FACS).
[00345] Library screening: The human antibody libraries used for screening were based on five different VH families each combined with four VK libraries and one M library which together in total consist of 100 billion independent antibody clones. Consequently, libraries were split into 6 pools: 1) the VH1-69 combined with all 4 VK libraries (V1-39, 3-15, 3-20 [9 aa in CDR3], 3-20 [10 aa in CDR3]), 2) the VH3-15 combined with all the VK libraries, 3) the VH3-23 combined with the VK libraries, 4) the VH3-30 combined with the VK libraries, 5) the VH4-39 combined with the VK libraries and 6) each of the VH libraries combined with the MX 1-40 library. The six library pools were grown up to 3-fold of the original library titer and induced for
antibody expression and screened in parallel. The screening process involved a preliminary enrichment for antigen-binding antibody clones using magnetic bead activated cell sorting (MACS) followed by FACS. For the initial magnetic bead sorting step, yeast cells were grown and induced to express antibodies culturing in induction medium (0.74 g amino acids without tryptophan, 7 g yeast nitrogen base with ammonium sulfate, 2 g glucose, 20 raffinose, 20 g galactose, 8.4 g NaFI2P04-7FI20 and 7.3 g Na2FIP04, pH 6.25) at 20°C for 16 hours to induce the expression of the scFab. Biotinylated SARS-CoV-2-RBD plus biotinylated SARS-CoV-2-S1 was added in binding buffer (PBS plus 5g/l BSA, but without Ca2+ or Mg2+) to a final concentration of 100 nM each. After incubation with the yeast libraries at room temperature for 1 hr, the cells were incubated on ice for 10 min, washed 3 times with 50 ml binding buffer, followed by incubation with streptavidin-magnetic beads for 10 min on ice. The cells were then washed once with binding buffer and resuspended in binding buffer, before being passed through a magnetic sorting column. After all the cells were had passed through the column, the column was washed 3 times with 7 ml binding buffer. Captured cells were eluted in 10 ml of binding buffer per column by turning off the magnetic field, then pelleted and resuspended in selective medium. The collected cells were grown up and induced for Fab expression as described above and used for a second round of magnetic bead sorting using the same conditions.
[00346] The selected cells were then grown up for further selection by FACS. Fab- expressing yeast cells was were incubated with 100 nM biotinylated SARS-CoV-2- RBD plus 100 nM biotinylated SARS-CoV-2-S1 and bound SARS-CoV-2-RBD and SARS-CoV-2-S1 antigens were detected with phycoerythrin (PE)-conjugated streptavidin, while the displayed Fab was detected with goat anti-human Kappa or Lambda followed by APC-conjugated donkey anti-goat antibody. Double positive cells were identified and collected using a FACSAria II (Becton Dickenson) sorter at a rate of 20,000 events per second. The harvested cells were expanded and used for the next round of sorting that included a presort using biotinylated baculovirus detected with PE-conjugated streptavidin to remove polyspecific (or non-specific, sticky) antibody clones, then taking the antibody-only positive cells and subjecting them to a positive sort in the presence of 100 nM biotinylated SARS-CoV-2-RBD.
The antigen (biotin) and Fab positive cells were collected and then used for a 3rd round of FACS, which was designed to select for the subset of SARS-CoV-2-RBD-
positive antibody clones that could block binding of the human ACE2 receptor to SARS-CoV-2-RBD antigen captured by the antibody clone displayed at the yeast cell surface. For this sort, cells were incubated in the presence of 50 nM biotinylated SARS-CoV-2-RBD detected with PE-conjugated streptavidin and 100 nM human ACE2-FC (ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc) detected with Dylight 647-conjugated goat anti-human Fc (Jackson ImmunoResearch, West Grove PA). Those antibody clones that were positive for SARS-CoV-2-RBD binding (PE) and negative for ACE2-Fc binding (Dylight 647) were collected (FIG. 1).
[00347] The harvested cells were then subjected to a fourth round of FACS using 50 nM biotinylated SARS-CoV-2-S1 detected with PE-conjugated streptavidin and 100 nM human ACE2-Fc (ACE2 residues Gin 18 to Ser740 (SEQ ID NO:30) fused to human Fc) detected with Dylight 647-conjugated goat anti-human Fc. Those antibody clones that were positive for SARS-CoV-2-RBD binding (PE) and negative for ACE2-FC binding (Dylight 647) were collected.
[00348] A final round of FACS was performed to separate the subset of antibody clones expressing antibody that was specific to SARS-CoV-2 RBD from those that expressed antibody that could also bind biotinylated SARS-CoV-1-RBD (residues Arg306 - Phe 537-Avi tag; Kactus Biosystems) at a concentration of 100 nM.
EXAMPLE 2. SELECTION OF ANTIBODY CLONES [00349] The yeast antibody clones isolated from the final two rounds of FACS were plated on selective media plates and incubated at 30°C for 2 days. Individual colonies were randomly picked from the agar plates and grown in selective medium overnight at 30°C. The medium was replaced with induction medium and cells cultured at 20°C overnight to induce the expression of Fab antibodies. In this yeast display system, a significant amount of Fab antibody is secreted into the culture medium in addition to those displayed Fab antibodies on the yeast cell surface. The secreted Fab in the culture medium can be used directly for binding assays.
[00350] A preliminary ELISA was performed to determine binding activity of individual antibody clones to SARS-CoV-1 RBD, SARS-CoV-2 RBD and to baculovirus to identify antibody clones that bound antigen but did not show background binding to baculovirus. A total of 2124 antibody clones were analyzed for SARS-CoV-2 RBD binding and 490 antibody clones from the subset of antibody
clones from the harvested pool that bound SARS-CoV-1 RBD were also analyzed. Only 2 of the antibody clones exhibited non-specific binding to baculovirus.
[00351] To identify antibody clones with potential neutralizing activity, a competition ELISA was performed to determine the ability of the secreted Fab from individual antibody clones to block SARS-CoV-2 RBD binding to immobilized ACE2 receptor. For this assay, 100 ng of human ACE2-Fc in 100 pi PBS was used to coat the wells of Immulon 2 HB ELISA plates at 4°C overnight. The next day, unbound ACE2 receptor was removed, and the wells were blocked with PBS containing 3% BSA for 1 hour at room temperature then washed. The secreted Fab antibodies in 50 mI culture media were mixed with 2 ng of biotinylated SARS-COV-2-RBD or SAR- CoV-1-RBD in 2x binding buffer (0.5 M HEPES, 0.5 M NaCI, 5% BSA, pH 7.5) in a final volume of 100, mI for 30 mins at room temperature, then added to washed ACE2-coated wells. The plates were incubated at 30°C for 1 hr, and the bound biotinylated SARS-RBD detected with HRP-labeled streptavidin (FIG. 2). Inhibition of binding was determined by assessing the ratio of the signal for antigen binding in the presence of the Fab-containing culture media compared to the signal for antigen binding in the presence of yeast culture media alone in the absence of Fab. Antibody clones that yielded a >50% decrease in signal were considered to be inhibitory antibody clones. From a total of 2122 yeast antibody clones tested, 667 expressed Fab that blocked SARS-CoV-2-RBD binding to ACE2-coated wells by >50%. Of these, 205 antibody clones also bound to SARS-CoV-1 RBD. In addition, antibody clones were also tested by ELISA for binding to baculovirus to eliminate those antibody clones exhibiting non-specific binding.
[00352] Yeast antibody clones expressing specific antibody clones that exhibited > 70% inhibition of SARS-CoV-2-RBD binding to ACE2-coated wells were then combined into 5 new plates and the culture media tested for the ability of the secreted Fab to bind to full-length spike protein expressed as a spike-green- fluorescent protein (GFP) fusion in 293 cells, which should more faithfully represent the conformation of native trimeric spike protein on the virus particle than the isolated RBD domain. A vector encoding a full-length spike protein sequence encompassing residues 13-1273 of UniProtKB accession number P0DTC2 (SEQ ID NO:31), that was coupled to green fluorescent protein (GFP) as a reporter (Sino Biologicals, Beijing, China) was used to transiently transfect 293 cells using the Freestyle™ 293 Expression System (ThermoFisher Scientific).
[00353] After 2 days, when a robust GFP signal was observed, aliquots of 80,000 cells per well were transferred to wells of a 96 well plate, pelleted by centrifugation, resuspended in ice cold phosphate-buffered saline containing EDTA and 0.5% BSA, pH 7.4 (PBSM) and blocked for 45 mins at 4°C. After washing, the cells were then incubated in 50 pi Fab-containing culture supernatant from individual yeast antibody clones for 45 mins with rotation at 4°C, washed 3 times in ice-cold PBSM and then bound Fab detected with either goat anti-human kappa-A647 (SouthernBiotech cat# 2060-31) or goat anti-human lambda-A647 (SouthernBiotech cat# 2070-31) The cells were then washed three times with ice cold PBSM, the washed cell pellet resuspended in ice-cold PBSM and the cell-bound Dylight-647 analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius). Both the mean fluorescence intensity (MFI) and percent of positive cells were measured. Of the 394 antibody clones tested, 65 bound to native spike protein. Representative examples of an individual clone with binding activity compared to controls is shown in FIG. 3. [00354] In parallel, a total of 310 antibody clones were selected for sequencing, including the above-referenced 65 antibody clones; 91 unique sequences were identified.
EXAMPLE 3. VIRAL NEUTRALIZATION ACTIVITY [00355] The sixty-three (63) antibody clones that represented the unique antibody clones in the set of 65 testing positive for binding to spike glycoprotein expressed by 293F cells were selected for production as full-length IgGl The light and heavy chains were separately cloned into different expression vectors carrying the constant regions of human lgG1 heavy chain and either the kappa or lambda chain (depending of the VL identity of the isolated antibody clone). The heavy and light chain plasmids were co-transfected into Expi293 suspension cells. Secreted antibody was then purified from the culture supernatants by Protein A chromatography, buffer-exchanged into PBS pH 7.4 and its concentration determined by Nanodrop A280 assay. The quality of each IgG was assessed by SDS-PAGE and by HPLC.
[00356] A viral cytopathic effect (CPE) assay was performed to assess the ability of the 63 selected antibody clones to inhibit cell death of Vero E6 epithelial cells, which naturally express ACE2, upon viral infection in the presence of SARS-CoV-2. For this assay, Vero E6 cells are seeded into wells of a 96-well plate and grown to
confluence then infected with SARS-CoV-2 virus (Washington state SARS-CoV-2 isolate WA1 -F6/2020). After 4 days culture, the cytopathic effect of the virus is clearly visible by microscopy (FIG. 4A).
[00357] First all the antibody clones were screened for neutralizing effect at a concentration of 10 pg/ml. In a fresh plate, each test antibody clone was diluted into DMEM (FlyClone Characterized) with routine antibiotics and supplements (pen/strep, sodium pyruvate, L-glutamine) to give 20 pg/ml in 100 pi. Then 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was added to each well, thus diluting the antibody in each well to 10 pg/ml. The plates were incubated at 37°C with 5% CO2 in a humidified incubator for 1 hour then the media in the wells with the Vero E6 cell monolayers was removed and the antibody- virus mixtures transferred to the corresponding Vero E6 cell wells. One well on the plate had control irrelevant IgG with virus and one well served as the non-virus control well. The plates were incubated for 48 hrs at 37°C with 5% CO2 in a humidified incubator then each well scored by microscopic analysis for the presence of live cells. Out of the 63 antibody clones tested, 12 showed neutralizing activity at 10 pg/ml.
[00358] Next, the assay was repeated with the 12 antibody clones that exhibited neutralizing activity, this time using a log3 dilution series ranging from 10 to 0.0045 pg/ml in triplicate of each of the 12 antibody clones that had exhibited neutralizing activity at 10 pg/ml to determine the lowest concentration that could provide protection from cell death, the IC100 value. After 2 days, the wells were scored for absence or presence of viral-induced cell death. The lowest concentration providing protection from cell death for each of the antibody clones is shown in Table 11. Five antibody clones, clone A, B, C, D and E conferred full protection from cell death at concentrations below 0.4 pg/ml.
[00359] The assay was repeated with the more potent antibody clones using 5 replicates to better define the assay standard error; the data are shown in Table 12. [00360] To define an ICso value for the neutralization activity of each clone, a variation of the assay whereby the effect of cell viability was quantified using a cell viability tracer was performed with antibody clones B, C, F, H and K. For this a colorimetric MTS cell viability assay, CellTitreAq (Promega, Madison, Wl) was performed. Vero E6 were seeded in 96 well plates and grown to confluency. Then 100 pi of the Washington state SARS-CoV-2 isolate WA1-F6/2020 containing 100 TCID50 was mixed with test antibody in DMEM at concentrations ranging from 10 pg/ml to 0.0005 pg/ml and pre-incubated together for 1 hr. The mixture was then added to the wells with confluent Vero E6 cells and the plates cultured for 4 days. A separate set of wells were cultured in the presence of antibody alone. Each condition was run in 5 replicate wells. Then 3 days later the number of viable cells in each well was measured using the CellTitreAq assay according to the manufacturer’s protocol. The ratio of the viable cell signal in the virus+antibody treated wells to the corresponding antibody-only treated wells at each dilution was plotted and the ICso determined using Prism software. The curve fit plots are shown in FIGS. 4B-4D and the ICso values in Table 12, which indicated that antibody clones B, C and F had ICso values in the 10 to 20 ng/ml range.
[00361] The apparent affinity of the most potent antibody clones exhibiting neutralizing activity was determined by ELISA. For the ELISA, wells were coated with 100 ng/well of the test antibody clones overnight at 4°C, washed then blocked in PBS plus 3% BSA. Serial dilutions of biotinylated SARS-CoV-2-RBD, SARS-CoV-1- RBD or irrelevant antigen were added to the relevant wells and incubated for 1 hr at room temperature. Wells were then washed and bound biotinylated antigen detected with HRP-labeled streptavidin. Specific binding (subtracting OD450 values for BSA from OD450 values for the SARS-CoV-2-RBD or SARS-CoV-1-RBD antigen at the same concentration) was plotted and curve fitted using Prism software. The binding curve for Clone B (AvGn-B) is shown in FIG. 5A. The KD values for 11 clones assessed in this assay were determined to range from 0.15 to 0.98 nM (Table 13).
[00362] To assess the apparent avidity effect of the bivalent IgG, the monomeric antigen was coated on the wells and a dilution series of the test antibody clone as lgG1 was added to the wells and incubated for 1 hr at room temperature. Bound IgG was detected with FIRP-labeled goat anti-human IgG (Jackson ImmunoResearch). Specific binding was measured from the OD values adjusted for background signals and plotted as described above. The apparent KD values (apparent avidity) values are summarized in Table 13.
[00363] The ability of the selected antibody clones to inhibit the interaction of the SARS-CoV-2 spike protein RBD with its ACE2 receptor was evaluated by ELISA. For this, wells of a 96-well plate were coated with human-ACE2-Fc as described above. Then, in a separate plate a serial dilution series of each test antibody was pre-mixed with a 2 nM concentration of either biotinylated SARS-CoV-1 RBD or SARS-CoV2-RBD and incubated for 30 mins. The contents were then transferred to the washed ACE-2-Fc coated wells. Wells with plain buffer served as the negative control wells. The plates were incubated at room temperature for 1 hr, washed and bound antigen detected with HRP-labeled streptavidin. The OD values versus test antibody concentration were plotted and curve fitted using Prism software. The ICso curve for Clone B (AvGn-B) is shown in FIG. 5C. The ICso values for 4 clones assessed in this assay ranged from 2.2 nM to 23 nM (Table 13).
[00364] Next the binding kinetics of select antibody clones were assessed by Bio- Layer Interferometry (BLI) assays carried out using a Gator™ instrument (Probe Life, Inc., Palo Alto, CA) with filtered Q-buffer (PBS with 0.2% BSA and 0.02% Tween-20) at a temperature of 30°C. After establishing a baseline, test lgG1 antibodies at 1pg/ml (200mI per well) were captured onto six ProtG probes until a wavelength shift of approximately 1 nm were observed on the Gator sensorgram. After reestablishing baseline, binding of captured antibody to biotinylated SARS-CoV-2 RBD (Kactus Biosystems; Lot #030201) analyte (200mI per well) were measured via separate association (Six concentrations (1 per well) consisting of a 3-fold serial dilution range of 138.9 - 0.57 nm) and dissociation steps. Non-specific binding events, to probe or an irrelevant control antibody, were monitored in two separate wells and reference
subtracted from each test antibody sensorgram. Antibody Kon, Koff and KD values were determined using Gator software through global fitting of the data to a 1:1 binding model. The data are shown in Table 14.
[00365] To assess the affinity to native spike protein, the binding affinity to full- length native spike protein expressed on transiently transfected 293 cells expressing spike-GFP protein was determined as follows. Following transfection as described above, cells were harvested and washed with ice cold PBSM (phosphate-buffered saline containing EDTA and 0.5% BSA). The cells were blocked in PBSM for 45 min at 4°C with rotation. The cells were transferred to a 96-well plate (80,000 cells/well) and pelleted by centrifugation. Anti-SARS-CoV-2-RBD, control IgGs or ACE2-Fc were each serially diluted in ice cold PBSM, and the cell pellets were resuspended and incubated in these IgG/PBSM solutions for 45 min at 4°C with rotation. After the incubation, the cells were washed three times with ice cold PBSM by centrifugation then resuspended in fresh buffer. The washed cell pellets were then resuspended and incubated in the dark, at 4 °C with rotation in PBSM containing goat anti-hlgG- Fc-APC (Jackson ImmunoResearch Laboratories, Inc.cat# 109-135-098) or goat anti-hlgG-Fc-A647 (Jackson ImmunoResearch Laboratories, cat# 109-605-008). The cells were then washed three times with ice cold PBSM and the washed cell pellet resuspended in ice cold PBSM and analyzed using an IntelliCyt® iQue Screener PLUS and ForeCyt Software (Sartorius). The data was then fitted to a one-site binding algorithm to calculate the apparent KD using Prism software (GraphPad, San Diego, CA). The curves of Clone B (AvGn-B) compared to ACE2-Fc binding to 293- cells expressing SARS-CoV-2 measured as mean fluorescence intensity (MFI) are shown in FIG. 5B. As shown in FIG. 5B and Table 15, ACE2-Fc bound to the Spike expressing cells with a KD value of 4.7nM, similar to the reported affinity of ACE2 for
the SARS-CoV-2 spike protein, indicating that the expressed spike protein had adopted a functional conformation. All the antibody clones evaluated exhibited KD values ranging from 0.04 to 4.86, with the majority <0.6 nM as shown in Table 15. However, two antibody clones exhibited some slight background binding to irrelevant antigen transfected cells, and one clone, clone E, exhibited clear cut binding to non- transfected cells with a measurable KD of 6.8 mM. This and clone D had also shown non-specific binding in ELISA.
EXAMPLE 5. BIOPHYSICAL PROPERTIES [00366] HPLC analysis of 6 antibody clones indicated that they showed a single discrete peak consistent with monomeric IgG. Thermostability analysis of the 6 antibody clones was performed using by differential scanning fluorimetry (DSF). All DSF assays were carried out using the LightCycler 480 II Real-Time PCR instrument (Roche Applied Science, (Pleasanton, CA)) with filtered PBS buffer. Each test antibody was mixed with 100x SYPRO Orange solution (Invitrogen) to give a final concentration of 1.6mM protein and 20x SYPRO Orange. Twenty-five microliters of this mixture were then added to each well of a white LightCycler 48096-well plate. The plate was heated from 20°C to 99°C at a rate of 2.4°C/min, and the resulting fluorescence data were collected. The negative first derivative of the melt curve was calculated, and the minima values were defined as melting temperatures (Tm). Where multiple unfolding transitions were observed, the first (lowest) melting
transition was reported as Tm1 , the next lowest as Tm2 and in some cases the third as Tm3. Data collection and derivative calculation were carried out using the LightCycler software. The values obtained for the selected antibody clones, shown in Table 16, indicated that the selected antibody clones had stable thermostability profiles, with 5 of the 6 antibody clones analyzed showing two melting transition temperatures and 1 of the 6 antibody clones showing 3; Tm1 is assumed to be associated with the dissociation of CH2, and Tm2 to be associated with Fab/CH3 dissociation. Tm3 for clone C most likely represents Fab dissociation.
EXAMPLE 6. IN VIVO EFFICACY
[00367] A large scale preparation of Clone B (AvGn-B) was generated as described in Example 3. An aliquot of the purified Clone B (AvGn-B) lgG1 was then tested for endotoxin levels using a Limulus Amoebocyte Lysate (LAL) assay (ThermoFisher Scientific, catalogue # A39552) to ensure endotoxin content per dose was well below the threshold that could trigger untoward effects in vivo.
[00368] Syrian hamsters were chosen to test the effects of Clone B (AvGn-B) on a SARS-CoV-2 related disease, disorder, or condition as they are regarded as suitable models because of the close resemblance of their response (e.g., susceptibility, pathogenesis, pulmonary pathology, clinical features) to SARS-CoV-2 infection and the response of SARS-Cov-2 infected subjects (e.g., human SARS-CoV-2 infected patients). In these experiments, male Syrian hamsters (n=20, 10 weeks of age, obtained from Charles River Laboratory) were held in the animal facility and provided access to standard pelleted feed and water ad libitum prior to being moved into the biosafety-level 3 facility for experimental challenge with SARS-CoV-2. Of the 20 hamsters, 18 were intranasally infected with 2.5x104 TCID50/mL equivalents of SARS-CoV-2 (strain 2019-nCoV/USA-WA1/2020) and divided into treatment groups
as follows: “Clone B (AvGn-B) High” (2.5mg Clone B (AvGn-B)) (n=5), “Clone B (AvGn-B) Low” (1 mg Clone B (AvGn-B)) (n=5), “Untreated” (no antibody) (n=6), and “Ab Control” (2.5 mg isotype control lgG1) (n=2). Two uninfected hamsters received 2.5 mg Clone B (AvGn-B) (termed “Uninfected”). Each animal was dosed intraperitoneally with corresponding treatment at 24 and 72 hours post-infection (hpi). At 24, 48, 72, 96, and 120 hpi, each hamster was weighed and assessed for presence of clinical signs (lethargy, ruffled fur, hunched back posture, nasolacrimal discharge, and rapid breathing). At 120 hpi (5 days post-infection [dpi]), each hamster was anesthetized with isoflurane and then euthanized via cardiac exsanguination and blood was collected.
[00369] At 2 dpi, infected hamsters appeared quiet and began to progressively lose weight over the course of the study (up to ~13% reduction in untreated animals compared to uninfected controls). There was significantly less weight loss associated with Clone B (AvGn-B) treatment (P<0.0001) (FIG. 6A). None of the hamsters in the study died or met euthanasia criteria prior to study termination at 5 dpi. There was a significant reduction in viral RNA measured by qPCR in lung lavage samples from hamsters treated with Clone B (AvGn-B) (both 2.5 mg and 1 mg doses) compared to the samples from infected hamsters that were untreated (p = 0.0173 and 0.0303, respectively) (FIG. 6B).
[00370] The lungs were then extirpated en bloc and fixed whole in 10% neutral buffered formalin for at least 3 days to ensure virus inactivation before processing for histological analysis. Four transverse whole-lung sections per animal were stained with fast red and slides were counterstained with hematoxylin or processed for IHC. [00371] All lung sections were digitalized using a Nikon Eclipse 80i microscope and Nikon Digital Sight DS-FI1 camera (Nikon instruments, USA). Quantitative and qualitative microscopic analysis was determined using micrographs and morphological methods to quantify pulmonary lesions with the use of NIS-Elements (Nikon, Americas, USA).
[00372] Lungs from the two (2) uninfected AvGn-B treated hamsters did not show significant bronchiolar or parenchymal inflammation. Distal trachea and main stem bronchi contained microscopic hemorrhages and there were variable degrees of iatrogenic atelectasis, especially in cranial and middle portions of the lungs. Occasional peribronchiolar lymphoid follicles of moderate cellularity were present around bronchioles. Other organs, namely, tracheobronchial and hilar lymph nodes,
heart and kidneys were within normal histologic limits. In virus-infected and untreated hamsters, approximately 50-75% of lung parenchyma, especially the inner parenchyma (i.e. , peribronchial lung tissue), was consolidated, dark red and heavier than outer inflated lung parenchyma. Massive cellular infiltrates of predominantly macrophages, 60-70%, intermixed with neutrophils, lymphocytes and plasma cells partially filled the lumina of terminal bronchioles and adjacent alveolar and perivascular spaces to varying degrees. In the most affected lobes, there was near complete obliteration of air spaces ( FIG 7A, panel B) compared to lungs from uninfected hamsters (FIG. 7A, panel A). The lungs from hamsters dosed with 1 mg Clone B (AvGn-B) (FIG. 7A, panel D) showed much less area with consolidation and cellular infiltrates compared to the untreated viral infected hamster or hamster treated with 2.5 mg isotype control IgG (FIG. 7A, panel C). In lungs of hamsters treated with Clone B (AvGn-B), the consolidated areas with cellular infiltrates were greatly reduced, focused mainly around the major bronchi and bronchioles with normal areas of alveolar spaces towards the periphery (FIG. 7A, panel D).
[00373] To better quantitate the differences observed visually, FI&E sections were manually screened for pattern recognition of affected versus unaffected pulmonary parenchyma. At least 6 representative regions of interest (ROI) were defined (1088 x 816 pm) and subjectively delineated (annotated) by a trained single veterinary pathologist based upon hypercellularity and consolidation of alveolar spaces. Manual annotation was compiled for digital quantification of affected areas of the lung to compare individual hamsters. Data were expressed as mean (±SEM). Statistical analyses were performed using one-way ANOVA multiple comparison test p values less than 0.05 were considered significant. Florizontal whole-lung slides of consecutive planes of SARS-CoV-2-infected and antibody-treated lungs were digitalized by Olympus histoslide scanner to create image data files that can be used for further digital image analysis (DIA). Analysis of the ROIs for bronchiointerstitial pneumonia confirmed that there was a statistically significant dose dependent decrease in the SARS-CoV-2 viral infected lungs from animals treated with Clone B (AvGn-B) compared to untreated infected animals (FIG. 7B).
[00374] When lung sections were stained for SARS-CoV-2 nucleocapsid protein, the lungs from infected untreated animals or animals treated with control lgG1 (Ab Control) had extensive immunoreactivity throughout the lung (FIG. 8, panels A and C) while infected animals treated with 1 mg/hamster of Clone B (AvGn-B) showed
markedly reduced levels of immunostaining (FIG. 8, panel B) and in infected animals treated with 2.5 mg/hamster the parenchyma of the lungs was essentially clear of staining for virus, with the staining that was present occurring around the bronchi and blood vessels (FIG. 8, panel D).
[00375] To assess the effect of Clone B (AvGn-B) treatment on infiltrating macrophages and SARS-CoV-2 virus, paraffin embedded tissue sections were co stained for SARS-CoV-2 nucleocapsid protein (1:500) and ionized calcium binding adaptor molecule 1 (IBA1 , Abeam catalogue number ab5076; at a dilution of 1 :50), a marker for monocytes and macrophages using a Leica Bond RXm automated staining instrument following permeabilization using 0.01% Triton X diluted in Tris- buffered saline (TBS). Blocking was performed with 1% donkey serum diluted in TBS. Sections were stained for DAP I (Sigma) and images were captured using an Olympus BX63 fluorescence microscope equipped with a motorized stage and Flamamatsu ORCA-flash 4.0 LT CCD camera. Images were collected with Olympus cellSens software (v 1.18). Regions of interest (ROIs) were drawn around the perimeter of each tissue section and intensity thresholds were kept constant across groups analyses were performed blinded. Co-localization and intensity measurements were obtained using the Count and Measure feature of cellSens. [00376] Lungs were examined for the extent of macrophage infiltration and SARS- CoV-2 viral load at 5 days post infection by histopathological examination and by immunofluorescence imaging. High-resolution scans of whole mount lungs revealed pan-lobular replication of SARS-CoV-2 and largely centrilobular infiltration of IBA-1 + macrophages. Treatment with Clone B (AvGn-B) resulted in a dose dependent reduction, and treatment with 2.5 mg resulted in a dramatic decrease in the presence of IBA-1+ macrophages throughout the lung. The percent of total lung area displaying macrophage hypercellularity was quantified (FIG. 9A) and reflected the observed decrease in total hypercellular lung area in animals infected with SARS- CoV-2 and treated with increasing concentrations of Clone B (AvGn-B) (FIG. 8). [00377] These findings were confirmed by co-immunofluorescence imaging for macrophages (IBA-1+ cells) and SARS-CoV-2. Quantification of the number of IBA- 1+ cells co-localizing with SARS-CoV-2 (FIG. 9B), revealed similar trends and indicated that animals infected with SARS-CoV-2 and treated with 1 or 2.5 mg Clone B (AvGn-B) had a marked decrease in infiltration of IBA-1+ macrophages and a corresponding decrease in lung tissue pathology.
EXAMPLE 7. GENERATION OF VARIANT ANTIBODIES
[00378] To generate variants of Clone B (AvGn-B), an antibody engineering campaign was performed. For this, a focused library of Clone B (AvGn-B) was built whereby changes were introduced at key CDR residues, 1 mutation per CDR per antibody clone, based on the CDR amino acid usage observed in a large database of naturally occurring human antibody sequences for the specific VH and VL subfamilies from which Clone B (AvGn-B) is derived . While any one clone will have a maximum of 6 mutations, the focused library as a whole covers more than 1 billion variants. The library was displayed on yeast, screened as described above in Example 1 and individual clone supernatants analyzed as described in Example 2. Selected clones were then produced as full-length IgG from Expi-293 cell cultures and tested in the cytopathic effect assay as described in Example 3.
[00379] The seven clones analyzed exhibited an approximately 1.5 to 2-fold improvement in affinity for the recombinant SARS-CoV-2-RBD antigen but a 5.6 to 8.5-fold improvement in ICso values for their ability to inhibit SARS-CoV-2-RBD- binding to ACE2-Fc compared to the parental Clone B (AvGn-B) clone (Table 17). Four of the clones were tested for their ability to block SARS-CoV-2 viral infection and cell death in the Vero-E6 CPE assay. Two of the four clones, B-H 1 and B-H2, showed a 5-fold improvement in ICso values, similar to the improvement in their ability to block SARS-CoV-2-RBD binding to ACE2-Fc receptor, while Clone AvGn- B-G4 exhibited an approximately 8-fold increase and Clone B-G2 (AvGn-B-G2) exhibited an almost 30-fold increase in potency in the CPE viral neutralization assay compared to the parental Clone B (AvGn-B) clone (Table 18) despite both clones having a similar ICso values for their ability to block the RBD-ACE2 interaction as clones B-H 1 and B-FI2. The apparent affinity of Clone B-G2 (AvGn-B-G2) binding to native SARS-CoV-2 spike protein expressed by transfected 293 cells was determined. Despite the increased potency of Clone B-G2 (AvGn-B-G2) in the CPE assay, it exhibited a similar affinity for native SARS-CoV-2 spike protein to that of the parental Clone B (AvGn-B) for the native spike protein expressed by 293 cells (Table 17). Neither clone exhibited binding to non-transfected 293 cells. In this experiment the apparent affinity of the ACE2-Fc protein binding to spike protein was 10.9 nM.
Table 17
EXAMPLE 8. AVIDITY FOR SARS-CoV-2 RBD MUTANTS
[00380] Several new strains of the SARS-CoV-2 virus have been identified with mutations in the RBD region. The following recombinant RBD domains (Arg306 - Phe527 of SARS-CoV-2 spike protein) of five such mutant strains were obtained from AcroBiosystems: N354D (cat.# SPD-S52H5), V367F (cat.# SPD-S52H4), R408I (cat.# SPD-S52H8), W436R (cat.# SPD-S52H7) and N354D + D364Y (cat.# SPD- S52H3). The apparent avidity of Clone B (AvGn-B) and the optimized variants of Clone B (AvGn-B) for these variant RBDs antigens compared to the original SARS- CoV-2 RBD was determined by ELISA. The different RBD proteins were coated onto separate wells of 96-well plates and serial dilutions of purified IgG were added to the relevant wells and bound antibody detected with HRP-labeled goat-anti-human IgG as described above. The apparent KD values (apparent avidity) are summarized in Table 19. There were no meaningful differences in avidity either between clones or for any given clone to the different mutant SARS-CoV-2 RBD proteins.
TABLE 19
[00381] Additional new strains of the SARS-CoV-2 virus have been identified with mutations in the RBD region. These include the SARS-CoV-2 B.1.1.7, B.1.427 and P.1 variants which carry mutations that have been linked to increased transmissibility, namely the N501Y, K417N and E484K mutations. Therefore, antibody clones were tested for their apparent avidity for recombinant RBD domains carrying either N501Y (Sino Biological, cat.# 40592-V08H82), K417N (Sino Biological, cat.# 40592-V08H59) and E484K (Sino Biological, cat.# SPD-S52H3) mutations compared to the original RBD by ELISA as described above. Serial dilutions of antibody ranging from 20 nM to 0.00026 nM were added to the relevant wells and bound antibody detected with HRP-labeled goat-anti-human IgG as described above. The apparent KD values (apparent avidity) of the different antibody clones are summarized in Table 20. All the antibody clones tested bound with similar affinity to the N501Y and K417N mutant RBDs as to the original RBD. In the case of the E484K variant RBD, the Clone B (AvGn-B) family of clones exhibited a slight decrease in avidity to the E484K mutant RBD, although the apparent KD was still in the sub-nM to nM range. In contrast, Clone C (AvGn-C) showed weak binding and Clone F (AvGn-F) showed no detectable binding above background to the E484K variant RBD. These results indicate that the E484 residue within the RBD is important for Clone C (AvGn-C) and Clone F (AvGn-F) binding.
TABLE 20
EXAMPLE 9. EPITOPE BINNING
[00382] To determine whether antibody clones, for example, Clone B (AvGn-B), Clone C (AvGn-C), and Clone F (AvGn-F), bound to distinct or overlapping epitopes within the 221 amino acid SARS-CoV-2 RBD, a competition ELISA was performed. For this, wells of a 96-well plate were coated with 150 ng/well of each clone, 4 wells per antibody to create a 3 by 4 matrix. Then a separate aliquot of each antibody clone (final concentration 100 nM) was incubated in the presence of 10 nM biotinylated SARS-CoV-2 RBD for 1 hour at room temperature, then added to wells and incubated for a further hour. The binding in the absence of inhibitor, was determined using buffer plus the biotinylated antigen alone. After washing, biotinylated SARS-CoV-2 RBD bound to the coated antibody in the well was detected with FIRP-labeled streptavidin. The percent inhibition was determined by comparing the OD reading in the presence of the competing antibody clone to the OD reading obtained in the absence of competitor. As shown in Table 21, all three antibody clones tested could compete effectively for antigen binding to each other, indicating that the antibody clones recognized overlapping epitopes within the RBD.
TABLE 21
EMBODIMENTS
1. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and/or
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
2. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
3. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
4. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
5. The antibody or fragment thereof of embodiment 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRX1 TYLA (SEQ ID NO: 115) wherein Xi is S, G or D; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and/or
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
6. The antibody or fragment thereof of embodiment 5, wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
7. The antibody or fragment thereof of embodiment 5, wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
8. The antibody or fragment thereof of embodiment 5, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
9. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
10. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
11. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
12. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
13. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
14. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
15. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
16. The antibody or fragment thereof of any one of embodiments 1 -8, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
17. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
18. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
19. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
20. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
21. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
22. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 19; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
23. The antibody or fragment thereof of embodiment 17, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
24. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
25. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
26. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:8; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:10;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
27. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:2; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
28. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:16;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:11; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
29. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:19; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:22; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
30. The antibody or fragment thereof of embodiment 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:24; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:5; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
31. The antibody or fragment thereof of any one of embodiments 17-30, wherein the VH region comprises an amino acid sequence of SEQ ID NO:25 and the VL region comprises an amino acid sequence of SEQ ID NO:26.
32. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
33. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
34. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
35. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
36. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
37. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
38. The antibody or fragment thereof of embodiment 32, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32 and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
39. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
40. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
41. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:37;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:39;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
42. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:33; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
43. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:41 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:42;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:43.
44. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:45;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:47.
45. The antibody or fragment thereof of embodiment 39, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:32
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:34;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:36.
46. The antibody or fragment thereof of any one of embodiments 32-45, wherein the VH region comprises an amino acid sequence of SEQ ID NO:49 and the VL region comprises an amino acid sequence of SEQ ID NO:50.
47. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
48. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
49. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
50. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
51. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
52. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
53. The antibody or fragment thereof of embodiment 47, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52 and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
54. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
55. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:53; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
56. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:38; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
57. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:51; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
58. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
59. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:44; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
60. The antibody or fragment thereof of embodiment 54, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:48; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
61. The antibody or fragment thereof of any one of embodiments 47-60, wherein the VH region comprises an amino acid sequence of SEQ ID NO:56 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
62. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
63. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
64. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
65. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
66. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:62; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
67. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
68. The antibody or fragment thereof of embodiment 62, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
69. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
70. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
71. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:60;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:61; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
72. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:59; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
73. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:62;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
74. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:63; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
75. The antibody or fragment thereof of embodiment 69, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:58;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:64; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
76. The antibody or fragment thereof of any one of embodiments 62-75, wherein the VH region comprises an amino acid sequence of SEQ ID NO:65 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
77. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
78. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
79. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
80. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
81. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
82. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
83. The antibody or fragment thereof of embodiment 77, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
84. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
85. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
86. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
87. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
88. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:70; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:71.
89. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:73; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:74.
90. The antibody or fragment thereof of embodiment 84, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:67; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:68.
91. The antibody or fragment thereof of any one of embodiments 77-90, wherein the VH region comprises an amino acid sequence of SEQ ID NO:76 and the VL region comprises an amino acid sequence of SEQ ID NO:77.
92. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
93. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
94. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
95. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
96. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:81; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
97. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:82; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
98. The antibody or fragment thereof of embodiment 92, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
99. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
100. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
101. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:79;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:69; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:10;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
102. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:80;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:66; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
103. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:81;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:16;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
104. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:82;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:72; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NQ:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
105. The antibody or fragment thereof of embodiment 99, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:78;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:75; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
106. The antibody or fragment thereof of any one of embodiments 92-105, wherein the VH region comprises an amino acid sequence of SEQ ID NO:83 and the VL region comprises an amino acid sequence of SEQ ID NO:84.
107. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
108. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
109. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
110. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
111. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:92; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
112. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:93; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
113. The antibody or fragment thereof of embodiment 107, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
114. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
115. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
116. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:88;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:89; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:53;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
117. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:91;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:86; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
118. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:92;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:54;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:17.
119. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:93;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:94; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:55;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:95; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:23.
120. The antibody or fragment thereof of embodiment 114, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:85;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:96; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:52;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:87; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:6.
121. The antibody or fragment thereof of any one of embodiments 107-120, wherein the VH region comprises an amino acid sequence of SEQ ID NO:97 and the VL region comprises an amino acid sequence of SEQ ID NO:98.
122. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
123. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
124. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 101; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 10; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
125. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 12; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
126. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 13; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 14; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 16; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
127. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 18; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NQ:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
128. The antibody or fragment thereof of embodiment 122, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
129. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
130. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
131. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:7;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:101 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:9;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:10;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
132. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:12;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:99; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
133. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:13;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:14; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:15;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:16;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:40; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:102.
134. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:18;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 103; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:21;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:46; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 104.
135. The antibody or fragment thereof of embodiment 129, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:1 ;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 105; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:3;
and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:4;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:35; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:100.
136. The antibody or fragment thereof of any one of embodiments 122-135, wherein the VH region comprises an amino acid sequence of SEQ ID NO: 106 and the VL region comprises an amino acid sequence of SEQ ID NO: 107.
137. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131, 136, and 141 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121, 127, 133, and 138; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
138. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
139. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 124; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 125; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 127; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
140. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 129; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 119; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
141. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 130; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 133; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 128; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
142. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 135; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 138; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
143. The antibody or fragment thereof of embodiment 137, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:118; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 122; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
144. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:118, 124, 129, 130, 135;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131 , 136, 141 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, 137; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:121 , 127, 133, 138;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:122, 128, 139; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, 140.
145. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:118;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:122; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
146. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:124;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:125; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:126; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:127;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:128; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
147. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:129;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:119; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:121 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:122; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
148. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:130;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 131 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:132; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:133;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:128; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO: 134.
149. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:135;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 136; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:137; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:138;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 139; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:140.
150. The antibody or fragment thereof of embodiment 144, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 118;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 141 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:120; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 121 ;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:122; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:123.
151. The antibody or fragment thereof of any one of embodiments 137-150, wherein the VH region comprises an amino acid sequence of SEQ ID NO:142 and the VL region comprises an amino acid sequence of SEQ ID NO: 143.
152. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151 , 156, 161 , and 166; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
153. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 147; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
154. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 150; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 151; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 153; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
155. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 154; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 147; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
156. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 155; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 158; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
157. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 160; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 161; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 163; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
158. The antibody or fragment thereof of embodiment 152, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144; and/or
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and/or
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO: 147; and/or
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and/or
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
159. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151, 156, 161 , and 166; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
160. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
161. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:150;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:151 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:152; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:153;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
162. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 154;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 145; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
163. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:155;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 156; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:157; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:158;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO:90; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:159.
164. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO:160;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO:161 ; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO:162; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:163;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 164; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:165.
165. The antibody or fragment thereof of embodiment 159, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of SEQ ID NO: 144;
(2) a VH CDR2 having the amino acid sequence of SEQ ID NO: 166; and
(3) a VH CDR3 having the amino acid sequence of SEQ ID NO: 146; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of SEQ ID NO:147;
(2) a VL CDR2 having the amino acid sequence of SEQ ID NO: 148; and
(3) a VL CDR3 having the amino acid sequence of SEQ ID NO:149.
166. The antibody or fragment thereof of any one of embodiments 152-165, wherein the VH region comprises an amino acid sequence of SEQ ID NO:167 and the VL region comprises an amino acid sequence of SEQ ID NO: 168.
167. An antibody or fragment thereof that competes for binding to SARS-CoV- 2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino
acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino acid sequence of SEQ ID NO:76 and a light chain variable region having an amino acid sequence of SEQ ID NO:77; (vi) a heavy chain variable region having an amino acid sequence of SEQ ID NO:83 and a light chain variable region having an amino acid sequence of SEQ ID NO:84; (vii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:97 and a light chain variable region having an amino acid sequence of SEQ ID NO:98; and/or (viii) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 106 and a light chain variable region having an amino acid sequence of SEQ ID NO: 107; and/or (B)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and a light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (C)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and a light chain variable region having an amino acid sequence of SEQ ID NO: 168.
168. The antibody or fragment thereof of embodiment 167 that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO:143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and the light chain variable region having an amino acid sequence of SEQ ID NO:168.
169. An antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and
a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 107; (ix) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143; or (x) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
170. The antibody or fragment thereof of embodiment 169 that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; or (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:107.
171. The antibody or fragment thereof of embodiment 169 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 143.
172. The antibody or fragment thereof of embodiment 169 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 168.
173. The antibody or fragment thereof of any one of embodiments 1 -172, wherein the VH region and/or VL region further comprises human framework sequences.
174. The antibody or fragment thereof of any one of embodiments 1 -172, wherein the VH region and/or VL region further comprises a framework 1 (FR1). a framework 2 (FR2), a framework 3 (FR3) and/or a framework 4 (FR4) sequence.
175. The antibody or fragment thereof of any one of embodiments 1 -174, wherein the antibody is a monoclonal antibody.
176. The antibody or fragment thereof of any one of embodiments 1-175, wherein the monoclonal antibody is a humanized, human or chimeric antibody.
177. The antibody or fragment thereof of any one of embodiments 1 -176, wherein the antibody or fragment thereof is a Fab, Fab’, F(ab’)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable region antibody, single variable region antibody, linear antibody, V region, or a multispecific antibody formed from antibody fragments.
178. The antibody or fragment thereof of any one of embodiments 1 -177, wherein the antibody or fragment thereof is conjugated to a detectable marker.
179. The antibody or fragment thereof of embodiment 178, wherein the detectable marker is selected from a radioisotope, a metal chelator, an enzyme, a fluorescent compound, a bioluminescent compound and a chemiluminescent compound.
180. The antibody or fragment thereof of any one of embodiments 1 -173, wherein the binding to SARS-CoV-2 blocks the interaction of SARS CoV and an ACE-2 receptor.
181. One or more vectors comprising one or more polynucleotides encoding the antibody or fragment thereof of any one of embodiments 1 -179.
182. A composition that comprises the antibody or fragment thereof of any one of embodiments 1 -180.
183. An antibody or fragment thereof that binds to essentially the same epitope as the antibody or fragment thereof of any one of embodiments 1 -180 or that competes for the binding of the antibody or fragment thereof of any one of embodiments 1-180 to SARS-CoV-2.
184. A method treating, preventing, or ameliorating a SARS-CoV-2 related disease, disorder, or condition comprising administering to a subject in need thereof
an effective amount of the antibody or fragment thereof of any one of embodiments 1-174.
185. The method of embodiment 184, wherein the method further comprises administering to the subject an additional agent.
[00383] While example embodiments have been particularly shown and described, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the embodiments encompassed by the appended claims.
[00384] From the foregoing, it will be appreciated that, although specific embodiments have been described herein for the purpose of illustration, various modifications may be made without deviating from the spirit and scope of what is provided herein. All of the references referred to above are incorporated herein by reference in their entireties.
ADDITIONAL SEQUENCES
SARS-CoV-2 spike protein sequence (UniProt P0DTC2) receptor binding domain (RBD) (residues Arg319 to Asn532):
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFS TFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTG CVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFN CYFPLQSYGFQPTNGVGYQPYRVWLSFELLHAPATVCGPKKSTN (SEQ ID NO:27)
Bolded and underlined amino acids represent mutations sites (N354D, D364Y, V367F, R408I, W436R, N501Y, K417N, E484K) within the RBD {see, e.g., Example 8, including Tables 19-20).
SARS-CoV-2 spike protein sequence (UniProt P0DTC2) S1 domain; residues Gln14 to Arg683:
QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIH
VSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNV
VIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG
KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPL
SETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAW
NRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQI
APGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFER
DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVWLSFELLHAPA
TVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRD
PQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRV
YSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR (SEQ ID
NO:28)
SARS-CoV-1 spike protein sequence (UniProt P59594) receptor binding domain (RBD) (residues Arg306-Phe527):
RWPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFF STFKCYGVSATKLNDLCFSNVYADSFWKGDDVRQIAPGQTGVIADYNYKLPDDFM GCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALN C YWP L N D YG FYTTTG I GYQ P YR WVLS F E L L N AP ATVC GPKLSTDLIKNQCVNF (SEQ ID NO:29)
Human ACE2 sequence (UniProt Q9BYF1) (residues Gln18 -Ser740):
QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAF
LKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYST
GKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEY
WLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYE
HLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVT
DAM VD QAWDAQ R I F KEAE KF FVSVG LP NMTQGFWE N SM LTD PG N VQ KAVC H PTA
WDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEA
VGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRW
MVFKGEIPKDQWMKKWWEMKREIVGWEPVPHDETYCDPASLFHVSNDYSFIRYY
TRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALEN
WGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSA
LGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFN
FFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
(SEQ ID NO:30)
SARS-CoV-2 spike protein sequence (UniProt P0DTC2) residues 13 to 1273:
SQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAI
HVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATN
WIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQ
TLLALHRSYLTPGDSSSGWFAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDP
LSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVR
QIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPF
ERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRWVLSFELLHA
PATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV
RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTW
RVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVAS
QSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTE
CSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQI
LPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPP
LLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQ
KLIANQFNSAIGKIQDSLSSTASALGKLQDWNQNAQALNTLVKQLSSNFGAISSVLN
DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQ
SKRVDFCGKGYHLMSFPQSAPHGWFLHVTYVPAQEKNFTTAPAICHDGKAHFPR
EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDWIGIVNNTVYDPLQPELDSF
KEELDKYFKNHTSPDVDLGDISGINASWNIQKEIDRLNEVAKNLNESLIDLQELGKY
EQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE
PVLKGVKLHYT (SEQ ID NO:31 )
Claims
1. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and/or
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
2. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
3. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of
RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
4. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO: 108) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO: 109) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RAS Q S VRXi TYLA (SEQ ID NO:110) wherein Xi is a naturally occurring amino acid;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO: 111 ) wherein Xi and X2 are each independently a naturally occurring amino acid; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO:112) wherein Xi, X2, and X3 are each independently a naturally occurring amino acid.
5. The antibody or fragment thereof of claim 1 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H; and/or
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and/or
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D; and/or
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and/or
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
6. The antibody or fragment thereof of claim 5, wherein the antibody or fragment thereof comprises a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3).
7. The antibody or fragment thereof of claim 5, wherein the antibody or fragment thereof comprises a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRXiTYLA (SEQ ID NO: 115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
8. The antibody or fragment thereof of claim 5, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having the amino acid sequence of GGX1X2SSX3GIS (SEQ ID NO:113) wherein Xi is T or S, X2 is F or L, and X3 is Y, S or H;
(2) a VH CDR2 having the amino acid sequence of GIIPIFDX1X2NYAQKFX3G (SEQ ID NO:114) wherein Xi is T, R or V, X2 A, I, L or V, and X3 is Q or R; and
(3) a VH CDR3 having the amino acid sequence of YYVGWGWFDV (SEQ ID NO:3), and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having the amino acid sequence of RASQSVRX1TYLA (SEQ ID NO:115) wherein Xi is S, G or D;
(2) a VL CDR2 having the amino acid sequence of X1AX2SRAT (SEQ ID NO:116) wherein Xi is S, G or D, and X2 is S or T; and
(3) a VL CDR3 having the amino acid sequence of QQYX1SX2PX3T (SEQ ID NO: 117) wherein Xi is A or S, X2 A or L, and X3 is Y or F.
9. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
10. The antibody or fragment thereof of claim 9, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:2, 8, 14, 19 and 24; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:5, 11 , and 22; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
11. The antibody or fragment thereof of claim 9 or 10, wherein the VH region comprises an amino acid sequence of SEQ ID NO:25 and the VL region comprises an amino acid sequence of SEQ ID NO:26.
12. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
13. The antibody or fragment thereof of claim 12, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 32, 37, and 41 ;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 33, 38, 44, and 48; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:34, 39, 42, and 45;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:36, 43, and 47.
14. The antibody or fragment thereof of claim 12 or 13, wherein the VH region comprises an amino acid sequence of SEQ ID NO:49 and the VL region comprises an amino acid sequence of SEQ ID NO:50.
15. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
16. The antibody or fragment thereof of claim 15, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 38, 44, 48, and 51 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
17. The antibody or fragment thereof of claim 15 or 16, wherein the VH region comprises an amino acid sequence of SEQ ID NO:56 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
18. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
19. The antibody or fragment thereof of claim 18, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 18, 58, 60, and 62;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 59, 61 , 63, and 64; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
20. The antibody or fragment thereof of claim 18 or 19, wherein the VH region comprises an amino acid sequence of SEQ ID NO:65 and the VL region comprises an amino acid sequence of SEQ ID NO:57.
21. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
22. The antibody or fragment thereof of claim 21 , wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15, and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:67, 70, and 73; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:68, 71, and 74.
23. The antibody or fragment thereof of claim 21 or 22, wherein the VH region comprises an amino acid sequence of SEQ ID NO:76 and the VL region comprises an amino acid sequence of SEQ ID NO:77.
24. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
25. The antibody or fragment thereof of claim 24, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:78, 79, 80, 81, and 82;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 66, 69, 72, and 75; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16 and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
26. The antibody or fragment thereof of claim 24 or 25, wherein the VH region comprises an amino acid sequence of SEQ ID NO:83 and the VL region comprises an amino acid sequence of SEQ ID NO:84.
27. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
28. The antibody or fragment thereof of claim 27, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:85, 88, 91 , 92, and 93;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 86, 89, 94, and 96; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:52, 53, 54, and 55;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:87, 90, and 95; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:6, 17, and 23.
29. The antibody or fragment thereof of claim 27 or 28, wherein the VH region comprises an amino acid sequence of SEQ ID NO:97 and the VL region comprises an amino acid sequence of SEQ ID NO:98.
30. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:1 , 7, 12, 13, and 18; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and/or
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
31. The antibody or fragment thereof of claim 30, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 7, 12, 13, and 18;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 14, 99, 101, 103, and 105; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:3, 9, 15 and 20; and
(b) a light chain variable (VL) region comprising:
(1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:4, 10, 16, and 21 ;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:35, 40, and 46; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 100, 102, and 104.
32. The antibody or fragment thereof of claim 30 or 31 , wherein the VH region comprises an amino acid sequence of SEQ ID NO: 106 and the VL region comprises an amino acid sequence of SEQ ID NO: 107.
33. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 118, 124, 129, 130, and 135; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 119, 125, 131, 136, and 141 ; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, and 137; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 121, 127, 133, and 138; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 122, 128, and 139; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, and 140.
34. The antibody or fragment thereof of claim 33, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:118, 124, 129, 130, 135;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:119, 125, 131 , 136, 141 ; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 120, 126, 132, 137; and
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO:121 , 127, 133, 138;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:122, 128, 139; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 123, 134, 140.
35. The antibody or fragment thereof of claim 33 or 34, wherein the VH region comprises an amino acid sequence of SEQ ID NO: 142 and the VL region comprises an amino acid sequence of SEQ ID NO: 143.
36. An antibody or fragment thereof that binds to SARS-CoV-2, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160; and/or
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151, 156, 161 , and 166; and/or
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and/or
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163; and/or
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and/or
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
37. The antibody or fragment thereof of claim 36, wherein the antibody or fragment thereof comprises:
(a) a heavy chain variable (VH) region comprising:
(1 ) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 144, 150, 154, 155, and 160;
(2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO: 145, 151, 156, 161 , and 166; and
(3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 146, 152, 157, and 162; and
(b) a light chain variable (VL) region comprising:
(1 ) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NO: 147, 153, 158, and 163;
(2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NO:90, 148, and 164; and
(3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO: 149, 159, and 165.
38. The antibody or fragment thereof of claim 36 or 37, wherein the VH region comprises an amino acid sequence of SEQ ID NO:167 and the VL region comprises an amino acid sequence of SEQ ID NO: 168.
39. An antibody or fragment thereof that competes for binding to SARS-CoV- 2 with an antibody comprising: (A)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and a light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:49 and a light chain variable region having an amino acid sequence of SEQ ID NO:50; (iii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:56 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (iv) a heavy chain variable region having an amino acid sequence of SEQ ID NO:65 and a light chain variable region having an amino acid sequence of SEQ ID NO:57; (v) a heavy chain variable region having an amino
acid sequence of SEQ ID NO:76 and a light chain variable region having an amino acid sequence of SEQ ID NO:77; (vi) a heavy chain variable region having an amino acid sequence of SEQ ID NO:83 and a light chain variable region having an amino acid sequence of SEQ ID NO:84; (vii) a heavy chain variable region having an amino acid sequence of SEQ ID NO:97 and a light chain variable region having an amino acid sequence of SEQ ID NO:98; and/or (viii) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 106 and a light chain variable region having an amino acid sequence of SEQ ID NO: 107; and/or (B)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and a light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (C)(i) a heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and a light chain variable region having an amino acid sequence of SEQ ID NO: 168.
40. The antibody or fragment thereof of claim 39 that competes for binding to SARS-CoV-2 with the antibody comprising: (i) the heavy chain variable region having an amino acid sequence of SEQ ID NO:25 and the light chain variable region having an amino acid sequence of SEQ ID NO:26; (ii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 142 and the light chain variable region having an amino acid sequence of SEQ ID NO: 143; and/or (iii) the heavy chain variable region having an amino acid sequence of SEQ ID NO: 167 and the light chain variable region having an amino acid sequence of SEQ ID NO: 168.
41. An antibody or fragment thereof that binds to SARS-CoV-2 and that comprises: (i) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL
CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 107; (ix) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:143; or (x) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:168.
42. The antibody or fragment thereof of claim 41 that comprises: (i) VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:25, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:26; (ii) a VH CDR1 , a VH CDR2, a VH CDR3 as set forth in SEQ ID NO:49, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:50; (iii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:56, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (iv) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:65, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:57; (v) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:76, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:77; (vi) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:83, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:84; (vii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:97, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:98; or (viii) a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO: 106, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO:107.
43. The antibody or fragment thereof of claim 41 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:142, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 143.
44. The antibody or fragment thereof of claim 41 that comprises: a VH CDR1 , a VH CDR2, and a VH CDR3 as set forth in SEQ ID NO:167, and/or a VL CDR1 , a VL CDR2, and a VL CDR3 as set forth in SEQ ID NO: 168.
45. The antibody or fragment thereof of any one of claims 1 -44, wherein the VH region and/or VL region further comprises human framework sequences.
46. The antibody or fragment thereof of any one of claims 1 -44, wherein the VH region and/or VL region further comprises a framework 1 (FR1 ). a framework 2 (FR2), a framework 3 (FR3) and/or a framework 4 (FR4) sequence.
47. The antibody or fragment thereof of any one of claims 1 -44, wherein the antibody is a monoclonal antibody.
48. The antibody or fragment thereof of any one of claims 1 -47, wherein the monoclonal antibody is a humanized, human or chimeric antibody.
49. The antibody or fragment thereof of any one of claims 1 -48, wherein the antibody or fragment thereof is a Fab, Fab’, F(ab’)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable region antibody, single variable region antibody, linear antibody, V region, or a multispecific antibody formed from antibody fragments.
50. The antibody or fragment thereof of any one of claims 1 -49, wherein the antibody or fragment thereof is conjugated to a detectable marker.
51 The antibody or fragment thereof of claim 50, wherein the detectable marker is selected from a radioisotope, a metal chelator, an enzyme, a fluorescent compound, a bioluminescent compound and a chemiluminescent compound.
52. The antibody or fragment thereof of any one of claims 1 -51 , wherein the binding to SARS-CoV-2 blocks the interaction of SARS CoV and an ACE-2 receptor.
53. One or more vectors comprising one or more polynucleotides encoding the antibody or fragment thereof of any one of claims 1-51.
54. A composition that comprises the antibody or fragment thereof of any one of claims 1-52.
55. An antibody or fragment thereof that binds to essentially the same epitope as the antibody or fragment thereof of any one of claims 1 -52 or that competes for the binding of the antibody or fragment thereof of any one of claims 1- 52 to SARS-CoV-2.
56. A method treating, preventing, or ameliorating a SARS-CoV-2 related disease, disorder, or condition comprising administering to a subject in need thereof an effective amount of the antibody or fragment thereof of any one of claims 1-52.
57. The method of claim 56, wherein the method further comprises administering to the subject an additional agent.
Applications Claiming Priority (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063031565P | 2020-05-28 | 2020-05-28 | |
US202063031564P | 2020-05-28 | 2020-05-28 | |
US202063031560P | 2020-05-28 | 2020-05-28 | |
US63/031,560 | 2020-05-28 | ||
US63/031,565 | 2020-05-28 | ||
US63/031,564 | 2020-05-28 | ||
US202063081893P | 2020-09-22 | 2020-09-22 | |
US63/081,893 | 2020-09-22 |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2021243185A2 WO2021243185A2 (en) | 2021-12-02 |
WO2021243185A3 WO2021243185A3 (en) | 2021-12-23 |
WO2021243185A9 true WO2021243185A9 (en) | 2022-01-27 |
Family
ID=78722876
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2021/034810 WO2021243185A2 (en) | 2020-05-28 | 2021-05-28 | Sars-cov-2 binding agents and uses thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2021243185A2 (en) |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10131704B2 (en) * | 2014-04-25 | 2018-11-20 | Dana-Farber Cancer Institute, Inc. | Middle east respiratory syndrome coronavirus neutralizing antibodies and methods of use thereof |
-
2021
- 2021-05-28 WO PCT/US2021/034810 patent/WO2021243185A2/en active Application Filing
Also Published As
Publication number | Publication date |
---|---|
WO2021243185A2 (en) | 2021-12-02 |
WO2021243185A3 (en) | 2021-12-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111690058B (en) | Antibodies with neutralizing activity against coronaviruses and uses thereof | |
JP7171809B2 (en) | Antibodies that potently neutralize hepatitis B virus and uses thereof | |
JP5800809B2 (en) | TLR3 binding agent | |
CN113544148B (en) | Antibody for neutralizing hepatitis B virus and use thereof | |
WO2021218879A1 (en) | Sars-cov-2 neutralizing antibody and preparation and use thereof | |
JP2023534923A (en) | Antigen-binding molecule targeting SARS-CoV-2 | |
KR20230016186A (en) | Method for treating inflammatory diseases by galectic-3 blockade | |
KR20230035217A (en) | 2019 Novel Coronavirus Humanized Monoclonal Antibodies and Uses Thereof | |
WO2021063352A1 (en) | Anti-pd-l1 antigen binding protein, and application thereof | |
JP2023534922A (en) | Antigen-binding molecule targeting SARS-CoV-2 | |
WO2013184200A1 (en) | Human monoclonal antibodies against human chemokine receptor ccr7 | |
US20220380441A1 (en) | Antibody compositions and methods for treating hepatitis b virus infection | |
WO2021237516A1 (en) | Sars-cov-2 antibody and application thereof | |
US20240092872A1 (en) | Compositions and methods for treating hepatitis b virus infection | |
WO2021244601A1 (en) | Neutralizing antibody of sars-cov-2 virus and application thereof | |
JP2024518335A (en) | Human neutralizing monoclonal antibodies against SARS-CoV-2 and their uses | |
WO2021243185A9 (en) | Sars-cov-2 binding agents and uses thereof | |
EP4164673A2 (en) | Methods and compositions related to neutralizing antibodies against human coronavirus | |
TW202102204A (en) | Pharmaceutical composition comprising anti-il-5 antibody and uses thereof | |
WO2021190500A1 (en) | Preparation and application of cross-neutralizing antibody of sars-cov-2 and sars-cov | |
CN113164601B (en) | Isolated antigen binding proteins and uses thereof | |
CN113166264B (en) | Isolated antigen binding proteins and uses thereof | |
TW202229333A (en) | Coronavirus-binding molecules and methods of use thereof | |
KR20230123477A (en) | Methods for treating or preventing acute respiratory distress syndrome | |
WO2022051223A1 (en) | Use of sars-cov-2 receptor binding motif (rbm)-reactive monoclonal antibodies to treat covid-19 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21812449 Country of ref document: EP Kind code of ref document: A2 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 21812449 Country of ref document: EP Kind code of ref document: A2 |