WO2021188729A1 - Compositions and methods for the targeting of c9orf72 - Google Patents
Compositions and methods for the targeting of c9orf72 Download PDFInfo
- Publication number
- WO2021188729A1 WO2021188729A1 PCT/US2021/022840 US2021022840W WO2021188729A1 WO 2021188729 A1 WO2021188729 A1 WO 2021188729A1 US 2021022840 W US2021022840 W US 2021022840W WO 2021188729 A1 WO2021188729 A1 WO 2021188729A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- gna
- casx
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0306—Animal model for genetic diseases
- A01K2267/0318—Animal model for neurodegenerative disease, e.g. non- Alzheimer's
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/50—Physical structure
- C12N2310/53—Physical structure partially self-complementary or closed
- C12N2310/531—Stem-loop; Hairpin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- ALS Amyotrophic lateral sclerosis
- FTD frontotemporal dementia
- ALS is a fatal neurodegenerative disease characterized clinically by progressive paralysis leading to death from respiratory failure, typically within two to three years of symptom onset, and is the third most common neurodegenerative disease in the Western world (Rowland and Shneider, N. Engl. J. Med., 2001, 344, 1688-1700; Hirtz et al., Neurology, 2007, 68, 326-337).
- FTD is the second most common cause of pre-senile dementia in which degeneration of the frontal and temporal lobes of the brain results in progressive changes in personality, behavior, and language with relative preservation of perception and memory (Graff-Radford, N and Woodruff, B. Frontotemporal dementia.
- Chromosome 9 open reading frame 72 protein is a protein encoded by the C9orf72 gene (sometimes also referred to as C9orf72-SMCR8 complex subunit). Forms of disease related to mutations or abnormalities in the C9orf72 gene include FTD and ALS. The protein is found in many regions of the brain, including the cytoplasm of neurons, as well as in presynaptic terminals.
- the relevant mutation in the C9orf72 gene in connection with FTD and ALS is a hexanucleotide repeat expansion of the six letter string of nucleotides GGGGCC that occurs is located either in intron 1, between two 5’ -untranslated region (5’-UTR) exons, or in the promoter region of the C9orf72 gene (DeJesus-Hernandez, M., et al. Expanded GGGGCC hexanucleotide repeat in noncoding region of C90RF72 causes chromosome 9p-linked FTD and ALS. Neuron 72: 245 (2011); Niblock, M., et al.
- compositions and methods for controlling C9orf72 in subjects with C9orf72- related diseases are provided herein.
- the present disclosure provides compositions of modified Class 2, Type V CRISPR proteins and guide nucleic acids used in the editing of chromosome 9 open reading frame 72(C9orf72) gene target nucleic acid sequences.
- the Class 2 Type V CRISPR proteins and guide nucleic acids are modified for passive entry into target cells.
- the Class 2 Type V CRISPR proteins and guide nucleic acids are useful in a variety of methods for target nucleic acid modification of C9orf72- related diseases, which methods are also provided.
- the present disclosure relates to CasX:guide nucleic acid systems (CasX:gNA system) and methods used to alter a target nucleic acid comprising the C9orf72 gene with one or more mutations or that comprises the hexanucleotide repeat sequence expansion (HRS) in cells.
- CasX:gNA system CasX:guide nucleic acid systems
- HRS hexanucleotide repeat sequence expansion
- the CasX:gNA system has utility in knocking-down or knocking-out a C9orf72 gene with one or more mutations or that comprises the hexanucleotide repeat sequence expansion (HRS), in order to reduce or eliminate expression of the C9orf72 gene product, accumulation of the RNA from the HRS, and/or the DPR in subjects having a C9orf72- related disease.
- the CasX:gNA system has utility in correcting the C9orf72 gene comprising the HRS.
- the gNA is a gRNA, or a gDNA, or a chimera of RNA and DNA, and may be a single-molecule gNA or a dual -molecule gNA.
- the CasX:gNA system gNA has a targeting sequence complementary to a target nucleic acid sequence comprising a region within the C9orf72 gene.
- the targeting sequence of the gNA is selected from the group consisting of SEQ ID NOS: 309-343, 363-2100, 2295-2185, or a sequence having at least about 65%, at least about 75%, at least about 85%, or at least about 95% identity thereto.
- the gNA can comprise a targeting sequence comprising 14 to 30 consecutive nucleotides. In some embodiments, the targeting sequence of the gNA consists of 21 nucleotides. In other embodiments, the targeting sequence of the gNA consists of 20 nucleotides. In other embodiments, the targeting sequence consists of 19 nucleotides, the targeting sequence of the gNA having a sequence selected from the group consisting of SEQ ID NOS: 309-343, 363-2100, 2295-2185 with a single nucleotide removed from the 3' end of the sequence.
- the targeting sequence consists of 18 nucleotides, having a sequence selected from the group consisting of SEQ ID NOS: 309-343, 363-2100, 2295-2185 with two nucleotides removed from the 3’ end of the sequence. In other embodiments, the targeting sequence consists of 17 nucleotides, having a sequence selected from the group consisting of SEQ ID NOS: 309-343, 363-2100, 2295-2185 with three nucleotides removed from the 3’ end of the sequence.
- the targeting sequence consists of 16 nucleotides, having a sequence selected from the group consisting of SEQ ID NOS: 309-343, 363-2100, 2295-2185 with four nucleotides removed from the 3’ end of the sequence. In other embodiments, the targeting sequence consists of 15 nucleotides, having a sequence selected from the group consisting of SEQ ID NOS: 309-343, 363-2100, 2295-2185 with five nucleotides removed from the 3’ end of the sequence.
- the gNA has a scaffold comprising a sequence selected from the group consisting of SEQ ID NOS: 4-16 and 2101-2294, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto.
- the Class 2, Type V CRISPR protein comprises a reference CasX protein having a sequence of any one of SEQ ID NOS: 1-3, a CasX variant protein having a sequence selected from the group consisting of SEQ ID NOS: 49-150, 233-235, 238-239, 240-242, and 272-281, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto.
- a CasX variant exhibits one or more improved characteristics relative to the reference CasX protein.
- the CasX protein has binding affinity for a protospacer adjacent motif (PAM) sequence selected from the group consisting of TTC, ATC, GTC, and CTC.
- PAM protospacer adjacent motif
- the CasX protein has binding affinity for the PAM sequence that is at least 1.5-fold greater compared to the binding affinity of any one of the CasX proteins of SEQ ID NOS: 1-3 for the PAM sequences selected from the group consisting of TTC, ATC, GTC, and CTC.
- the CasX molecule and the gNA molecule are associated together in a ribonuclear protein complex (RNP).
- RNP ribonuclear protein complex
- the RNP comprising the CasX variant and the gNA variant exhibits greater editing efficiency and/or binding of a target sequence in the target DNA when any one of the PAM sequences TTC, ATC, GTC, or CTC is located 1 nucleotide 5’ to the non-target strand sequence having identity with the targeting sequence of the gNA in a cellular assay system compared to the editing efficiency and/or binding of an RNP comprising a reference CasX protein and a reference gNA in a comparable assay system.
- the system further comprises a donor template comprising a nucleic acid comprising at least a portion of a C9orf72 gene, wherein the C9orf72 gene portion is selected from the group consisting of a C9orf72 exon, a C9orf72 intron, a C9orf72 intron-exon junction, a C9orf72 regulatory element, or combinations thereof, wherein the donor template is used to knock down or knock out the C9orf72 gene or is used to correct the mutation in the C9orf72 gene.
- the donor template comprises a hexanucleotide repeat of a GGGGCC sequence wherein the number of repeats ranges from 10 to about 30 repeats and is utilized to replace the hexanucleotide repeat expansion of the mutant C9orf72 gene.
- the donor sequence is a single-stranded DNA template or a single stranded RNA template. In other cases, the donor template is a double-stranded DNA template.
- the disclosure relates to nucleic acids encoding the systems of any of the embodiments described herein, as well as vectors comprising the nucleic acids.
- the vector is selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a herpes simplex virus (HSV) vector, a plasmid, a minicircle, a nanoplasmid, and an RNA vector.
- the vector is a virus-like particle (VLP) comprising an RNP of a CasX and gNA of any of the embodiments described herein and, optionally, a donor template nucleic acid and a targeting moiety such as a viral-derived glycoprotein.
- VLP virus-like particle
- the disclosure provides a method of modifying a C9orf72 target nucleic acid sequence of cells of a population, wherein said method comprises introducing into the cell: a) CasX:gNA system of any of the embodiments disclosed herein; b) the nucleic acid of any of the embodiments disclosed herein; c) the vector of any of the embodiments disclosed herein; d) the VLP of any of the embodiments disclosed herein; or e) a combination of the foregoing, wherein the C9orf72 gene target nucleic acid sequence of the cells targeted by the first gNA is modified by the CasX protein, introducing a single- or double-stranded break in the target nucleic acid sequence.
- the method further comprises a second gNA or a nucleic acid encoding the second gNA, wherein the second gNA has a targeting sequence complementary to a different portion of the target nucleic acid sequence.
- the modifying comprises introducing an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides in the target nucleic acid sequence as compared to the wild-type sequence.
- the method further comprises contacting the target nucleic acid with a donor template nucleic acid of any of the embodiments disclosed herein.
- the target C9orf72 gene for modification comprises more than 30, more than 100, more than 500, more than 700, more than 1000, or more than 1600 copies of a hexanucleotide repeat sequence GGGGCC.
- the donor template comprises a nucleic acid comprising at least a portion of a C9orf72 gene for correcting (by knocking in) the mutation of the C9orf72 gene, or comprises a sequence comprising a mutation or heterologous sequence for knocking-down or knocking out the mutant C9orf72 such that expression of the HRS or the DPR by the cells of the population is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to a cell where the that has not been modified.
- the modifying of the target nucleic acid sequence occurs in vivo.
- the cell is a eukaryotic cell selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a primate cell, a and a non-human primate cell.
- the cell is a human cell.
- the cell is a selected from the group consisting of a Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the disclosure provides methods of modifying a C9orf72 target nucleic acid in a population of cells of a subject wherein the target cells are contacted using vectors encoding the CasX protein and one or more gNAs comprising a targeting sequence complementary to the C9orf72 gene, and optionally further comprising a donor template.
- the vector is an Adeno- Associated Viral (AAV) vector selected from AAVl, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAVl 2, AAV 44.9, AAV-Rh74, or AAVRhlO.
- the vector is a lentiviral vector.
- the disclosure provides methods wherein the target cells are contacted using a vector wherein the vector is a virus-like particle (VLP) comprising an RNP of a CasX and gNA of any of the embodiments described herein and, optionally, a donor template nucleic acid.
- VLP virus-like particle
- the vector is administered to a subject at a therapeutically effective dose.
- the subject can be a mouse, rat, pig, non-human primate, or a human.
- the dose can be administered by a route of administration selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
- a route of administration selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
- the disclosure provides a method of treating a C9orf72- related disorder in a subject, comprising modifying a gene encoding C9orf72 gene in cells of the subject, the modifying comprising contacting said cells with: a) CasX:gNA system of any of the embodiments disclosed herein; b) the nucleic acid of any of the embodiments disclosed herein; c) the vector of any of the embodiments disclosed herein; d) the VLP of any of the embodiments disclosed herein; or e) a combination of the foregoing wherein the C9orf72 gene of the cells targeted by the first gNA is modified by the CasX protein.
- the subject is selected from the group consisting of mouse, rat, pig, non-human primate, and human.
- the C9orf72- related disorder is ALS or FTD.
- the methods of treating a subject with a C9orf72- related disease result in improvement in at least one clinically- relevant parameter. In other cases, the methods of treating a subject with a C9orf72- related disease result in improvement in at least two clinically-relevant parameters.
- the disclosure provides compositions for use in a method of treating a C9orf72- related disorder in a subject.
- the method comprises modifying a gene encoding C9orf72 gene in cells of the subject, the modifying comprising contacting said cells with compositions selected from: a) CasX:gNA system of any of the embodiments disclosed herein; b) the nucleic acid of any of the embodiments disclosed herein; c) the vector of any of the embodiments disclosed herein; d) the VLP of any of the embodiments disclosed herein; or e) a combination of the foregoing wherein the C9orf72 gene of the cells targeted by the first gNA is modified by the CasX protein.
- the subject is selected from the group consisting of mouse, rat, pig, non-human primate, and human.
- the C9orf72- related disorder is ALS or FTD.
- the methods of treating a subject with a C9orf72- related disease result in improvement in at least one clinically- relevant parameter. In other cases, the methods of treating a subject with a C9orf72- related disease result in improvement in at least two clinically-relevant parameters.
- FIG. 1 shows an SDS-PAGE gel of CasX StX2 purification fractions visualized bycolloidal Coomassie staining, as described in Example 1.
- FIG. 2 shows a chromatogram from a size exclusion chromatography assay of the CasX StX2, using of Superdex 200 16/600 pg Gel Filtration, as described in Example 1.
- FIG. 3 shows an SDS-PAGE gel of CasX StX2 purification fractions visualized by colloidal Coomassie staining, as described in Example 1.
- FIG. 4 is a schematic showing the organization of the components in the pSTX34 plasmid used to assemble the CasX constructs, as described in Example 2.
- FIG. 5 is a schematic showing the steps of generating the pSTX34 plasmid with a CasX 119 variant, as described in Example 2.
- FIG. 6 shows an SDS-PAGE gel of purification samples, visualized on a Bio-Rad Stain-FreeTM gel, as described in Example 2.
- FIG. 7 shows the chromatogram of Superdex 200 16/600 pg Gel Filtration, as described in Example 2.
- FIG. 8 shows an SDS-PAGE gel of gel filtration samples, stained with colloidal Coomassie, as described in Example 2.
- FIG. 9 is a graph of the results of an assay for the quantification of active fractions of RNP formed by sgRNA174 and the CasX variants 119, 457, 488 and 491, as described in Example 13. Equimolar amounts of RNP and target were co-incubated and the amount of cleaved target was determined at the indicated timepoints. Mean and standard deviation of three independent replicates are shown for each timepoint. The biphasic fit of the combined replicates is shown. “2” refers to the reference CasX protein of SEQ ID NO: 2. [0029] FIG.
- FIG. 10 shows the quantification of active fractions of RNP formed by CasX2 (reference CasX protein of SEQ ID NO:2) and the modified sgRNAs, as described in Example 13. Equimolar amounts of RNP and target were co-incubated and the amount of cleaved target was determined at the indicated timepoints. Mean and standard deviation of three independent replicates are shown for each timepoint. The biphasic fit of the combined replicates is shown. [0030]
- FIG. 11 shows the quantification of active fractions of RNP formed by CasX 491 and the modified sgRNAs under guide-limiting conditions, as described in Example 13. Equimolar amounts of RNP and target were co-incubated and the amount of cleaved target was determined at the indicated timepoints. The biphasic fit of the data is shown.
- FIG. 12 shows the quantification of cleavage rates of RNP formed by sgRNA174 and the CasX variants, as described in Example 13.
- Target DNA was incubated with a 20-fold excess of the indicated RNP and the amount of cleaved target was determined at the indicated time points. Mean and standard deviation of three independent replicates are shown for each timepoint, except for 488 and 491 where a single replicate is shown. The monophasic fit of the combined replicates is shown.
- FIG. 13 shows the quantification of cleavage rates of RNP formed by CasX2 and the sgRNA variants, as described in Example 13.
- Target DNA was incubated with a 20-fold excess of the indicated RNP and the amount of cleaved target was determined at the indicated time points. Mean and standard deviation of three independent replicates are shown for each timepoint. The monophasic fit of the combined replicates is shown.
- FIG. 14 shows the quantification of initial velocities of RNP formed by CasX2 and the sgRNA variants, as described in Example 13. The first two time-points of the previous cleavage experiment were fit with a linear model to determine the initial cleavage velocity.
- FIG. 15 shows the quantification of cleavage rates of RNP formed by CasX491 and the sgRNA variants, as described in Example 13.
- Target DNA was incubated with a 20-fold excess of the indicated RNP at 10°C and the amount of cleaved target was determined at the indicated time points. The monophasic fit of the timepoints is shown.
- FIGS. 16A-16D show the quantification of cleavage rates of CasX variants on NTC PAMs, as described in Example 14.
- Target DNA substrates with identical spacers and the indicated PAM sequence were incubated with a 20-fold excess of the indicated RNP at 37°C and the amount of cleaved target was determined at the indicated time points. Monophasic fit of a single replicate is shown.
- FIG. 16A shows the results for sequences having a TTC PAM.
- FIG. 16B shows the results for sequences having a CTC PAM.
- FIG. 16C shows the results for sequences having a GTC PAM.
- FIG. 16D shows the results for sequences having a ATC PAM.
- FIG. 17 is a schematic showing an example of CasX protein and scaffold DNA sequence for packaging in adeno-associated virus (AAV), as described in Example 23.
- AAV adeno-associated virus
- ITRs AAV inverted terminal repeats
- FIG. 18 shows the results of an editing assay comparing gRNA scaffolds 229-237 to scaffold 174 in mouse neural progenitor cells (mNPC) isolated from the Ai9-tdtomato transgenic mice.
- mNPC mouse neural progenitor cells
- FIG. 19 shows the results of an editing assay comparing gRNA scaffolds 229-237 to scaffold 174 in mNPC cells.
- Cells were nucleofected with the indicated doses of p59 plasmids encoding CasX 491, the scaffold, and spacer 12.7 (5’ CUGCAUUCUAGUUGUGGUUU 3’,
- SEQ ID NO: 362 targeting repeat elements preventing expression of the tdtomato fluorescent protein. Editing was assessed 5 days post-transfection by FACS, to quantify the fraction of tdTomato positive cells. Cells nucleofected with scaffolds 231-235 displayed approximately 35% greater editing compared to constructs with scaffold 174 at the high dose, and approximately 25% greater editing at the low dose.
- FIG. 20 shows the results of an editing assay comparing CasX nucleases 2, 119, 491, 515, 527, 528, 529, 530, and 531 in a custom HEK293 cell line, PASS_V1.01.
- Cells were lipofected with 2 pg of p67 plasmid encoding the indicated CasX protein. After five days, cell genomic DNA was extracted. PCR amplification and Next-Generation Sequencing was performed to isolate and quantify the fraction of edited cells at custom designed on-target editing sites.
- FIG. 21 shows the results of an editing assay comparing improved CasX nuclease 491 to improved nucleases 532 and 533 in a custom HEK293 cell line, PASS V1.01.
- Cells were lipofected, in duplicate, with 2 pg of p67 plasmid encoding the indicated CasX protein and a puromycin resistance gene, and grown under puromycin selection. After three days, cell genomic DNA was extracted. PCR amplification and Next-Generation Sequencing was performed to isolate and quantify the fraction of edited cells at custom designed on-target editing sites.
- FIG. 22 is a schematic of a portion of the 5’ region of the C9orf72 locus.
- the top diagram shows the relative locations of the exon la and exon lb, which flank the hexanucleotide repeat element (HRE) while the open boxes indicate downstream exons.
- the lower diagram shows the regions of the locus that are targeted by (complementary to) the targeting segments (spacers) of the guide RNA of Table 15, as described in Example 18.
- FIG. 23 is a graph showing results of a single cut experiment using targeting sequence 164 to introduce edits in Exon la, as described in Example 18.
- the black deletion trace indicates for every position in the amplicon and the fraction of reads that have a deletion at that position. Gray bars at the bottom of the graph indicate the sgRNA binding site position.
- Quantification window indicates region used for quantification of deletions. Predicted cleavage position is the location of CasX induced double-stranded break.
- the deletion traces illustrate rates and extent of genetic deletions generated by the single guides delivered, resulting in an overall deletion efficiency of 65.4%.
- the data are representative of the results observed for single cuts (Table 15).
- FIG. 24 is a graph showing results of a double cut experiment using targeting sequences (spacers) 138 and 151, which targeting sequences that flank the hexanucleotide repeat element (HRE, also sometimes referred to herein as the hexanucleotide repeat sequence expansion, or HRS) at positions 193-248 in the reference amplicon, as described in Example 18.
- the black deletion trace indicates for every position in the amplicon the fraction of reads that have a deletion at that position.
- Gray bars at the bottom of the graph indicate the sgRNA binding site position.
- the quantification window indicates the region used for quantification of deletions.
- the predicted cleavage position is the location of CasX induced double-stranded break.
- the overall deletion efficiency was 45.4%, and was representative of the results observed for double cuts (Table 16), supporting that, under the conditions of the experiment, the HRE can be deleted using the double-cut design.
- FIG. 25 is a pair of graphs of an experiment testing the effects of spacer length on ability to edits target nucleic acid in Jurkat cells, as described in Example 26. The results demonstrate that shorter spacers of 18 or 19 support increased activity compared to a spacer of 20 bases in ex vivo editing by RNP.
- polynucleotide and nucleic acid refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- terms “polynucleotide” and “nucleic acid” encompass single-stranded DNA; double- stranded DNA; multi-stranded DNA; single-stranded RNA; double-stranded RNA; multi- stranded RNA; genomic DNA; cDNA; DNA-RNA hybrids; and a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- Hybridizable or “complementary” are used interchangeably to mean that a nucleic acid (e.g., RNA, DNA) comprises a sequence of nucleotides that enables it to non-covalently bind, i.e., form Watson-Crick base pairs and/or G/U base pairs, "anneal”, or “hybridize,” to another nucleic acid in a sequence-specific, antiparallel, manner (i.e., a nucleic acid specifically binds to a complementary nucleic acid) under the appropriate in vitro and/or in vivo conditions of temperature and solution ionic strength.
- a nucleic acid e.g., RNA, DNA
- anneal or “hybridize”
- sequence of a polynucleotide need not be 100% complementary to that of its target nucleic acid sequence to be specifically hybridizable; it can have at least about 70%, at least about 80%, or at least about 90%, or at least about 95% sequence identity and still hybridize to the target nucleic acid sequence.
- a polynucleotide may hybridize over one or more segments such that intervening or adjacent segments are not involved in the hybridization event (e.g., a loop structure or hairpin structure, a 'bulge', ‘bubble’ and the like).
- a gene may include regulatory element sequences including, but not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
- Coding sequences encode a gene product upon transcription or transcription and translation; the coding sequences of the disclosure may comprise fragments and need not contain a full-length open reading frame.
- a gene can include both the strand that is transcribed as well as the complementary strand containing the anticodons.
- downstream refers to a nucleotide sequence that is located 3' to a reference nucleotide sequence.
- downstream nucleotide sequences relate to sequences that follow the starting point of transcription. For example, the translation initiation codon of a gene is located downstream of the start site of transcription.
- upstream refers to a nucleotide sequence that is located 5' to a reference nucleotide sequence.
- upstream nucleotide sequences relate to sequences that are located on the 5' side of a coding region or starting point of transcription. For example, most promoters are located upstream of the start site of transcription.
- regulatory element is used interchangeably herein with the term “regulatory sequence,” and is intended to include promoters, enhancers, and other expression regulatory elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- regulatory elements include a transcription promoter such as, but not limited to, CMV, CMV+intron A, SV40, RSV, HIV-Ltr, elongation factor 1 alpha (EFla), MMLV-ltr, internal ribosome entry site (IRES) or P2A peptide to permit translation of multiple genes from a single transcript, metallothionein, a transcription enhancer element, a transcription termination signal, polyadenylation sequences, sequences for optimization of initiation of translation, and translation termination sequences.
- regulatory elements include exonic splicing enhancers.
- the choice of the appropriate regulatory element will depend on the encoded component to be expressed (e.g., protein or RNA) or whether the nucleic acid comprises multiple components that require different polymerases or are not intended to be expressed as a fusion protein.
- promoter refers to a DNA sequence that contains an RNA polymerase binding site, transcription start site, TATA box, and/or B recognition element and assists or promotes the transcription and expression of an associated transcribable polynucleotide sequence and/or gene (or transgene).
- a promoter can be synthetically produced or can be derived from a known or naturally occurring promoter sequence or another promoter sequence.
- a promoter can be proximal or distal to the gene to be transcribed.
- a promoter can also include a chimeric promoter comprising a combination of two or more heterologous sequences to confer certain properties.
- a promoter of the present disclosure can include variants of promoter sequences that are similar in composition, but not identical to, other promoter sequence(s) known or provided herein.
- a promoter can be classified according to criteria relating to the pattern of expression of an associated coding or transcribable sequence or gene operably linked to the promoter, such as constitutive, developmental, tissue-specific, inducible, etc.
- Enhancers refers to regulatory DNA sequences that, when bound by specific proteins called transcription factors, regulate the expression of an associated gene. Enhancers may be located in the intron of the gene, or 5’ or 3’ of the coding sequence of the gene. Enhancers may be proximal to the gene ⁇ i.e., within a few tens or hundreds of base pairs (bp) of the promoter), or may be located distal to the gene (i.e., thousands of bp, hundreds of thousands of bp, or even millions of bp away from the promoter). A single gene may be regulated by more than one enhancer, all of which are envisaged as within the scope of the instant disclosure.
- Recombinant means that a particular nucleic acid (DNA or RNA) is the product of various combinations of cloning, restriction, and/or ligation steps resulting in a construct having a structural coding or non-coding sequence distinguishable from endogenous nucleic acids found in natural systems.
- DNA sequences encoding the structural coding sequence can be assembled from cDNA fragments and short oligonucleotide linkers, or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system.
- sequences can be provided in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, which are typically present in eukaryotic genes.
- Genomic DNA comprising the relevant sequences can also be used in the formation of a recombinant gene or transcriptional unit. Sequences of non-translated DNA may be present 5’ or 3’ from the open reading frame, where such sequences do not interfere with manipulation or expression of the coding regions, and may indeed act to modulate production of a desired product by various mechanisms (see “enhancers” and “promoters”, above).
- recombinant polynucleotide or "recombinant nucleic acid” refers to one which is not naturally occurring, e.g., is made by the artificial combination of two otherwise separated segments of sequence through human intervention.
- This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions.
- This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques.
- recombinant polypeptide or “recombinant protein” refers to a polypeptide or protein which is not naturally occurring, e.g., is made by the artificial combination of two otherwise separated segments of amino sequence through human intervention.
- a protein that comprises a heterologous amino acid sequence is recombinant.
- contacting means establishing a physical connection between two or more entities. For example, contacting a target nucleic acid sequence with a guide nucleic acid means that the target nucleic acid sequence and the guide nucleic acid are made to share a physical connection; e.g., can hybridize if the sequences share sequence similarity.
- K d Dissociation constant
- compositions and methods useful for editing a target nucleic acid sequence are used interchangeably with “modifying” and includes but is not limited to cleaving, nicking, deleting, knocking in, knocking out, and the like.
- knock-out refers to the elimination of a gene or the expression of a gene.
- a gene can be knocked out by either a deletion or an addition of a nucleotide sequence that leads to a disruption of the reading frame.
- a gene may be knocked out by replacing a part of the gene with an irrelevant sequence.
- knock-down refers to reduction in the expression of a gene or its gene product(s). As a result of a gene knock-down, the protein activity or function may be attenuated or the protein levels may be reduced or eliminated.
- HDR homology-directed repair
- This process requires nucleotide sequence homology, and uses a donor template to repair or knock-out a target DNA, and leads to the transfer of genetic information from the donor (e.g., such as the donor template) to the target, resulting in a transgene of interest.
- Homology-directed repair can result in an alteration of the sequence of the target nucleic acid sequence by insertion, deletion, or mutation if the donor template differs from the target DNA sequence and part or all of the sequence of the donor template is incorporated into the target DNA.
- non-homologous end joining refers to the repair of double strand breaks in DNA by direct ligation of the break ends to one another without the need for a homologous template (in contrast to homology-directed repair, which requires a homologous sequence to guide repair). NHEJ often results in the loss (deletion) of nucleotide sequence near the site of the double-strand break.
- micro-homology mediated end joining refers to a mutagenic DSB repair mechanism, which always associates with deletions flanking the break sites without the need for a homologous template (in contrast to homology-directed repair, which requires a homologous sequence to guide repair). MMEJ often results in the loss (deletion) of nucleotide sequence near the site of the double- strand break.
- a polynucleotide or polypeptide has a certain percent "sequence similarity" or “sequence identity” to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences.
- Sequence similarity (interchangeably referred to as percent similarity, percent identity, or homology) can be determined in a number of different manners.
- sequences can be aligned using the methods and computer programs that are known in the art, including BLAST, available over the world wide web at ncbi.nlm.nih.gov/BLAST. Percent complementarity between particular stretches of nucleic acid sequences within nucleic acids can be determined using any convenient method.
- Example methods include BLAST programs (basic local alignment search tools) and PowerBLAST programs (Altschul et ah, J. Mol.
- polypeptide and “protein” are used interchangeably herein, and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
- the term includes fusion proteins, including, but not limited to, fusion proteins with a heterologous amino acid sequence.
- a "vector” or “expression vector” is a replicon, such as plasmid, phage, virus, virus like particle, or cosmid, to which another DNA segment, i.e., an "insert", may be attached so as to bring about the replication or expression of the attached segment in a cell.
- wild-type refers to a nucleic acid, polypeptide, cell, or organism that is found in nature.
- wild-type can refer to more than one naturally occurring variants of a nucleic acid, polypeptide, cell or organism.
- wild-type can also be used to refer to naturally-occurring, non-disease causing variants of the gene.
- a “mutation” refers to an insertion, deletion, substitution, duplication, or inversion of one or more amino acids or nucleotides as compared to a wild-type or reference amino acid sequence or to a wild-type or reference nucleotide sequence.
- isolated is meant to describe a polynucleotide, a polypeptide, or a cell that is in an environment different from that in which the polynucleotide, the polypeptide, or the cell naturally occurs.
- An isolated genetically modified host cell may be present in a mixed population of genetically modified host cells.
- a "host cell,” as used herein, denotes a eukaryotic cell, a prokaryotic cell, or a cell from a multicellular organism (e.g., a cell line) cultured as a unicellular entity, which eukaryotic or prokaryotic cells are used as recipients for a nucleic acid (e.g., an expression vector), and include the progeny of the original cell which has been genetically modified by the nucleic acid. It is understood that the progeny of a single cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation.
- a “recombinant host cell” (also referred to as a “genetically modified host cell”) is a host cell into which has been introduced a heterologous nucleic acid, e.g., an expression vector.
- a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide-containing side chains consists of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains consists of cysteine and methionine.
- Exemplary conservative amino acid substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine,
- treatment or “treating,” are used interchangeably herein and refer to an approach for obtaining beneficial or desired results, including but not limited to a therapeutic benefit and/or a prophylactic benefit.
- therapeutic benefit is meant eradication or amelioration of the underlying disorder or disease being treated.
- a therapeutic benefit can also be achieved with the eradication or amelioration of one or more of the symptoms or an improvement in one or more clinical parameters associated with the underlying disease such that an improvement is observed in the subject, notwithstanding that the subject may still be afflicted with the underlying disease.
- terapéuticaally effective amount and "therapeutically effective dose”, as used herein, refer to an amount of a drug or a biologic, alone or as a part of a composition, that is capable of having any detectable, beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition when administered in one or repeated doses to a subject such as a human or an experimental animal. Such effect need not be absolute to be beneficial.
- administering is meant as a method of giving a dosage of a compound (e.g., a composition of the disclosure) or a composition (e.g., a pharmaceutical composition) to a subject.
- a "subject” is a mammal. Mammals include, but are not limited to, domesticated animals, non-human primates, humans, rabbits, mice, rats and other rodents.
- the present disclosure provides systems comprising a Class 2, Type V CRISPR nuclease protein and one or more guide nucleic acids (gNA) for use in modifying a C9orf72 gene with one or more mutations or that comprises the HRS, in order to reduce or eliminate expression of the C9orf72 gene product, the RNA from the transcription of the HRS, and/or the DPR (collectively referred to herein as the “target nucleic acid”, inclusive of coding and non-coding regions).
- gNA guide nucleic acids
- the human C9orp2 gene (HGNC:28337) encodes a protein (Q01453) having the sequence
- the C9orf72 gene is defined as the sequence that spans chr9: 27,546,546- 27,573,866 of the human genome on chromosome 9 (Homo sapiens Updated Annotation Release 109.20191205, GRCh38.pl3 (NCBI).
- the human C9orp2 gene is described in part in the NCBI database (ncbi.nlm.nih.gov) as Reference Sequence NC_000009.12, which is incorporated by reference herein.
- the C9orf72 locus contains 12 exons, including 2 alternate noncoding first exons (exons la and lb) (DeJesus-Hernandez, M., et al. 2011).
- the translated DPR proteins include poly-(Gly-Ala) and, to a lesser extent, poly-(Gly-Pro) and poly-(Gly-Arg).
- a shorter isoform b (NP_659442.2) has the sequence
- the disclosure provides systems specifically designed to modify the C9orf72 gene in eukaryotic cells.
- the systems are designed to knock-down or knock-out the C9orf72 gene.
- the systems are designed to correct one or more mutations in the C9orf72 gene.
- the systems are designed to excise the hexanucleotide repeat sequence and restore the ability of the cell to express a functional C9orf72 protein.
- the systems are designed to correct the hexanucleotide repeat sequence GGGGCC mutation of the C9orf72 gene that encodes the RNA transcripts of the HRS and/or the DPR and restore the ability of the cell to express a functional C9orf72 protein.
- the CRISPR nuclease is a Class 2, Type V nuclease.
- the Class 2, Type V nuclease is selected from the group consisting of Casl2a, Casl2b, Casl2c, Casl2d (CasY), Casl2J, and CasX.
- the Class 2, Type V nuclease is a CasX.
- the disclosure provides systems comprising one or more CasX proteins and one or more guide nucleic acids (gNA) as a CasX:gNA system and, optionally, one or more donor template nucleic acids.
- gNA guide nucleic acids
- the disclosure provides gene editing pairs of a CasX and a gNA of any of the embodiments described herein that are capable of being bound together prior to their use for gene editing and, thus, are “pre-complexed” as a ribonuclear protein complex (RNP).
- RNP ribonuclear protein complex
- the use of a pre-complexed RNP confers advantages in the delivery of the system components to a cell or target nucleic acid sequence for editing of the target nucleic acid sequence.
- the functional RNP can be delivered ex vivo to a cell by electrophoresis or by chemical means.
- the functional RNP can be delivered either ex vivo or in vivo by a vector in their functional form, or are expressed and then complex together as the RNP.
- the gNA can provide target specificity to the complex by including a targeting sequence (or “spacer”) having a nucleotide sequence that is complementary to a sequence of the target nucleic acid sequence while the CasX protein of the pre-complexed CasX:gNA provides the site-specific activity such as cleavage or nicking of the target sequence that is guided to a target site (e.g., stabilized at a target site) within a target nucleic acid sequence (e.g., a C9orf72 gene to be modified) by virtue of its association with the gNA.
- a targeting sequence or “spacer” having a nucleotide sequence that is complementary to a sequence of the target nucleic acid sequence while the CasX protein of the pre-complexed CasX:gNA provides the site-specific activity such as cleavage or nicking of the target sequence that is guided to a target site (e.g., stabilized at a target site) within a target nucleic acid sequence
- the CasX:gNA systems utilized in the editing of the C9orf72 gene can optionally further comprise a donor template comprising all or at least a portion of a gene encoding a C9orf72 protein, a non-coding region, or a C9orf72 regulatory element wherein the donor template comprises one or more mutations compared to a wild-type C9orf72 gene utilized for insertion for either knocking out or knocking down (described more fully, below) the target nucleic acid sequence with one or more mutations or the HRS.
- the CasX:gNA systems can optionally further comprise a donor template for the introduction (or knocking in) of all or a portion of gene encoding the physiologically-normal number of hexanucleotide repeats, or a sequence for the production of a wild-type C9orf72 protein (SEQ ID NO:227 or 228), or a sequence for the production of physiologically-normal levels of C9orf72 in the target cell.
- a donor template for the introduction (or knocking in) of all or a portion of gene encoding the physiologically-normal number of hexanucleotide repeats or a sequence for the production of a wild-type C9orf72 protein (SEQ ID NO:227 or 228), or a sequence for the production of physiologically-normal levels of C9orf72 in the target cell.
- the donor template comprises at least about 20, at least about 50, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000, at least about 10,000, at least 15,000, or at least 25,000 nucleotides of a wild-type C9orf72 gene, wherein the C9orf72 gene portion is selected from the group consisting of a C9orf72 exon, a C9orf72 intron, a C9orf72 intron-exon junction, a C9orf72 regulatory element, a C9orf72 coding region, a C9orf72 non-coding region, or the entirety of the C9orf72 gene.
- the C9orf72 gene portion comprises a combination of any of a C9orf72 exon sequence, a C9orf72 intron sequence, a C9orf72 intron-exon junction sequence, a C9orf72 non-coding region, or a C9orf72 regulatory element sequence.
- the donor template comprises a sequence having a physiol ogically-normal number of hexanucleotide repeats of the GGGGCC sequence wherein upon insertion of the donor template, the hexanucleotide repeat sequence expansion of the C9orf72 gene is replaced.
- the donor polynucleotide comprises at least about 10 to about 15,000 nucleotides, at least about 100 to about 10,000 nucleotides, at least about 400 to about 6000 nucleotides, at least about 600 to about 4000 nucleotides, or at least about 1000 to about 2000 nucleotides of a wild-type C9orf72 gene.
- the donor template is a single stranded DNA template or a single stranded RNA template. In other embodiments, the donor template is a double stranded DNA template.
- the disclosure relates to guide nucleic acids (gNA) comprising a targeting sequence complementary to a target nucleic acid sequence of a C9orf72 gene, wherein the gNA is capable of forming a complex with a CRISPR protein that has specificity to a protospacer adjacent motif (PAM) sequence comprising a TC motif in the complementary non target strand, and wherein the PAM sequence is located 1 nucleotide 5’ of the sequence in the non-target strand that is complementary to the target nucleic acid sequence in the target strand of the target nucleic acid.
- the gNA is capable of forming a complex with a Class 2, Type V CRISPR nuclease.
- the gNA is capable of forming a complex with a CasX nuclease.
- the disclosure provides gNAs utilized in the CasX:gNA systems that have utility in genome editing in a cell that have utility in editing of the C9orf72 gene.
- the present disclosure provides specifically-designed guide nucleic acids (“gNAs”) with targeting sequences that are complementary to (and are therefore able to hybridize with) the C9orf72 gene as a component of the gene editing CasX:gNA systems.
- gNAs specifically-designed guide nucleic acids
- targeting sequences to the C9orf72 target nucleic acid that can be utilized in the gNA of the embodiments are presented as SEQ ID NOS: 309-343, 363-2100 and 2295- 21835.
- the gNA is a deoxyribonucleic acid molecule (“gDNA”); in some embodiments, the gNA is a ribonucleic acid molecule (“gRNA”); and in other embodiments, the gNA is a chimera, and comprises both DNA and RNA.
- gDNA deoxyribonucleic acid molecule
- gRNA ribonucleic acid molecule
- the gNA is a chimera, and comprises both DNA and RNA.
- the terms gNA, gRNA, and gDNA cover naturally-occurring molecules, as well as sequence variants.
- multiple gNAs are delivered in the CasX:gNA system for the modification of a gene encoding one or more regions of a C9orf72 protein, a non-coding region of the C9orf72 gene, or a C9orf72 regulatory element.
- a pair of gNAs with targeting sequences to different or overlapping regions of the target nucleic acid sequence can be used in order to bind and cleave at two different or overlapping sites within the gene.
- a pair of gNAs can be used in order to bind and cleave at two different sites 5’ and 3’ of the hexanucleotide repeats within the C9orf72 gene, resulting in the excision of the HRS that is then edited by non-homologous end joining (NHEJ), homology-directed repair (HDR), homology- independent targeted integration (HP ⁇ ), micro-homology mediated end joining (MMEJ), single strand annealing (SSA) or base excision repair (BER).
- NHEJ non-homologous end joining
- HDR homology-directed repair
- HP ⁇ homology- independent targeted integration
- MMEJ micro-homology mediated end joining
- SSA single strand annealing
- BER base excision repair
- a gNA of the present disclosure comprises a sequence of a naturally-occurring gNA (a “reference gNA”).
- a reference gNA of the disclosure may be subjected to one or more mutagenesis methods, such as the mutagenesis methods described herein, which may include Deep Mutational Evolution (DME), deep mutational scanning (DMS), error prone PCR, cassette mutagenesis, random mutagenesis, staggered extension PCR, gene shuffling, or domain swapping, in order to generate one or more gNA variants with enhanced or varied properties relative to the reference gNA.
- DME Deep Mutational Evolution
- DMS deep mutational scanning
- error prone PCR cassette mutagenesis
- random mutagenesis random mutagenesis
- staggered extension PCR staggered extension PCR
- gene shuffling gene shuffling
- domain swapping in order to generate one or more gNA variants with enhanced or varied properties relative to the reference gNA.
- gNA variants also include variants comprising one or more exogenous sequences, for example fused to either the 5’ or 3’ end, or inserted internally.
- the activity of reference gNAs may be used as a benchmark against which the activity of gNA variants are compared, thereby measuring improvements in function or other characteristics of the gNA variants.
- a reference gNA may be subjected to one or more deliberate, specifically-targeted mutations in order to produce a gNA variant, for example a rationally designed variant.
- the gNAs of the disclosure comprise two segments: a targeting sequence and a protein-binding segment.
- the targeting segment of a gNA includes a nucleotide sequence (referred to interchangeably as a guide sequence, a spacer, a targeter, or a targeting sequence) that is complementary to (and therefore hybridizes with) a specific sequence (a target site) within the target nucleic acid sequence (e.g., a target ssRNA, a target ssDNA, a strand of a double stranded target DNA, etc.), described more fully below.
- the targeting sequence of a gNA is capable of binding to a target nucleic acid sequence, including a coding sequence, a complement of a coding sequence, a non-coding sequence, and to regulatory elements.
- the protein-binding segment (or “activator” or “protein-binding sequence”) interacts with (e.g., binds to) a CasX protein as a complex, forming an RNP (described more fully, below).
- the targeter and the activator portions each have a duplex-forming segment, where the duplex forming segment of the targeter and the duplex-forming segment of the activator have complementarity with one another and hybridize to one another to form a double stranded duplex (dsRNA duplex for a gRNA).
- dsRNA duplex for a gRNA double stranded duplex
- a targeter or “targeter RNA” is used herein to refer to a crRNA-like molecule (crRNA: "CRISPR RNA”) of a CasX dual guide RNA (and therefore of a CasX single guide RNA when the “activator” and the “targeter” are linked together, e.g., by intervening nucleotides).
- the crRNA has a 5' region that anneals with the tracrRNA followed by the nucleotides of the targeting sequence.
- a guide RNA (dgRNA or sgRNA) comprises a guide sequence and a duplex-forming segment of a crRNA, which can also be referred to as a crRNA repeat.
- a corresponding tracrRNA-like molecule also comprises a duplex-forming stretch of nucleotides that forms the other half of the dsRNA duplex of the protein-binding segment of the guide RNA.
- a targeter and an activator hybridize to form a dual guide NA, referred to herein as a “dual guide NA”, a “dual-molecule gNA”, a “dgNA”, a “double-molecule guide NA”, or a “two-molecule guide NA”.
- Site-specific binding and/or cleavage of a target nucleic acid sequence (e.g., genomic DNA) by the CasX protein can occur at one or more locations (e.g., a sequence of a target nucleic acid) determined by base-pairing complementarity between the targeting sequence of the gNA and the target nucleic acid sequence.
- the gNA of the disclosure have sequences complementarity to and therefore can hybridize with the target nucleic acid that is adjacent to a sequence complementary to a TC PAM motif or a PAM sequence, such as ATC, CTC, GTC, or TTC.
- a targeter can be modified by a user to hybridize with a specific target nucleic acid sequence, so long as the location of the PAM sequence is considered.
- the sequence of a targeter may be a non-naturally occurring sequence.
- the sequence of a targeter may be a naturally-occurring sequence, derived from the gene to be edited.
- the activator and targeter of the gNA are covalently linked to one another (rather than hybridizing to one another) and comprise a single molecule, referred to herein as a “single-molecule gNA,” “one-molecule guide NA,” “single guide NA”, “single guide RNA”, a “single-molecule guide RNA,” a “one-molecule guide RNA”, a “single guide DNA”, a “single-molecule DNA”, or a “one-molecule guide DNA”, (“sgNA”, “sgRNA”, or a “sgDNA”).
- the sgNA includes an “activator” or a “targeter” and thus can be an “activator-RNA” and a “targeter-RNA,” respectively.
- the assembled gNAs of the disclosure comprise four distinct regions, or domains: the RNA triplex, the scaffold stem, the extended stem, and the targeting sequence that, in the embodiments of the disclosure is specific for a target nucleic acid and is located on the 3’ end of the gNA.
- the RNA triplex, the scaffold stem, and the extended stem, together, are referred to as the “scaffold” of the gNA.
- RNA triplex RNA triplex
- the RNA triplex comprises the sequence of a UUU— nX( ⁇ 4-15)— UUU stem loop (SEQ ID NO: 19) that ends with an AAAG after 2 intervening stem loops (the scaffold stem loop and the extended stem loop), forming a pseudoknot that may also extend past the triplex into a duplex pseudoknot.
- the UU-UUU-AAA sequence of the triplex forms as a nexus between the spacer, scaffold stem, and extended stem.
- the UUU-loop-UUU region is coded for first, then the scaffold stem loop, and then the extended stem loop, which is linked by the tetraloop, and then an AAAG closes off the triplex before becoming the spacer.
- an AAAG closes off the triplex before becoming the spacer.
- the triplex region is followed by the scaffold stem loop.
- the scaffold stem loop is a region of the gNA that is bound by CasX protein (such as a reference or CasX variant protein).
- the scaffold stem loop is a fairly short and stable stem loop. In some cases, the scaffold stem loop does not tolerate many changes, and requires some form of an RNA bubble. In some embodiments, the scaffold stem is necessary for CasX sgNA function.
- the scaffold stem of a CasX sgNA While it is perhaps analogous to the nexus stem of Cas9 as being a critical stem loop, the scaffold stem of a CasX sgNA, in some embodiments, has a necessary bulge (RNA bubble) that is different from many other stem loops found in CRISPR/Cas systems. In some embodiments, the presence of this bulge is conserved across sgNA that interact with different CasX proteins.
- An exemplary sequence of a scaffold stem loop sequence of a gNA comprises the sequence CCAGCGACUAUGUCGUAUGG (SEQ ID NO: 20).
- the disclosure provides gNA variants wherein the scaffold stem loop is replaced with an RNA stem loop sequence from a heterologous RNA source with proximal 5' and 3' ends, such as, but not limited to stem loop sequences selected from MS2, Q b, U1 hairpin II, Uvsx, or PP7 stem loops.
- the heterologous RNA stem loop of the gNA is capable of binding a protein, an RNA structure, a DNA sequence, or a small molecule.
- the scaffold stem loop is followed by the extended stem loop.
- the extended stem comprises a synthetic tracr and crRNA fusion that is largely unbound by the CasX protein.
- the extended stem loop can be highly malleable.
- a single guide gRNA is made with a GAAA tetraloop linker or a GAGAAA linker between the tracr and crRNA in the extended stem loop.
- the targeter and activator of a CasX sgNA are linked to one another by intervening nucleotides and the linker can have a length of from 3 to 20 nucleotides.
- the extended stem is a large 32-bp loop that sits outside of the CasX protein in the ribonucleoprotein complex.
- An exemplary sequence of an extended stem loop sequence of a sgNA comprises the sequence GC GCUU AUUU AU C GG AG AG A AAU C C G AU A AAU A AG A AGC (SEQ ID NO: 21).
- the extended stem loop comprises a GAGAAA spacer sequence.
- the disclosure provides gNA variants wherein the extended stem loop is replaced with an RNA stem loop sequence from a heterologous RNA source with proximal 5’ and 3’ ends, such as, but not limited to stem loop sequences selected from MS2, QP, U1 hairpin II, Uvsx, or PP7 stem loops.
- the heterologous RNA stem loop increases the stability of the gNA.
- the disclosure provides gNA variants having an extended stem loop region comprising at least 10, at least 100, at least 500, at least 1000, or at least 10,000 nucleotides, or at least 10-10,000, at least 10-1000, or at least 10-100 nucleotides.
- the extended stem loop is followed by a region that forms part of the triplex, and then the targeting sequence.
- the targeting sequence targets the CasX ribonucleoprotein holo complex to a specific region of the target nucleic acid sequence of the C9orf72 gene.
- CasX gNA targeting sequences of the disclosure have sequences complementarity to, and therefore can hybridize to, a portion of the C9orf72 gene in a nucleic acid in a eukaryotic cell (e.g., a eukaryotic chromosome, chromosomal sequence, a eukaryotic RNA, etc.) as a component of the RNP when the TC PAM motif or any one of the PAM sequences TTC, ATC, GTC, or CTC is located 1 nucleotide 5’ to the non-target strand sequence complementary to the target sequence.
- a eukaryotic cell e.g., a eukaryotic chromosome, chromosomal sequence, a eukaryotic RNA, etc.
- the targeting sequence of a gNA can be modified so that the gNA can target a desired sequence of any desired target nucleic acid sequence, so long as the PAM sequence location is taken into consideration.
- the gNA scaffold is 5’ of the targeting sequence, with the targeting sequence on the 3’ end of the gNA.
- the PAM motif sequence recognized by the nuclease of the RNP is TC. In other embodiments, the PAM sequence recognized by the nuclease of the RNP is NTC.
- the targeting sequence of the gNA is specific for a portion of a gene encoding a C9orf72 protein comprising one or more mutations. In some embodiments, the targeting sequence of a gNA is specific for a C9orf72 exon. In some embodiments, the targeting sequence of a gNA is specific for a C9orf72 intron. In some embodiments, the targeting sequence of the gNA is specific for a C9orf72 intron-exon junction. In some embodiments, the targeting sequence of the gNA has a sequence that hybridizes with a C9orf72 regulatory element, a C9orf72 coding region, a C9orf72 non-coding region, or combinations thereof.
- the targeting sequence of the gNA hybridizes with a sequence that is 5’ to the HRS.
- the first gNA targeting sequence of the gNA hybridizes with a sequence that is 5’ to the HRS and the second gNA hybridizes with a sequence that is 3’ to the HRS.
- the targeting sequence of the gNA is complementary to a sequence comprising one or more single nucleotide polymorphisms (SNPs) of the C9orf72 gene or its complement. SNPs that are within C9orf72 coding sequence or within C9orf72 non-coding sequence are both within the scope of the instant disclosure.
- the targeting sequence of the gNA is complementary to a sequence of an intergenic region of the C9orf72 gene or a sequence complementary to an intergenic region of the C9orf72 gene.
- the targeting sequence of a gNA is specific for a regulatory element that regulates expression of C9orf72.
- C9orf72 regulatory elements include, but are not limited to promoter regions, enhancer regions, intergenic regions, 5’ untranslated regions (5’ UTR), 3’ untranslated regions (3’ UTR), intergenic regions, gene enhancer elements, conserved elements, and regions comprising cis-regulatory elements.
- the promoter region is intended to encompass nucleotides within 100 kb of the C9orf72 initiation point or, in the case of gene enhancer elements or conserved elements, can be 1 Mb or more distal to the C9orf72 gene.
- the disclosure provides a gNA with a targeting sequence that hybridizes with a C9orf72 regulatory element.
- the targets are those in which the encoding gene of the target is intended to be knocked out or knocked down such that the C9orf72 protein comprising mutations or the hexanucleotide duplication of the C9orf72 gene product is not expressed or is expressed at a lower level in a cell.
- the disclosure provides a CasX:gNA system wherein the targeting sequence (or spacer) of the gNA is complementary to a nucleic acid sequence encoding C9orf72, a portion of the C9orf72 protein, a portion of a C9orf72 regulatory element, or the complement of a portion of the C9orf72 gene.
- the targeting sequence of the gNA has between 14 and 35 consecutive nucleotides. In some embodiments, the targeting sequence has 14, 15, 16, 18, 18,
- the targeting sequence consists of 21 consecutive nucleotides. In some embodiments, the targeting sequence consists of 20 consecutive nucleotides. In some embodiments, the targeting sequence consists of 19 consecutive nucleotides. In some embodiments, the targeting sequence consists of 18 consecutive nucleotides. In some embodiments, the targeting sequence consists of 17 consecutive nucleotides. In some embodiments, the targeting sequence consists of 16 consecutive nucleotides. In some embodiments, the targeting sequence consists of 15 consecutive nucleotides.
- the targeting sequence has 14, 15, 16, 17, 18, 19, 20, or 21 consecutive nucleotides and the targeting sequence can comprise 0 to 5, 0 to 4, 0 to 3, or 0 to 2 mismatches relative to the target nucleic acid sequence and retain sufficient binding specificity such that the RNP comprising the gNA comprising the targeting sequence can form a complementary bond with respect to the target nucleic acid.
- Representative, but non-limiting examples of targeting sequences to wild-type C9orf72 nucleic acid are presented in Tables 3 and 15 as SEQ ID NOS: 309-343, 363-2100 and 2295- 21835.
- the disclosure provides targeting sequences comprising a sequence that is at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or 100% identical to a sequence in Tables 3 and 15 as SEQ ID NOS: 309-343, 363-2100 and 2295-21835.
- the targeting sequence of the gNA comprises a sequence of SEQ ID NOS: 2281-159093 with a single nucleotide removed from the 3' end of the sequence.
- the targeting sequence of the gNA comprises a sequence of SEQ ID NOS: 309-343, 363-2100 and 2295- 21835 with two nucleotides removed from the 3' end of the sequence. In other embodiments, the targeting sequence of the gNA comprises a sequence of SEQ ID NOS: 309-343, 363-2100 and 2295-21835 with three nucleotides removed from the 3' end of the sequence. In other embodiments, the targeting sequence of the gNA comprises a sequence of SEQ ID NOS: 309- 343, 363-2100 and 2295-21835 with four nucleotides removed from the 3' end of the sequence.
- the targeting sequence of the gNA comprises a sequence of SEQ ID NOS: 309-343, 363-2100 and 2295-21835 with five nucleotides removed from the 3' end of the sequence.
- thymine (T) nucleotides can be substituted for one or more or all of the uracil (U) nucleotides in any of the targeting sequences such that the gNA can be a gDNA or a gRNA, or a chimera of RNA and DNA, or in those cases where the encoding sequence for the spacer is incorporated into an expression vector.
- a targeting sequence of SEQ ID NOS: 309-343, 363-2100 and 2295-21835 has at least 1, 2, 3, 4, 5, or 6 or more thymine nucleotides substituted for uracil nucleotides.
- a gNA, gRNA, or gDNA of the disclosure comprises 1, 2, 3 or more targeting sequences of SEQ ID NOS: 309-343, 363-2100 and 2295-21835, or targeting sequences that are at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or 100% identical to one or more sequences of SEQ ID NOS: 309-343, 363-2100 and 2295-21835.
- the targeting sequence is complementary to a nucleic acid sequence encoding a mutation of the C9orf72 protein of SEQ ID NO: 227 or 228 or hexanucleotide duplications that disrupt the function or expression of the C9orf72 protein.
- the CasX:gNA system comprises a first gNA and further comprises a second (and optionally a third, fourth or fifth) gNA, wherein the second gNA or additional gNA has a targeting sequence complementary a different portion of the target nucleic acid sequence or its complement compared to the targeting sequence of the first gNA; e.g., the first gNA targets 5’ to the hexanucleotide repeat and the second gNA targets 3’ to the hexanucleotide repeat.
- the targeting sequences of the gNA defined regions of the target nucleic acid sequence can be modified or edited using the CasX:gNA systems described herein.
- a CasX reference gRNA comprises a sequence isolated or derived from Deltaproteobacter .
- the sequence is a CasX tracrRNA sequence.
- Exemplary CasX reference tracrRNA sequences isolated or derived from Deltaproteobacter may include:
- ACAUCUGGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGU AU GG AC G A AGC GCUU AUUU AU C GG AG A (SEQ ID NO: 22) and ACAUCUGGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGU AUGGACGAAGC GCUU AUUU AUCGG (SEQ ID NO: 23).
- Exemplary crRNA sequences isolated or derived from Deltaproteobacter may comprise a sequence of CCGAUAAGUAAAACGCAUCAAAG (SEQ ID NO: 24).
- a CasX reference gNA comprises a sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical or 100% identical to a sequence isolated or derived from Deltaproteobacter .
- a CasX reference guide RNA comprises a sequence isolated or derived from Planctomycetes.
- the sequence is a CasX tracrRNA sequence.
- Exemplary CasX reference tracrRNA sequences isolated or derived from Planctomycetes may include:
- exemplary crRNA sequences isolated or derived from Planctomycetes may comprise a sequence of
- a CasX reference gNA comprises a sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical or 100% identical to a sequence isolated or derived from Planctomycetes.
- a CasX reference gNA comprises a sequence isolated or derived from Candidatus Sungbacteria.
- the sequence is a CasX tracrRNA sequence.
- Exemplary CasX reference tracrRNA sequences isolated or derived from Candidatus Sungbacteria may comprise sequences of: GUUUACACACUCCCUCUCAUAGGGU (SEQ ID NO: 28), GUUUACACACUCCCUCUCAUGAGGU (SEQ ID NO: 29), UUUUACAUACCCCCUCUCAUGGGAU (SEQ ID NO: 30) and
- a CasX reference guide RNA comprises a sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical or 100% identical to a sequence isolated or derived from Candidatus sungbacteria.
- Table 1 provides the sequences of reference gRNAs tracr and scaffold sequences.
- the disclosure provides gNA sequences wherein the gNA has a scaffold comprising a sequence having at least one nucleotide modification relative to a reference gNA sequence having a sequence of any one of SEQ ID NOS:4-16 of Table 1.
- a vector comprises a DNA encoding sequence for a gNA, or where a gNA is a gDNA or a chimera of RNA and DNA, that thymine (T) bases can be substituted for the uracil (U) bases of any of the gNA sequence embodiments described herein, including the sequences of Table 1 and Table 2.
- the disclosure relates to guide nucleic acid variants (referred to herein alternatively as “gNA variant” or “gRNA variant”), which comprise one or more modifications relative to a reference gRNA scaffold.
- gNA variant guide nucleic acid variants
- gRNA variant guide nucleic acid variants
- sinaffold refers to all parts to the gNA necessary for gNA function with the exception of the spacer sequence.
- a gNA variant comprises one or more nucleotide substitutions, insertions, deletions, or swapped or replaced regions relative to a reference gRNA sequence of the disclosure.
- a mutation can occur in any region of a reference gRNA to produce a gNA variant.
- the scaffold of the gNA variant sequence has at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, or at least 70%, at least 80%, at least 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity to the sequence of SEQ ID NO:4 or SEQ ID NO:5.
- a gNA variant comprises one or more nucleotide changes within one or more regions of the reference gRNA that improve a characteristic of the reference gRNA. Exemplary regions include the RNA triplex, the pseudoknot, the scaffold stem loop, and the extended stem loop.
- the variant scaffold stem further comprises a bubble.
- the variant scaffold further comprises a triplex loop region.
- the variant scaffold further comprises a 5' unstructured region.
- the gNA variant scaffold comprises a scaffold stem loop having at least 60% sequence identity to SEQ ID NO:14.
- the gNA variant comprises a scaffold stem loop having the sequence of CCAGCGACUAUGUCGUAGUGG (SEQ ID NO: 32).
- the disclosure provides a gNA scaffold comprising, relative to SEQ ID NO:5, a C18G substitution, a G55 insertion, a U1 deletion, and a modified extended stem loop in which the original 6 nt loop and 13 most-loop-proximal base pairs (32 nucleotides total) are replaced by a Uvsx hairpin (4 nt loop and 5 loop-proximal base pairs; 14 nucleotides total) and the loop-distal base of the extended stem was converted to a fully base-paired stem contiguous with the new Uvsx hairpin by deletion of the A99 and substitution of G64U.
- the gNA scaffold comprises the sequence
- gNA variants that have one or more improved functions or characteristics, or add one or more new functions when the variant gNA is compared to a reference gRNA described herein, are envisaged as within the scope of the disclosure.
- a representative example of such a gNA variant is guide 174 (SEQ ID NO:2238), the design of which is described in the Examples.
- the gNA variant adds a new function to the RNP comprising the gNA variant.
- the gNA variant has an improved characteristic selected from: improved stability; improved solubility; improved transcription of the gNA; improved resistance to nuclease activity; increased folding rate of the gNA; decreased side product formation during folding; increased productive folding; improved binding affinity to a CasX protein; improved binding affinity to a target DNA when complexed with a CasX protein; improved gene editing when complexed with a CasX protein; improved specificity of editing when complexed with a CasX protein; and improved ability to utilize a greater spectrum of one or more PAM sequences, including ATC, CTC, GTC, or TTC, in the editing of target DNA when complexed with a CasX protein, or any combination thereof.
- the one or more of the improved characteristics of the gNA variant is at least about 1.1 to about 100,000-fold improved relative to the reference gNA of SEQ ID NO:4 or SEQ ID NO:5. In other cases, the one or more improved characteristics of the gNA variant is at least about 1.1, at least about 10, at least about 100, at least about 1000, at least about 10,000, at least about 100,000-fold or more improved relative to the reference gNA of SEQ ID NO:4 or SEQ ID NO:5.
- the one or more of the improved characteristics of the gNA variant is about 1.1 to 100,00-fold, about 1.1 to 10,00-fold, about 1.1 to 1,000-fold, about 1.1 to 500-fold, about 1.1 to 100-fold, about 1.1 to 50-fold, about 1.1 to 20-fold, about 10 to 100,00-fold, about 10 to 10,00-fold, about 10 to 1,000-fold, about 10 to 500-fold, about 10 to 100-fold, about 10 to 50-fold, about 10 to 20-fold, about 2 to 70-fold, about 2 to 50-fold, about 2 to 30-fold, about 2 to 20-fold, about 2 to 10-fold, about 5 to 50-fold, about 5 to 30-fold, about 5 to 10-fold, about 100 to 100,00-fold, about 100 to 10,00-fold, about 100 to 1,000-fold, about 100 to 500-fold, about 500 to 100,00-fold, about 500 to 10,00-fold, about 500 to 1,000-fold, about 500 to 750-fold, about 1,000 to 100,00-fold, about 10,000 to 100,00-fold, about
- the one or more improved characteristics of the gNA variant is about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9- fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 11-fold, 12-fold, 13- fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 25-fold, 30-fold, 40-fold, 45- fold, 50-fold, 55-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 110-fold, 120-fold, 130-fold, 140-fold, 150-fold, 160-fold, 170-fold, 180-fold, 190-fold, 200-fold, 210-fold, 220-fold, 230-fold, 240-fold, 250-fold, 260-fold, 270-fold, 280-fold, 290
- a gNA variant can be created by subjecting a reference gRNA to a one or more mutagenesis methods, such as the mutagenesis methods described herein, below, which may include Deep Mutational Evolution (DME), deep mutational scanning (DMS), error prone PCR, cassette mutagenesis, random mutagenesis, staggered extension PCR, gene shuffling, or domain swapping, in order to generate the gNA variants of the disclosure.
- DME Deep Mutational Evolution
- DMS deep mutational scanning
- error prone PCR cassette mutagenesis
- random mutagenesis random mutagenesis
- staggered extension PCR staggered extension PCR
- gene shuffling gene shuffling
- domain swapping domain swapping
- a reference gRNA may be subjected to one or more deliberate, targeted mutations, substitutions, or domain swaps in order to produce a gNA variant, for example a rationally designed variant.
- exemplary gRNA variants produced by such methods are described in the Examples and representative sequences of gNA scaffolds are presented in Table 2.
- the gNA variant comprises one or more modifications compared to a reference guide nucleic acid scaffold sequence, wherein the one or more modification is selected from: at least one nucleotide substitution in a region of the gNA variant; at least one nucleotide deletion in a region of the gNA variant; at least one nucleotide insertion in a region of the gNA variant; a substitution of all or a portion of a region of the gNA variant; a deletion of all or a portion of a region of the gNA variant; or any combination of the foregoing.
- the modification is a substitution of 1 to 15 consecutive or non-consecutive nucleotides in the gNA variant in one or more regions. In other cases, the modification is a deletion of 1 to 10 consecutive or non-consecutive nucleotides in the gNA variant in one or more regions. In other cases, the modification is an insertion of 1 to 10 consecutive or non-consecutive nucleotides in the gNA variant in one or more regions. In other cases, the modification is a substitution of the scaffold stem loop or the extended stem loop with an RNA stem loop sequence from a heterologous RNA source with proximal 5' and 3' ends. In some cases, a gNA variant of the disclosure comprises two or more modifications in one region. In other cases, a gNA variant of the disclosure comprises modifications in two or more regions. In other cases, a gNA variant comprises any combination of the foregoing modifications described in this paragraph.
- a 5' G is added to a gNA variant sequence for expression in vivo , as transcription from a U6 promoter is more efficient and more consistent with regard to the start site when the +1 nucleotide is a G.
- two 5' Gs are added to a gNA variant sequence for in vitro transcription to increase production efficiency, as T7 polymerase strongly prefers a G in the +1 position and a purine in the +2 position.
- the 5’ G bases are added to the reference scaffolds of Table 1.
- the 5’ G bases are added to the variant scaffolds of Table 2. [0115] Table 2 provides exemplary gNA variant scaffold sequences.
- (-) indicates a deletion at the specified position(s) relative to the reference sequence of SEQ ID NO:5
- (+) indicates an insertion of the specified base(s) at the position indicated relative to SEQ ID NO:5
- (:) indicates the range of bases at the specified startstop coordinates of a deletion or substitution relative to SEQ ID NO:5, and multiple insertions, deletions or substitutions are separated by commas; e.g., A14C, U17G.
- the gNA variant scaffold comprises any one of the sequences listed in Table 2 as SEQ ID NOS:2101-2294, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
- a vector comprises a DNA encoding sequence for a gNA, or where a gNA is a gDNA or a chimera of RNA and DNA, that thymine (T) bases can be substituted for the uracil (U) bases of any of the gNA sequence embodiments described herein.
- T thymine
- U uracil
- the gNA variant comprises a tracrRNA stem loop comprising the sequence -UUU-N4-25-UUU- (SEQ ID NO: 34).
- the gNA variant comprises a scaffold stem loop or a replacement thereof, flanked by two triplet U motifs that contribute to the triplex region.
- the scaffold stem loop or replacement thereof comprises at least 4 nucleotides, at least 5 nucleotides, at least 6 nucleotides, at least 7 nucleotides, at least 7 nucleotides, at least 8 nucleotides, at least 9 nucleotides, at least 10 nucleotides, at least 11 nucleotides, at least 12 nucleotides, at least 13 nucleotides, at least 14 nucleotides, at least 15 nucleotides, at least 16 nucleotides, at least 17 nucleotides, at least 18 nucleotides, at least 19 nucleotides, at least 20 nucleotides, at least 21 nucleotides, at least 22 nucleotides, at least 23 nucleotides, at least 24 nucleotides, or at least 25 nucleotides.
- the gNA variant comprises a crRNA sequence with -AAAG- in a location 5’ to the spacer region.
- the -AAAG- sequence is immediately 5’ to the spacer region.
- the at least one nucleotide modification to a reference gNA to produce a gNA variant comprises at least one nucleotide deletion in the CasX variant gNA relative to the reference gRNA.
- a gNA variant comprises a deletion of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 consecutive or non-consecutive nucleotides relative to a reference gNA.
- the at least one deletion comprises a deletion of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 or more consecutive nucleotides relative to a reference gNA.
- the gNA variant comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 or more nucleotide deletions relative to the reference gNA, and the deletions are not in consecutive nucleotides.
- any length of deletions, and any combination of lengths of deletions, as described herein, are contemplated as within the scope of the disclosure.
- a gNA variant comprises at least two deletions in different regions of the reference gRNA.
- a gNA variant comprises at least two deletions in the same region of the reference gRNA.
- the regions may be the extended stem loop, scaffold stem loop, scaffold stem bubble, triplex loop, pseudoknot, triplex, or a 5’ end of the gNA variant.
- the deletion of any nucleotide in a reference gRNA is contemplated as within the scope of the disclosure.
- the at least one nucleotide modification of a reference gRNA to generate a gNA variant comprises at least one nucleotide insertion.
- a gNA variant comprises an insertion of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 consecutive or non- consecutive nucleotides relative to a reference gRNA.
- the at least one nucleotide insertion comprises an insertion of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
- the gNA variant comprises 2 or more insertions relative to the reference gRNA, and the insertions are not consecutive.
- any length of insertions, and any combination of lengths of insertions, as described herein, are contemplated as within the scope of the disclosure.
- a gNA variant may comprise a first insertion of one nucleotide, and a second insertion of two nucleotides and the two insertions are not consecutive.
- a gNA variant comprises at least two insertions in different regions of the reference gRNA. In some embodiments, a gNA variant comprises at least two insertions in the same region of the reference gRNA.
- the regions may be the extended stem loop, scaffold stem loop, scaffold stem bubble, triplex loop, pseudoknot, triplex, or a 5’ end of the gNA variant. Any insertion of A, G, C, U (or T, in the corresponding DNA) or combinations thereof at any location in the reference gRNA is contemplated as within the scope of the disclosure.
- the at least one nucleotide modification of a reference gRNA to generate a gNA variant comprises at least one nucleic acid substitution.
- a gNA variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 or more consecutive or non-consecutive substituted nucleotides relative to a reference gRNA.
- a gNA variant comprises 1-4 nucleotide substitutions relative to a reference gRNA.
- the at least one substitution comprises a substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 or more consecutive nucleotides relative to a reference gRNA.
- the gNA variant comprises 2 or more substitutions relative to the reference gRNA, and the substitutions are not consecutive.
- any length of substituted nucleotides, and any combination of lengths of substituted nucleotides, as described herein, are contemplated as within the scope of the disclosure.
- a gNA variant may comprise a first substitution of one nucleotide, and a second substitution of two nucleotides and the two substitutions are not consecutive.
- a gNA variant comprises at least two substitutions in different regions of the reference gRNA.
- a gNA variant comprises at least two substitutions in the same region of the reference gRNA.
- the regions may be the triplex, the extended stem loop, scaffold stem loop, scaffold stem bubble, triplex loop, pseudoknot, triplex, or a 5’ end of the gNA variant.
- Any substitution of A, G, C, U (or T, in the corresponding DNA) or combinations thereof at any location in the reference gRNA is contemplated as within the scope of the disclosure.
- Any of the substitutions, insertions and deletions described herein can be combined to generate a gNA variant of the disclosure.
- a gNA variant can comprise at least one substitution and at least one deletion relative to a reference gRNA, at least one substitution and at least one insertion relative to a reference gRNA, at least one insertion and at least one deletion relative to a reference gRNA, or at least one substitution, one insertion and one deletion relative to a reference gRNA.
- the gNA variant comprises a scaffold region at least 20% identical, at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical to any one of SEQ ID NOS:4-16.
- the gNA variant comprises a scaffold region at least 60% homologous (or identical) to any one of SEQ ID NOS:4-16.
- the gNA variant comprises a tracr stem loop at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, or at least 95% identical to SEQ ID NO:14. In some embodiments, the gNA variant comprises a tracr stem loop at least 60% homologous (or identical) to SEQ ID NO: 14.
- the gNA variant comprises an extended stem loop at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, or at least 95% identical to SEQ ID NO: 15. In some embodiments, the gNA variant comprises an extended stem loop at least 60% homologous (or identical) to SEQ ID NO: 15.
- the gNA variant comprises an exogenous extended stem loop, with such differences from a reference gNA described as follows.
- an exogenous extended stem loop has little or no identity to the reference stem loop regions disclosed herein (e.g., SEQ ID NO: 15).
- an exogenous stem loop is at least 10 bp, at least 20 bp, at least 30 bp, at least 40 bp, at least 50 bp, at least 60 bp, at least 70 bp, at least 80 bp, at least 90 bp, at least 100 bp, at least 200 bp, at least 300 bp, at least 400 bp, at least 500 bp, at least 600 bp, at least 700 bp, at least 800 bp, at least 900 bp, at least 1,000 bp, at least 2,000 bp, at least 3,000 bp, at least 4,000 bp, at least 5,000 bp, at least 6,000 bp, at least 7,000 bp, at least 8,000 bp, at least 9,000 bp, at least 10,000 bp, at least 12,000 bp, at least 15,000 bp or at least 20,000 bp.
- the gNA variant comprises an extended stem loop region comprising at least 10, at least 100, at least 500, at least 1000, or at least 10,000 nucleotides.
- the heterologous stem loop increases the stability of the gNA.
- the heterologous RNA stem loop is capable of binding a protein, an RNA structure, a DNA sequence, or a small molecule.
- an exogenous stem loop region replacing the stem loop comprises an RNA stem loop or hairpin in which the resulting gNA has increased stability and, depending on the choice of loop, can interact with certain cellular proteins or RNA.
- exogenous extended stem loops can comprise, for example a thermostable RNA such as MS2 (ACAUGAGGAUCACCCAUGU (SEQ ID NO:
- an exogenous stem loop comprises a long non-coding RNA (IncRNA).
- a IncRNA refers to a non-coding RNA that is longer than approximately 200 bp in length.
- the 5’ and 3’ ends of the exogenous stem loop are base paired; i.e., interact to form a region of duplex RNA.
- the 5’ and 3’ ends of the exogenous stem loop are base paired, and one or more regions between the 5’ and 3’ ends of the exogenous stem loop are not base paired.
- the at least one nucleotide modification comprises: (a) substitution of 1 to 15 consecutive or non-consecutive nucleotides in the gNA variant in one or more regions; (b) a deletion of 1 to 10 consecutive or non-consecutive nucleotides in the gNA variant in one or more regions; (c) an insertion of 1 to 10 consecutive or non-consecutive nucleotides in the gNA variant in one or more regions; (d) a substitution of the scaffold stem loop or the extended stem loop with an RNA stem loop sequence from a heterologous RNA source with proximal 5' and 3' ends; or any combination of (a)-(d).
- the gNA variant comprises a scaffold stem loop sequence of CCAGCGACUAUGUCGUAGUGG (SEQ ID NO: 32). In some embodiments, the gNA variant comprises a scaffold stem loop sequence of CCAGCGACUAUGUCGUAGUGG (SEQ ID NO: 32) with at least 1, 2, 3, 4, or 5 mismatches thereto.
- the gNA variant comprises an extended stem loop region comprising less than 32 nucleotides, less than 31 nucleotides, less than 30 nucleotides, less than 29 nucleotides, less than 28 nucleotides, less than 27 nucleotides, less than 26 nucleotides, less than 25 nucleotides, less than 24 nucleotides, less than 23 nucleotides, less than 22 nucleotides, less than 21 nucleotides, or less than 20 nucleotides.
- the gNA variant comprises an extended stem loop region comprising less than 32 nucleotides.
- the gNA variant further comprises a thermostable stem loop.
- a sgRNA variant comprises a sequence of SEQ ID NOS:2104, SEQ ID NO:2106, SEQ ID NO:2163, SEQ ID NO:2107, SEQ ID NO:2164, SEQ ID NO:2165,
- SEQ ID NO:2112 SEQ ID NO:2160, SEQ ID NO:2170, SEQ ID NO:2114, SEQ ID NO:2171,
- a sgRNA variant comprises a sequence of SEQ ID NOS: 2238, 2246, 2256, 2274 or 2275.
- the gNA variant comprises the sequence of any one of SEQ ID NOS: 2236, 2237, 2238, 2241, 2244, 2248, 2249, 2256, or 2259-2294, or having at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% identity thereto.
- the gNA variant comprises one or more additional changes to a sequence of any one of SEQ ID NOs: 2201-2294.
- the gNA variant comprises the sequence of any one of SEQ ID NOS:2236, 2237, 2238, 2241, 2244, 2248, 2249, or 2259-2294.
- a sgRNA variant comprises one or more additional changes to a sequence of SEQ ID NO :2104, SEQ ID NO :2163, SEQ ID NO :2107, SEQ ID NO :2164, SEQ ID NO:2165, SEQ ID NO:2166, SEQ ID NO:2103, SEQ ID NO:2167, SEQ ID NO:2105, SEQ ID NO:2108, SEQ ID NO:2112, SEQ ID NO:2160, SEQ ID NO:2170, SEQ ID N0:2114, SEQ ID
- the gNA variant comprises at least one modification, wherein the at least one modification compared to the reference guide scaffold of SEQ ID NO:5 is selected from one or more of: (a) a C18G substitution in the triplex loop; (b) a G55 insertion in the stem bubble; (c) aUl deletion; (d) a modification of the extended stem loop wherein (i) a 6 nt loop and 13 loop-proximal base pairs are replaced by a Uvsx hairpin; and (ii) a deletion of A99 and a substitution of G65U that results in a loop-distal base that is fully base-paired.
- the gNA variant comprises the sequence of any one of SEQ ID NOS:2236, 2237, 2238, 2241, 2244, 2248, 2249, 2256 or 2259-2294.
- the gNA variant further comprises a spacer (or targeting sequence) region located at the 3’ end of the gNA, specific to a C9orf72 sequence.
- spacers or targeting sequence region located at the 3’ end of the gNA, specific to a C9orf72 sequence.
- Exemplary spacers, and their cognate PAM sequences, are shown in Table 3 below.
- the gNA variant further comprises a spacer (or targeting sequence) region located at the 3’ end of the gNA, described more fully, supra, which comprises at least 14 to about 35 nucleotides wherein the spacer is designed with a sequence that is complementary to a target nucleic acid.
- the gNA variant comprises a targeting sequence of at least 10 to 30 nucleotides complementary to a target nucleic acid.
- the targeting sequence has 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35 nucleotides.
- the gNA variant comprises a targeting sequence having 20 nucleotides.
- the targeting sequence has 25 nucleotides.
- the targeting sequence has 24 nucleotides.
- the targeting sequence has 23 nucleotides. In some embodiments, the targeting sequence has 22 nucleotides. In some embodiments, the targeting sequence has 21 nucleotides. In some embodiments, the targeting sequence has 19 nucleotides. In some embodiments, the targeting sequence has 18 nucleotides. In some embodiments, the targeting sequence has 17 nucleotides. In some embodiments, the targeting sequence has 16 nucleotides.
- the targeting sequence has 15 nucleotides. In some embodiments, the targeting sequence has 14 nucleotides. In some embodiments, the disclosure provides targeting sequences for inclusion in the gNA variants of the disclosure comprising a sequence that is at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or 100% identical to a sequence of SEQ ID NOs: 309-343, 363- 2100 and 2295-21835.
- the targeting sequence of the gNA variant comprises a sequence a sequence of SEQ ID NOs: 309-343, 363-2100 and 2295-21835 with a single nucleotide removed from the 3' end of the sequence. In other embodiments, the targeting sequence of the gNA variant comprises a sequence a sequence of SEQ ID NOs: 309-343, 363- 2100 and 2295-21835 with two nucleotides removed from the 3' end of the sequence. In other embodiments, the targeting sequence of the gNA variant comprises a sequence a sequence of SEQ ID NOs: 309-343, 363-2100 and 2295-21835 with three nucleotides removed from the 3' end of the sequence.
- the targeting sequence of the gNA variant comprises a sequence a sequence of SEQ ID NOs: 309-343, 363-2100 and 2295-21835 with four nucleotides removed from the 3' end of the sequence. In other embodiments, the targeting sequence of the gNA variant comprises a sequence a sequence of SEQ ID NOs: 309-343, 363- 2100 and 2295-21835with five nucleotides removed from the 3' end of the sequence.
- the gNA variant further comprises a spacer (targeting) region located at the 3’ end of the gNA, wherein the spacer is designed with a sequence that is complementary to a target nucleic acid.
- the target nucleic acid comprises a PAM sequence located 5’ of the spacer with at least a single nucleotide separating the PAM from the first nucleotide of the spacer.
- the PAM is located on the non- targeted strand of the target region, i.e. the strand that is complementary to the target nucleic acid.
- the PAM sequence is ATC.
- the targeting sequence for an ATC PAM comprises SEQ ID NOs: 363-2100 or 2295-5426, or a sequence that is at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 99% identical to SEQ ID NOs: 363-2100 or 2295-5426.
- the targeting sequence for an ATC PAM is selected from the group consisting of SEQ ID NOs: 363-2100 or 2295-5426.
- the PAM sequence is CTC.
- the targeting sequence for a CTC PAM comprises SEQ ID NOs: 16203-21835, or a sequence that is at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 99% identical to SEQ ID NOs: 16203-21835.
- the targeting sequence for a CTC PAM is selected from the group consisting of SEQ ID NOs: 16203-21835.
- the PAM sequence is GTC.
- the targeting sequences for a GTC PAM comprises SEQ ID NOs: 12894-16202 or a sequence that is at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 99% identical to SEQ ID NOs: 12894-16202.
- the targeting sequence for a GTC PAM is selected from the group consisting of SEQ ID NOs: 12894-16202.
- the PAM sequence is TTC.
- a targeting sequences for a TTC PAM comprises SEQ ID NOs: 5427-12893, or a sequence that is at least 50% identical, at least 55% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 99% identical to SEQ ID NOs: 5427-12893.
- a targeting sequence for a TTC PAM is selected from the group consisting of SEQ ID NOs: 5427-12893.
- the scaffold of the gNA variant is part of an RNP with a reference CasX protein comprising SEQ ID NO: 1, SEQ ID NO:2, or SEQ ID NO:3.
- the scaffold of the gNA variant is part of an RNP with a CasX variant protein comprising any one of the sequences of Tables 4, 6, 7, 8, or 10 or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
- the gNA further comprises a spacer sequence.
- the scaffold of the gNA variant is a variant comprising one or more additional changes to a sequence of a reference gRNA that comprises SEQ ID NO:4 or SEQ ID NO:5.
- the scaffold of the reference gRNA is derived from SEQ ID NO:4 or SEQ ID NO:5
- the one or more improved or added characteristics of the gNA variant are improved compared to the same characteristic in SEQ ID NO:4 or SEQ ID NO:5.
- a gNA variant has an improved ability to form a complex with a CasX protein (such as a reference CasX or a CasX variant protein) when compared to a reference gRNA.
- a gNA variant has an improved affinity for a CasX protein (such as a reference or variant protein) when compared to a reference gRNA, thereby improving its ability to form a ribonucleoprotein (RNP) complex with the CasX protein, as described in the Examples. Improving ribonucleoprotein complex formation may, in some embodiments, improve the efficiency with which functional RNPs are assembled.
- RNPs comprising a gNA variant and its spacer are competent for gene editing of a target nucleic acid.
- a gNA variant has an improved ability to form a complex with a CasX protein (such as a reference CasX or a CasX variant protein) when compared to a reference gRNA.
- a gNA variant has an improved affinity for a CasX protein (such as a reference or variant protein) when compared to a reference gRNA, thereby improving its ability to form a ribonucleoprotein (RNP) complex with the CasX protein, as described in the Examples. Improving ribonucleoprotein complex formation may, in some embodiments, improve the efficiency with which functional RNPs are assembled.
- RNPs comprising a gNA variant and its spacer are competent for gene editing of a target nucleic acid.
- Exemplary nucleotide changes that can improve the ability of gNA variants to form a complex with CasX protein may, in some embodiments, include replacing the scaffold stem with a thermostable stem loop.
- replacing the scaffold stem with a thermostable stem loop could increase the overall binding stability of the gNA variant with the CasX protein.
- removing a large section of the stem loop could change the gNA variant folding kinetics and make a functional folded gNA easier and quicker to structurally-assemble, for example by lessening the degree to which the gNA variant can get “tangled” in itself.
- choice of scaffold stem loop sequence could change with different spacers that are utilized for the gNA.
- scaffold sequence can be tailored to the spacer and therefore the target sequence.
- Biochemical assays can be used to evaluate the binding affinity of CasX protein for the gNA variant to form the RNP, including the assays of the Examples.
- a person of ordinary skill can measure changes in the amount of a fluorescently tagged gNA that is bound to an immobilized CasX protein, as a response to increasing concentrations of an additional unlabeled “cold competitor” gNA.
- fluorescence signal can be monitored to or seeing how it changes as different amounts of fluorescently labeled gNA are flowed over immobilized CasX protein.
- the ability to form an RNP can be assessed using in vitro cleavage assays against a defined target nucleic acid sequence. i. gNA Stability
- a gNA variant has improved stability when compared to a reference gRNA.
- Increased stability and efficient folding may, in some embodiments, increase the extent to which a gNA variant persists inside a target cell, which may thereby increase the chance of forming a functional RNP capable of carrying out CasX functions such as gene editing.
- Increased stability of gNA variants may also, in some embodiments, allow for a similar outcome with a lower amount of gNA delivered to a cell, which may in turn reduce the chance of off-target effects during gene editing.
- Guide RNA stability can be assessed in a variety of ways, including for example in vitro by assembling the guide, incubating for varying periods of time in a solution that mimics the intracellular environment, and then measuring functional activity via the in vitro cleavage assays described herein.
- gNAs can be harvested from cells at varying time points after initial transfection/transduction of the gNA to determine how long gNA variants persist relative to reference gRNAs.
- a gNA variant has improved solubility when compared to a reference gRNA.
- a gNA variant has improved solubility of the CasX protein: gNA RNP when compared to a reference gRNA.
- solubility of the CasX protein:gNA RNP is improved by the addition of a ribozyme sequence to a 5’ or 3’ end of the gNA variant, for example the 5’ or 3’ of a reference sgRNA.
- Some ribozymes, such as the Ml ribozyme can increase solubility of proteins through RNA mediated protein folding.
- Increased solubility of CasX RNPs comprising a gNA variant as described herein can be evaluated through a variety of means known to one of skill in the art, such as by taking densitometry readings on a gel of the soluble fraction of lysed E. coli in which the CasX and gNA variants are expressed.
- k Resistance to Nuclease Activity
- a gNA variant has improved resistance to nuclease activity compared to a reference gRNA that may, for example, increase the persistence of a variant gNA in an intracellular environment, thereby improving gene editing.
- Resistance to nuclease activity may be evaluated through a variety of methods known to one of skill in the art. For example, in vitro methods of measuring resistance to nuclease activity may include for example contacting reference gNA and variants with one or more exemplary RNA nucleases and measuring degradation. Alternatively, or in addition, measuring persistence of a gNA variant in a cellular environment using the methods described herein can indicate the degree to which the gNA variant is nuclease resistant.
- a gNA variant has improved affinity for the target DNA relative to a reference gRNA.
- a ribonucleoprotein complex comprising a gNA variant has improved affinity for the target DNA, relative to the affinity of an RNP comprising a reference gRNA.
- the improved affinity of the RNP for the target DNA comprises improved affinity for the target sequence, improved affinity for the PAM sequence, improved ability of the RNP to search DNA for the target sequence, or any combinations thereof.
- the improved affinity for the target DNA is the result of increased overall DNA binding affinity.
- nucleotide changes in the gNA variant that affect the function of the OBD in the CasX protein may increase the affinity of CasX variant protein binding to the protospacer adjacent motif (PAM), as well as the ability to bind or utilize an increased spectrum of PAM sequences other than the canonical TTC PAM recognized by the reference CasX protein of SEQ ID NO:2, including PAM sequences selected from the group consisting of TTC, ATC, GTC, and CTC, thereby increasing the affinity and diversity of the CasX variant protein for target DNA sequences, resulting in a substantial increase in the target nucleic acid sequences that can be edited and/or bound, compared to a reference CasX.
- PAM protospacer adjacent motif
- increasing the sequences of the target nucleic acid that can be edited, compared to a reference CasX refers to both the PAM and the protospacer sequence and their directionality according to the orientation of the non-target strand. This does not imply that the PAM sequence of the non-target strand, rather than the target strand, is determinative of cleavage or mechanistically involved in target recognition.
- reference when reference is to a TTC PAM, it may in fact be the complementary GAA sequence that is required for target cleavage, or it may be some combination of nucleotides from both strands.
- the PAM is located 5’ of the protospacer with at least a single nucleotide separating the PAM from the first nucleotide of the protospacer.
- changes in the gNA that affect function of the helical I and/or helical II domains that increase the affinity of the CasX variant protein for the target DNA strand can increase the affinity of the CasX RNP comprising the variant gNA for target DNA.
- gNA variants can comprise larger structural changes that change the topology of the gNA variant with respect to the reference gRNA, thereby allowing for different gNA functionality.
- a gNA variant has swapped an endogenous stem loop of the reference gRNA scaffold with a previously identified stable RNA structure or a stem loop that can interact with a protein or RNA binding partner to recruit additional moieties to the CasX or to recruit CasX to a specific location, such as the inside of a viral capsid, that has the binding partner to the said RNA structure.
- RNAs may be recruited to each other, as in Kissing loops, such that two CasX proteins can be co localized for more effective gene editing at the target DNA sequence.
- RNA structures may include MS2, QP, U1 hairpin P, Uvsx, PP7, Phage replication loop, Kissing loop a, Kissing loop bl, Kissing loop_b2, G quadriplex M3q, G quadriplex telomere basket, Sarcin-ricin loop, or a Pseudoknot.
- a gNA variant comprises a terminal fusion partner.
- Exemplary terminal fusions may include fusion of the gRNA to a self-cleaving ribozyme or protein binding motif.
- a “ribozyme” refers to an RNA or segment thereof with one or more catalytic activities similar to a protein enzyme.
- Exemplary ribozyme catalytic activities may include, for example, cleavage and/or ligation of RNA, cleavage and/or ligation of DNA, or peptide bond formation. In some embodiments, such fusions could either improve scaffold folding or recruit DNA repair machinery.
- a gRNA may in some embodiments be fused to a hepatitis delta virus (HDV) antigenomic ribozyme, HDV genomic ribozyme, hatchet ribozyme (from metagenomic data), env25 pistol ribozyme (representative from Aliistipes putredinis), HH15 Minimal Hammerhead ribozyme, tobacco ringspot virus (TRSV) ribozyme, WT viral Hammerhead ribozyme (and rational variants), or Twisted Sister 1 or RBMX recruiting motif.
- Hammerhead ribozymes are RNA motifs that catalyze reversible cleavage and ligation reactions at a specific site within an RNA molecule.
- Hammerhead ribozymes include type I, type II and type III hammerhead ribozymes.
- the HDV, pistol, and hatchet ribozymes have self-cleaving activities.
- gNA variants comprising one or more ribozymes may allow for expanded gNA function as compared to a gRNA reference.
- gNAs comprising self cleaving ribozymes can, in some embodiments, be transcribed and processed into mature gNAs as part of polycistronic transcripts. Such fusions may occur at either the 5’ or the 3’ end of the gNA.
- a gNA variant comprises a fusion at both the 5’ and the 3’ end, wherein each fusion is independently as described herein.
- a gNA variant comprises a phage replication loop or a tetraloop.
- a gNA comprises a hairpin loop that is capable of binding a protein.
- the hairpin loop is an MS2, QP, U1 hairpin II, Uvsx, or PP7 hairpin loop.
- a gNA variant comprises one or more RNA aptamers.
- an “RNA aptamer” refers to an RNA molecule that binds a target with high affinity and high specificity.
- a gNA variant comprises one or more riboswitches.
- a “riboswitch” refers to an RNA molecule that changes state upon binding a small molecule.
- the gNA variant further comprises one or more protein binding motifs.
- Adding protein binding motifs to a reference gRNA or gNA variant of the disclosure may, in some embodiments, allow a CasX RNP to associate with additional proteins, which can, for example, add the functionality of those proteins to the CasX RNP.
- additional proteins which can, for example, add the functionality of those proteins to the CasX RNP.
- the disclosure relates to chemically-modified gNA.
- the present disclosure provides a chemically-modified gNA that has guide RNA functionality and has reduced susceptibility to cleavage by a nuclease.
- a gNA that comprises any nucleotide other than the four canonical ribonucleotides A, C, G, and U, or a deoxynucleotide is a chemically modified gNA.
- a chemically-modified gNA comprises any backbone or internucleotide linkage other than a natural phosphodiester intemucleotide linkage.
- the retained functionality includes the ability of the modified gNA to bind to a CasX of any of the embodiments described herein. In certain embodiments, the retained functionality includes the ability of the modified gNA to bind to a C9orf72 target nucleic acid sequence. In certain embodiments, the retained functionality includes targeting a CasX protein or the ability of a pre-complexed CasX protein-gNA to bind to a target nucleic acid sequence. In certain embodiments, the retained functionality includes the ability to nick a target polynucleotide by a CasX-gNA. In certain embodiments, the retained functionality includes the ability to cleave a target nucleic acid sequence by a CasX-gNA. In certain embodiments, the retained functionality is any other known function of a gNA in a CasX system with a CasX protein of the embodiments of the disclosure.
- the disclosure provides a chemically-modified gNA in which a nucleotide sugar modification is incorporated into the gNA selected from the group consisting of 2'-0 — Ci-4alkyl such as 2'-0-methyl (2'-OMe), 2'-deoxy (2'-H), 2'-0 — Ci- 3 alkyl-0 — Ci-3alkyl such as 2 '-m ethoxy ethyl (“2'-MOE”), 2'-fluoro (“2'-F”), 2'-amino (“2'-NH 2 ”), 2'-arabinosyl (“2 - arabino”) nucleotide, 2'-F-arabinosyl (“2'-F-arabino”) nucleotide, 2'-locked nucleic acid (“LNA”) nucleotide, 2'-unlocked nucleic acid (“ULNA”) nucleotide, a sugar in L form (“L- sugar”), and
- an intemucleotide linkage modification incorporated into the guide RNA is selected from the group consisting of: phosphorothioate “P(S)” (P(S)), phosphonocarboxylate (P(CH2) n COOR) such as phosphonoacetate “PACE” (P(CH2COO-)), thiophosphonocarboxylate ((S)P(CH2) n COOR) such as thiophosphonoacetate “thioPACE” ((S)P(CH2) n COO-)), alkylphosphonate (P(Ci-3alkyl) such as methylphosphonate — P(CH3), boranophosphonate (P(BH 3 )), and phosphorodithioate (P(S)2).
- P(S) phosphorothioate
- P(CH2) n COOR such as phosphonoacetate “PACE” (P(CH2COO-)
- the disclosure provides a chemically-modified gNA in which a nucleobase (“base”) modification is incorporated into the gNA selected from the group consisting of: 2-thiouracil (“2-thioU”), 2-thiocytosine (“2-thioC”), 4-thiouracil (“4-thioU”), 6- thioguanine (“6-thioG”), 2-aminoadenine (“2-aminoA”), 2-aminopurine, pseudouracil, hypoxanthine, 7-deazaguanine, 7-deaza-8-azaguanine, 7-deazaadenine, 7-deaza-8-azaadenine, 5- methylcytosine (“5-methylC”), 5-methyluracil (“5-methylU”), 5 -hydroxymethyl cytosine, 5- hydroxymethyluracil, 5,6-dehydrouracil, 5-propynylcytosine, 5-propynyluracil, 5- ethynylcyto
- the disclosure provides a chemically-modified gNA in which one or more isotopic modifications are introduced on the nucleotide sugar, the nucleobase, the phosphodi ester linkage and/or the nucleotide phosphates, including nucleotides comprising one or more 15 N, 13 C, 14 C, deuterium, 3 ⁇ 4, 32 P, 125 I, 131 I atoms or other atoms or elements used as tracers.
- an “end” modification incorporated into the gNA is selected from the group consisting of: PEG (polyethyleneglycol), hydrocarbon linkers (including: heteroatom (0,S,N)-substituted hydrocarbon spacers; halo-substituted hydrocarbon spacers; keto-, carboxyl-, amido-, thionyl-, carbamoyl-, thionocarbamaoyl-containing hydrocarbon spacers), spermine linkers, dyes including fluorescent dyes (for example fluoresceins, rhodamines, cyanines) attached to linkers such as, for example, 6-fluorescein-hexyl, quenchers (for example dabcyl, BHQ) and other labels (for example biotin, digoxigenin, acridine, streptavidin, avidin, peptides and/or proteins).
- PEG polyethyleneglycol
- hydrocarbon linkers including: heteroatom (0,S,N)-substitute
- an “end” modification comprises a conjugation (or ligation) of the gNA to another molecule comprising an oligonucleotide of deoxynucleotides and/or ribonucleotides, a peptide, a protein, a sugar, an oligosaccharide, a steroid, a lipid, a folic acid, a vitamin and/or other molecule.
- the disclosure provides a chemically-modified gNA in which an “end” modification (described above) is located internally in the gNA sequence via a linker such as, for example, a 2-(4-butylamidofluorescein)propane-l,3-diol bis(phosphodiester) linker, which is incorporated as a phosphodiester linkage and can be incorporated anywhere between two nucleotides in the gNA.
- a linker such as, for example, a 2-(4-butylamidofluorescein)propane-l,3-diol bis(phosphodiester) linker, which is incorporated as a phosphodiester linkage and can be incorporated anywhere between two nucleotides in the gNA.
- the disclosure provides a chemically-modified gNA having an end modification comprising a terminal functional group such as an amine, a thiol (or sulfhydryl), a hydroxyl, a carboxyl, carbonyl, thionyl, thiocarbonyl, a carbamoyl, a thiocarbamoyl, a phoshoryl, an alkene, an alkyne, an halogen or a functional group-terminated linker that can be subsequently conjugated to a desired moiety selected from the group consisting of a fluorescent dye, a non-fluorescent label, a tag (for 14 C, example biotin, avidin, streptavidin, or moiety containing an isotopic label such as 15 N, 13 C, deuterium, 3 H, 32 P, 125 I and the like), an oligonucleotide (comprising deoxynucleotides and/or ribonu
- the conjugation employs standard chemistry well-known in the art, including but not limited to coupling via N-hydroxysuccinimide, isothiocyanate, DCC (or DCI), and/or any other standard method as described in “Bioconjugate Techniques” by Greg T. Hermanson, Publisher Eslsevier Science, 3 rd ed. (2013), the contents of which are incorporated herein by reference in its entirety.
- the present disclosure provides systems comprising a CRISPR nuclease that have utility in genome editing of eukaryotic cells.
- the CRISPR nuclease employed in the genome editing systems is a Class 2 Type V nuclease.
- members of Class 2 Type V CRISPR-Cas systems have differences, they share some common characteristics that distinguish them from the Cas9 systems.
- the Type V nucleases possess a single RNA-guided RuvC domain-containing effector but no HNH domain, and they recognize T-rich PAM 5' upstream to the target region on the non-targeted strand, which is different from Cas9 systems which rely on G-rich PAM at 3' side of target sequences.
- Type V nucleases generate staggered double-stranded breaks distal to the PAM sequence, unlike Cas9, which generates a blunt end in the proximal site close to the PAM.
- Type V nucleases degrade ssDNA in trans when activated by target dsDNA or ssDNA binding in cis.
- the Type V nucleases of the embodiments recognize a 5'-TC PAM motif and produce staggered ends cleaved solely by the RuvC domain.
- the Type V nuclease is selected from the group consisting of Casl2a, Casl2b, Casl2c, Casl2d (CasY), and CasX.
- the Type V nuclease is a CasX nuclease.
- the present disclosure provides systems comprising a CasX protein and one or more gNA acids (CasX:gNA system) that are specifically designed to modify a target nucleic acid sequence in eukaryotic cells.
- CasX protein refers to a family of proteins, and encompasses all naturally occurring CasX proteins, proteins that share at least 50% identity to naturally occurring CasX proteins, as well as CasX variants exhibiting one or more improved characteristics relative to a naturally-occurring reference CasX protein.
- Exemplary improved characteristics of the CasX variant embodiments include, but are not limited to improved folding of the variant, improved binding affinity to the gNA, improved binding affinity to the target nucleic acid, improved ability to utilize a greater spectrum of PAM sequences in the editing and/or binding of target DNA, improved unwinding of the target DNA, increased editing activity, improved editing efficiency, improved editing specificity, increased percentage of a eukaryotic genome that can be efficiently edited, increased activity of the nuclease, increased target strand loading for double strand cleavage, decreased target strand loading for single strand nicking, decreased off-target cleavage, improved binding of the non target strand of DNA, improved protein stability, improved proteimgNA (RNP) complex stability, improved protein solubility, improved proteimgNA (RNP) complex solubility, improved protein yield, improved protein expression, and improved fusion characteristics, as described more fully, below.
- the RNP of the CasX variant and the gNA variant exhibit one or more of the improved characteristics that are at least about 1.1 to about 100,000-fold improved relative to an RNP of the reference CasX protein of SEQ ID NO:l, SEQ ID NO:2, or SEQ ID NO:3 and the gNA of Table 1, when assayed in a comparable fashion.
- the one or more improved characteristics of an RNP of the CasX variant and the gNA variant are at least about 1.1, at least about 10, at least about 100, at least about 1000, at least about 10,000, at least about 100,000-fold or more improved relative to an RNP of the reference CasX protein of SEQ ID NO:l, SEQ ID NO:2, or SEQ ID NO:3 and the gNA of Table 1.
- the one or more of the improved characteristics of an RNP of the CasX variant and the gNA variant are about 1.1 to 100,00-fold, about 1.1 to 10,00-fold, about 1.1 to 1,000- fold, about 1.1 to 500-fold, about 1.1 to 100-fold, about 1.1 to 50-fold, about 1.1 to 20-fold, about 10 to 100,00-fold, about 10 to 10,00-fold, about 10 to 1,000-fold, about 10 to 500-fold, about 10 to 100-fold, about 10 to 50-fold, about 10 to 20-fold, about 2 to 70-fold, about 2 to 50- fold, about 2 to 30-fold, about 2 to 20-fold, about 2 to 10-fold, about 5 to 50-fold, about 5 to 30- fold, about 5 to 10-fold, about 100 to 100,00-fold, about 100 to 10,00-fold, about 100 to 1,000- fold, about 100 to 500-fold, about 500 to 100,00-fold, about 500 to 10,00-fold, about 500 to 1,000-fold, about 500 to 750-fold, about 1,000 to 10
- the one or more improved characteristics of an RNP of the CasX variant and the gNA variant are about 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6- fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10- fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 25- fold, 30-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 110-fold, 120-fold, 130-fold, 140-fold, 150-fold, 160-fold, 170-fold, 180-fold, 190-fold, 200- fold, 210-fold, 220-fold, 230-fold, 240-fold, 250-fold, 260-fold, 270
- CasX variant is inclusive of variants that are fusion proteins; i.e., the CasX is “fused to” a heterologous sequence. This includes CasX variants comprising CasX variant sequences and N-terminal, C-terminal, or internal fusions of the CasX to a heterologous protein or domain thereof.
- CasX proteins of the disclosure comprise at least one of the following domains: a non target strand binding (NTSB) domain, a target strand loading (TSL) domain, a helical I domain, a helical II domain, an oligonucleotide binding domain (OBD), and a RuvC DNA cleavage domain (the last of which may be modified or deleted in a catalytically dead CasX variant), described more fully, below.
- NTSB non target strand binding
- TSL target strand loading
- OBD oligonucleotide binding domain
- RuvC DNA cleavage domain the last of which may be modified or deleted in a catalytically dead CasX variant
- the CasX variant proteins of the disclosure have an enhanced ability to efficiently edit and/or bind target DNA, when complexed with a gNA as an RNP, utilizing PAM TC motif, including PAM sequences selected from TTC, ATC, GTC, or CTC, compared to an RNP of a reference CasX protein and reference gNA.
- PAM TC motif including PAM sequences selected from TTC, ATC, GTC, or CTC, compared to an RNP of a reference CasX protein and reference gNA.
- the PAM sequence is located at least 1 nucleotide 5’ to the non-target strand of the protospacer having identity with the targeting sequence of the gNA in a assay system compared to the editing efficiency and/or binding of an RNP comprising a reference CasX protein and reference gNA in a comparable assay system.
- an RNP of a CasX variant and gNA variant exhibits greater editing efficiency and/or binding of a target sequence in the target DNA compared to an RNP comprising a reference CasX protein and a reference gNA in a comparable assay system, wherein the PAM sequence of the target DNA is TTC.
- an RNP of a CasX variant and gNA variant exhibits greater editing efficiency and/or binding of a target sequence in the target DNA compared to an RNP comprising a reference CasX protein and a reference gNA in a comparable assay system, wherein the PAM sequence of the target DNA is ATC.
- an RNP of a CasX variant and gNA variant exhibits greater editing efficiency and/or binding of a target sequence in the target DNA compared to an RNP comprising a reference CasX protein and a reference gNA in a comparable assay system, wherein the PAM sequence of the target DNA is CTC.
- an RNP of a CasX variant and gNA variant exhibits greater editing efficiency and/or binding of a target sequence in the target DNA compared to an RNP comprising a reference CasX protein and a reference gNA in a comparable assay system, wherein the PAM sequence of the target DNA is GTC.
- the increased editing efficiency and/or binding affinity for the one or more PAM sequences is at least 1.5-fold greater or more compared to the editing efficiency and/or binding affinity of an RNP of any one of the CasX proteins of SEQ ID NOST- 3 and the gNA of Table 1 for the PAM sequences.
- a CasX protein can bind and/or modify (e.g., cleave, nick, methylate, demethylate, etc.) a target nucleic acid and/or a polypeptide associated with target nucleic acid (e.g., methylation or acetylation of a histone tail).
- the CasX protein is catalytically dead (dCasX) but retains the ability to bind a target nucleic acid.
- An exemplary catalytically dead CasX protein comprises one or more mutations in the active site of the RuvC domain of the CasX protein.
- a catalytically dead CasX protein comprises substitutions at residues 672, 769 and/or 935 of SEQ ID NO:l. In one embodiment, a catalytically dead CasX protein comprises substitutions of D672A, E769A and/or D935A in a reference CasX protein of SEQ ID NO:l. In other embodiments, a catalytically dead CasX protein comprises substitutions at amino acids 659, 756 and/or 922 in a reference CasX protein of SEQ ID NO:2. In some embodiments, a catalytically dead CasX protein comprises D659A, E756A and/or D922A substitutions in a reference CasX protein of SEQ ID NO:2.
- a catalytically dead CasX protein comprises deletions of all or part of the RuvC domain of the CasX protein. It will be understood that the same foregoing substitutions can similarly be introduced into the CasX variants of the disclosure, resulting in a dCasX variant. In one embodiment, all or a portion of the RuvC domain is deleted from the CasX variant, resulting in a dCasX variant. Catalytically inactive dCasX variant proteins can, in some embodiments, be used for base editing or epigenetic modifications.
- catalytically inactive dCasX variant proteins can, relative to catalytically active CasX, find their target nucleic acid faster, remain bound to target nucleic acid for longer periods of time, bind target nucleic acid in a more stable fashion, or a combination thereof, thereby improving these functions of the catalytically dead CasX variant protein compared to a CasX variant that retains its cleavage capability.
- the reference CasX proteins of the disclosure comprise a non-target strand binding domain (NTSBD).
- NTSBD is a domain not previously found in any Cas proteins; for example this domain is not present in Cas proteins such as Cas9, Casl2a/Cpfl, Casl3, Casl4, CASCADE, CSM, or CSY.
- a NTSBD in a CasX allows for binding to the non-target DNA strand and may aid in unwinding of the non-target and target strands.
- the NTSBD is presumed to be responsible for the unwinding, or the capture, of a non-target DNA strand in the unwound state.
- the NTSBD is in direct contact with the non-target strand in CryoEM model structures derived to date and may contain a non-canonical zinc finger domain.
- the NTSBD may also play a role in stabilizing DNA during unwinding, guide RNA invasion and R-loop formation.
- an exemplary NTSBD comprises amino acids 101-191 of SEQ ID NO:l or amino acids 103-192 of SEQ ID NO:2.
- the NTSBD of a reference CasX protein comprises a four-stranded beta sheet.
- the reference CasX proteins of the disclosure comprise a Target Strand Loading (TSL) domain.
- TSL domain is a domain not found in certain Cas proteins such as Cas9, CASCADE, CSM, or CSY. Without wishing to be bound by theory or mechanism, it is thought that the TSL domain is responsible for aiding the loading of the target DNA strand into the RuvC active site of a CasX protein.
- the TSL acts to place or capture the target-strand in a folded state that places the scissile phosphate of the target strand DNA backbone in the RuvC active site.
- the TSL comprises a cys4 (CXXC, CXXC zinc finger/ribbon domain (SEQ ID NO: 48) that is separated by the bulk of the TSL.
- an exemplary TSL comprises amino acids 825-934 of SEQ ID NO:l or amino acids 813-921 of SEQ ID NO:2.
- the reference CasX proteins of the disclosure comprise a helical I domain. Certain Cas proteins other than CasX have domains that may be named in a similar way. However, in some embodiments, the helical I domain of a CasX protein comprises one or more unique structural features, or comprises a unique sequence, or a combination thereof, compared to non- CasX proteins. For example, in some embodiments, the helical I domain of a CasX protein comprises one or more unique secondary structures compared to domains in other Cas proteins that may have a similar name. For example, in some embodiments the helical I domain in a CasX protein comprises one or more alpha helices of unique structure and sequence in arrangement, number and length compared to other CRISPR proteins.
- the helical I domain is responsible for interacting with the bound DNA and spacer of the guide RNA. Without wishing to be bound by theory, it is thought that in some cases the helical I domain may contribute to binding of the protospacer adjacent motif (PAM).
- PAM protospacer adjacent motif
- an exemplary helical I domain comprises amino acids 57-100 and 192-332 of SEQ ID NO:l, or amino acids 59-102 and 193-333 of SEQ ID NO:2.
- the helical I domain of a reference CasX protein comprises one or more alpha helices.
- the reference CasX proteins of the disclosure comprise a helical II domain.
- Certain Cas proteins other than CasX have domains that may be named in a similar way.
- the helical II domain of a CasX protein comprises one or more unique structural features, or a unique sequence, or a combination thereof, compared to domains in other Cas proteins that may have a similar name.
- the helical P domain comprises one or more unique structural alpha helical bundles that align along the target DNA:guide RNA channel.
- a CasX comprising a helical II domain
- the target strand and guide RNA interact with helical II (and the helical I domain, in some embodiments) to allow RuvC domain access to the target DNA.
- the helical II domain is responsible for binding to the guide RNA scaffold stem loop as well as the bound DNA.
- an exemplary helical II domain comprises amino acids 333-509 of SEQ ID NO:l, or amino acids 334-501 of SEQ ID NO:2.
- the reference CasX proteins of the disclosure comprise an Oligonucleotide Binding Domain (OBD).
- OBD Oligonucleotide Binding Domain
- Certain Cas proteins other than CasX have domains that may be named in a similar way.
- the OBD comprises one or more unique functional features, or comprises a sequence unique to a CasX protein, or a combination thereof.
- the bridged helix (BH), helical I domain, helical II domain, and Oligonucleotide Binding Domain (OBD) together are responsible for binding of a CasX protein to the guide RNA.
- the OBD is unique to a CasX protein in that it interacts functionally with a helical I domain, or a helical II domain, or both, each of which may be unique to a CasX protein as described herein.
- the OBD largely binds the RNA triplex of the guide RNA scaffold.
- the OBD may also be responsible for binding to the protospacer adjacent motif (PAM).
- An exemplary OBD domain comprises amino acids 1-56 and 510-660 of SEQ ID NO:l, or amino acids 1-58 and 502-647 of SEQ ID NO:2.
- the reference CasX proteins of the disclosure comprise a RuvC domain, that includes 2 partial RuvC domains (RuvC -I and RuvC-II).
- the RuvC domain is the ancestral domain of all type 12 CRISPR proteins.
- the RuvC domain originates from a TNPB (transposase B) like transposase.
- the CasX RuvC domain has a DED catalytic triad that is responsible for coordinating a magnesium (Mg) ion and cleaving DNA.
- the RuvC has a DED motif active site that is responsible for cleaving both strands of DNA (one by one, most likely the non-target strand first at 11-14 nucleotides (nt) into the targeted sequence and then the target strand next at 2-4 nucleotides after the target sequence).
- the RuvC domain is unique in that it is also responsible for binding the guide RNA scaffold stem loop that is critical for CasX function.
- An exemplary RuvC domain comprises amino acids 661-824 and 935-986 of SEQ ID NO:l, or amino acids 648-812 and 922- 978 of SEQ ID NO :2.
- the disclosure provides naturally-occurring CasX proteins (referred to herein as a "reference CasX protein”) that function as an endonuclease that catalyzes a double strand break at a specific sequence in a targeted double-stranded DNA (dsDNA).
- the sequence specificity is provided by the targeting sequence of the associated gNA to which it is complexed, which hybridizes to a target sequence within the target nucleic acid.
- reference CasX proteins can be isolated from naturally occurring prokaryotes, such as Deltaproteobacteria , Planctomycetes, or Candidatus Sungbacteria species.
- a reference CasX protein (sometimes referred to herein as a reference CasX protein) is a Type V CRISPR/Cas endonuclease belonging to the CasX (sometimes referred to as Casl2e) family of proteins that is capable of interacting with a guide NA to form a ribonucleoprotein (RNP) complex.
- the RNP complex comprising the reference CasX protein can be targeted to a particular site in a target nucleic acid via base pairing between the targeting sequence (or spacer) of the gNA and a target sequence in the target nucleic acid.
- the RNP comprising the reference CasX protein is capable of cleaving target DNA.
- the RNP comprising the reference CasX protein is capable of nicking target DNA. In some embodiments, the RNP comprising the reference CasX protein is capable of editing target DNA, for example in those embodiments where the reference CasX protein is capable of cleaving or nicking DNA, followed by non-homologous end joining (NHEJ), homology-directed repair (HDR), homology- independent targeted integration (HGP), micro-homology mediated end joining (MMEJ), single strand annealing (SSA) or base excision repair (BER).
- NHEJ non-homologous end joining
- HDR homology-directed repair
- HGP homology- independent targeted integration
- MMEJ micro-homology mediated end joining
- SSA single strand annealing
- BER base excision repair
- the RNP comprising the CasX protein is a catalytically dead (is catalytically inactive or has substantially no cleavage activity) CasX protein (dCasX), but retains the ability to bind the target DNA, described more fully, supra.
- a reference CasX protein is isolated or derived from Deltaproteobacter .
- a CasX protein comprises a sequence at least 50% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical or 100% identical to a sequence of:
- a reference CasX protein is isolated or derived from Planctomycetes.
- a CasX protein comprises a sequence at least 50% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical or 100% identical to a sequence of:
- the CasX protein comprises the sequence of SEQ ID NO: 2, or at least 60% similarity thereto. In some embodiments, the CasX protein comprises the sequence of SEQ ID NO: 2, or at least 80% similarity thereto. In some embodiments, the CasX protein comprises the sequence of SEQ ID NO: 2, or at least 90% similarity thereto. In some embodiments, the CasX protein comprises the sequence of SEQ ID NO: 2, or at least 95% similarity thereto. In some embodiments, the CasX protein consists of the sequence of SEQ ID NO: 2.
- the CasX protein comprises or consists of a sequence that has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 30, at least 40 or at least 50 mutations relative to the sequence of SEQ ID NO: 2. These mutations can be insertions, deletions, amino acid substitutions, or any combinations thereof.
- a reference CasX protein is isolated or derived from Candidatus Sungbacteria.
- a CasX protein comprises a sequence at least 50% identical, at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical or 100% identical to a sequence of
- the CasX protein comprises the sequence of SEQ ID NO: 3, or at least 60% similarity thereto. In some embodiments, the CasX protein comprises the sequence of SEQ ID NO: 3, or at least 80% similarity thereto. In some embodiments, the CasX protein comprises the sequence of SEQ ID NO: 3, or at least 90% similarity thereto. In some embodiments, the CasX protein comprises the sequence of SEQ ID NO: 3, or at least 95% similarity thereto. In some embodiments, the CasX protein consists of the sequence of SEQ ID NO: 3.
- the CasX protein comprises or consists of a sequence that has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 30, at least 40 or at least 50 mutations relative to the sequence of SEQ ID NO: 3. These mutations can be insertions, deletions, amino acid substitutions, or any combinations thereof. h. CasX Variant Proteins
- the present disclosure provides variants of a reference CasX protein (interchangeably referred to herein as “CasX variant” or “CasX variant protein”), wherein the CasX variants comprise at least one modification in at least one domain of the reference CasX protein, including the sequences of SEQ ID NOS: 1-3.
- the CasX variant exhibits at least one improved characteristic compared to the reference CasX protein. All variants that improve one or more functions or characteristics of the CasX variant protein when compared to a reference CasX protein described herein are envisaged as being within the scope of the disclosure.
- the modification is a mutation in one or more amino acids of the reference CasX.
- the modification is a substitution of one or more domains of the reference CasX with one or more domains from a different CasX.
- insertion includes the insertion of a part or all of a domain from a different CasX protein. Mutations can occur in any one or more domains of the reference CasX protein, and may include, for example, deletion of part or all of one or more domains, or one or more amino acid substitutions, deletions, or insertions in any domain of the reference CasX protein.
- the domains of CasX proteins include the non-target strand binding (NTSB) domain, the target strand loading (TSL) domain, the helical I domain, the helical II domain, the oligonucleotide binding domain (OBD), and the RuvC DNA cleavage domain.
- NTSB non-target strand binding
- TSL target strand loading
- OBD oligonucleotide binding domain
- RuvC DNA cleavage domain Any change in amino acid sequence of a reference CasX protein that leads to an improved characteristic of the CasX protein is considered a CasX variant protein of the disclosure.
- CasX variants can comprise one or more amino acid substitutions, insertions, deletions, or swapped domains, or any combinations thereof, relative to a reference CasX protein sequence.
- the CasX variant protein comprises at least one modification in at least each of two domains of the reference CasX protein, including the sequences of SEQ ID NOS: 1-3. In some embodiments, the CasX variant protein comprises at least one modification in at least 2 domains, in at least 3 domains, at least 4 domains or at least 5 domains of the reference CasX protein. In some embodiments, the CasX variant protein comprises two or more modifications in at least one domain of the reference CasX protein. In some embodiments, the CasX variant protein comprises at least two modifications in at least one domain of the reference CasX protein, at least three modifications in at least one domain of the reference CasX protein or at least four modifications in at least one domain of the reference CasX protein.
- each modification is made in a domain independently selected from the group consisting of a NTSBD, TSLD, Helical I domain, Helical II domain, OBD, and RuvC DNA cleavage domain.
- the at least one modification of the CasX variant protein comprises a deletion of at least a portion of one domain of the reference CasX protein, including the sequences of SEQ ID NOS: 1-3.
- the deletion is in the NTSBD, TSLD, Helical I domain, Helical II domain, OBD, or RuvC DNA cleavage domain.
- Suitable mutagenesis methods for generating CasX variant proteins of the disclosure may include, for example, Deep Mutational Evolution (DME), deep mutational scanning (DMS), error prone PCR, cassette mutagenesis, random mutagenesis, staggered extension PCR, gene shuffling, or domain swapping.
- the CasX variants are designed, for example by selecting one or more desired mutations in a reference CasX.
- the activity of a reference CasX protein is used as a benchmark against which the activity of one or more CasX variants are compared, thereby measuring improvements in function of the CasX variants.
- Exemplary improvements of CasX variants include, but are not limited to, improved folding of the variant, improved binding affinity to the gNA, improved binding affinity to the target DNA, altered binding affinity to one or more PAM sequences, improved unwinding of the target DNA, increased activity, improved editing efficiency, improved editing specificity, increased activity of the nuclease, increased target strand loading for double strand cleavage, decreased target strand loading for single strand nicking, decreased off-target cleavage, improved binding of the non-target strand of DNA, improved protein stability, improved proteimgNA complex stability, improved protein solubility, improved proteimgNA complex solubility, improved protein yield, improved protein expression, and improved fusion characteristics, as described more fully, below.
- the at least one modification comprises: (a) a substitution of 1 to 100 consecutive or non-consecutive amino acids in the CasX variant compared to a reference CasX of SEQ ID NO: 1, SEQ ID NO:2, or SEQ ID NO:3; (b) a deletion of 1 to 100 consecutive or non-consecutive amino acids in the CasX variant compared to a reference CasX; (c) an insertion of 1 to 100 consecutive or non- consecutive amino acids in the CasX compared to a reference CasX; or (d) any combination of (a)-(c).
- the at least one modification comprises: (a) a substitution of 5-10 consecutive or non-consecutive amino acids in the CasX variant compared to a reference CasX of SEQ ID NO: 1, SEQ ID NO:2, or SEQ ID NO:3; (b) a deletion of 1-5 consecutive or non- consecutive amino acids in the CasX variant compared to a reference CasX; (c) an insertion of 1-5 consecutive or non-consecutive amino acids in the CasX compared to a reference CasX; or (d) any combination of (a)-(c).
- the CasX variant protein comprises or consists of a sequence that has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 30, at least 40 or at least 50 mutations relative to the sequence of SEQ ID NO:l, SEQ ID NO:2, or SEQ ID NO:3. These mutations can be insertions, deletions, amino acid substitutions, or any combinations thereof.
- the CasX variant protein comprises at least one amino acid substitution in at least one domain of a reference CasX protein. In some embodiments, the CasX variant protein comprises at least about 1-4 amino acid substitutions, 1-10 amino acid substitutions, 1-20 amino acid substitutions, 1-30 amino acid substitutions, 1-40 amino acid substitutions, 1-50 amino acid substitutions, 1-60 amino acid substitutions, 1-70 amino acid substitutions, 1-80 amino acid substitutions, 1-90 amino acid substitutions, 1-100 amino acid substitutions, 2-10 amino acid substitutions, 2-20 amino acid substitutions, 2-30 amino acid substitutions, 3-10 amino acid substitutions, 3-20 amino acid substitutions, 3-30 amino acid substitutions, 4-10 amino acid substitutions, 4-20 amino acid substitutions, 3-300 amino acid substitutions, 5-10 amino acid substitutions, 5-20 amino acid substitutions, 5-30 amino acid substitutions, 10-50 amino acid substitutions, or 20-50 amino acid substitutions, relative to a reference CasX protein, which can be consecutive or non-consecutive, or in different domains.
- the CasX variant protein comprises at least about 100 or more amino acid substitutions relative to a reference CasX protein.
- the amino acid substitutions are conservative substitutions.
- the substitutions are non-conservative; e.g., a polar amino acid is substituted for a non-polar amino acid, or vice versa.
- Any amino acid can be substituted for any other amino acid in the substitutions described herein.
- the substitution can be a conservative substitution (e.g., a basic amino acid is substituted for another basic amino acid).
- the substitution can be a non-conservative substitution (e.g., a basic amino acid is substituted for an acidic amino acid or vice versa).
- a proline in a reference CasX protein can be substituted for any of arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, glutamine, cysteine, glycine, alanine, isoleucine, leucine, methionine, phenylalanine, tryptophan, tyrosine or valine to generate a CasX variant protein of the disclosure.
- a CasX variant protein comprises at least one amino acid deletion relative to a reference CasX protein.
- a CasX variant protein comprises a deletion of 1-4 amino acids, 1-10 amino acids, 1-20 amino acids, 1-30 amino acids, 1-40 amino acids, 1-50 amino acids, 1-60 amino acids, 1-70 amino acids, 1-80 amino acids, 1-90 amino acids, 1-100 amino acids, 2-10 amino acids, 2-20 amino acids, 2-30 amino acids, 3-10 amino acids, 3-20 amino acids, 3-30 amino acids, 4-10 amino acids, 4-20 amino acids, 3-300 amino acids, 5-10 amino acids, 5-20 amino acids, 5-30 amino acids, 10-50 amino acids or 20-50 amino acids relative to a reference CasX protein.
- a CasX protein comprises a deletion of at least about 100 consecutive amino acids relative to a reference CasX protein. In some embodiments, a CasX variant protein comprises a deletion of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50 or 100 consecutive amino acids relative to a reference CasX protein. In some embodiments, a CasX variant protein comprises a deletion of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 consecutive amino acids.
- a CasX variant protein comprises two or more deletions relative to a reference CasX protein, and the two or more deletions are not consecutive amino acids.
- a first deletion may be in a first domain of the reference CasX protein
- a second deletion may be in a second domain of the reference CasX protein.
- a CasX variant protein comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 non-consecutive deletions relative to a reference CasX protein.
- a CasX variant protein comprises at least 20 non-consecutive deletions relative to a reference CasX protein. Each non-consecutive deletion may be of any length of amino acids described herein, e.g., 1-4 amino acids, 1-10 amino acids, and the like.
- the CasX variant protein comprises one or more amino acid insertions relative to the sequence of SEQ ID NOS:l, 2, or 3.
- a CasX variant protein comprises an insertion of 1 amino acid, an insertion of 2-3 consecutive or non- consecutive amino acids, 2-4 consecutive or non-consecutive amino acids, 2-5 consecutive or non-consecutive amino acids, 2-6 consecutive or non-consecutive amino acids, 2-7 consecutive or non-consecutive amino acids, 2-8 consecutive or non-consecutive amino acids, 2-9 consecutive or non-consecutive amino acids, 2-10 consecutive or non-consecutive amino acids,
- 2-20 consecutive or non-consecutive amino acids 2-30 consecutive or non-consecutive amino acids, 2-40 consecutive or non-consecutive amino acids, 2-50 consecutive or non-consecutive amino acids, 2-60 consecutive or non-consecutive amino acids, 2-70 consecutive or non- consecutive amino acids, 2-80 consecutive or non-consecutive amino acids, 2-90 consecutive or non-consecutive amino acids, 2-100 consecutive or non-consecutive amino acids, 3-10 consecutive or non-consecutive amino acids, 3-20 consecutive or non-consecutive amino acids,
- the CasX variant protein comprises an insertion of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 consecutive or non-consecutive amino acids.
- a CasX variant protein comprises an insertion of at least about 100 consecutive or non-consecutive amino acids. Any amino acid, or combination of amino acids, can be inserted in the insertions described herein to generate a CasX variant protein.
- a CasX variant protein can comprise at least one substitution and at least one deletion relative to a reference CasX protein sequence, at least one substitution and at least one insertion relative to a reference CasX protein sequence, at least one insertion and at least one deletion relative to a reference CasX protein sequence, or at least one substitution, one insertion and one deletion relative to a reference CasX protein sequence.
- the CasX variant protein has at least about 60% sequence similarity to SEQ ID NO:2 or a portion thereof.
- the CasX variant protein comprises a substitution of Y789T of SEQ ID NO:2, a deletion of P793 of SEQ ID NO:2, a substitution of Y789D of SEQ ID NO:2, a substitution of T72S of SEQ ID NO:2, a substitution of I546V of SEQ ID NO:2, a substitution of E552A of SEQ ID NO:2, a substitution of A636D of SEQ ID NO:2, a substitution of F536S of SEQ ID NO:2, a substitution of A708K of SEQ ID NO:2, a substitution of Y797L of SEQ ID NO:2, a substitution of L792G SEQ ID NO:2, a substitution of A739V of SEQ ID NO:2, a substitution of G791M of SEQ ID NO:2, an insertion of A at position 661of SEQ
- the CasX variant comprises at least one modification in the NTSB domain.
- the CasX variant comprises at least one modification in the TSL domain. In some embodiments, the at least one modification in the TSL domain comprises an amino acid substitution of one or more of amino acids Y857, S890, or S932 of SEQ ID NO:2. [0187] In some embodiments, the CasX variant comprises at least one modification in the helical I domain. In some embodiments, the at least one modification in the helical I domain comprises an amino acid substitution of one or more of amino acids S219, L249, E259, Q252, E292, L307, or D318 of SEQ ID NO:2.
- the CasX variant comprises at least one modification in the helical P domain.
- the at least one modification in the helical II domain comprises an amino acid substitution of one or more of amino acids D361, L379, E385, E386, D387, F399, L404, R458, C477, or D489 of SEQ ID NO:2.
- the CasX variant comprises at least one modification in the OBD domain.
- the at least one modification in the OBD comprises an amino acid substitution of one or more of amino acids F536, E552, T620, or 1658 of SEQ ID NO:2.
- the CasX variant comprises at least one modification in the RuvC DNA cleavage domain.
- the at least one modification in the RuvC DNA cleavage domain comprises an amino acid substitution of one or more of amino acids K682, G695, A708, V711, D732, A739, D733, L742, V747, F755, M771, M779, W782, A788, G791, L792, P793, Y797, M799, Q804, S819, or Y857 or a deletion of amino acid P793 of SEQ ID NO:2.
- the CasX variant comprises at least one modification compared to the reference CasX sequence of SEQ ID NO:2 is selected from one or more of: (a) an amino acid substitution of L379R; (b) an amino acid substitution of A708K; (c) an amino acid substitution of T620P; (d) an amino acid substitution of E385P; (e) an amino acid substitution of Y857R; (f) an amino acid substitution of I658V; (g) an amino acid substitution of F399L; (h) an amino acid substitution of Q252K; (i) an amino acid substitution of L404K; and (j) an amino acid deletion of P793.
- a CasX variant comprises at least two amino acid changes to the sequence of a reference CasX variant protein selected from the group consisting of: a substitution of Y789T of SEQ ID NO:2, a deletion of P793 of SEQ ID NO:2, a substitution of Y789D of SEQ ID NO:2, a substitution of T72S of SEQ ID NO:2, a substitution of I546V of SEQ ID NO:2, a substitution of E552A of SEQ ID NO:2, a substitution of A636D of SEQ ID NO:2, a substitution of F536S of SEQ ID NO:2, a substitution of A708K of SEQ ID NO:2, a substitution of Y797L of SEQ ID NO:2, a substitution of L792G SEQ ID NO:2, a substitution of A739V of SEQ ID NO:2, a substitution of G791M of SEQ ID NO:2, an insertion of A at position 661of SEQ ID NO:2, a
- the at least two amino acid changes to a reference CasX protein are selected from the amino acid changes disclosed in the sequences of SEQ ID NOS: 49-150 as set forth in Table 4.
- a CasX variant comprises any combination of the foregoing embodiments of this paragraph.
- a CasX variant protein comprises more than one substitution, insertion and/or deletion of a reference CasX protein amino acid sequence.
- a CasX variant protein comprises a substitution of S794R and a substitution of Y797L of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of K416E and a substitution of A708K of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of A708K and a deletion of P793 of SEQ ID NO:2.
- a CasX variant protein comprises a deletion of P793 and an insertion of AS at position 795 SEQ ID NO:2.
- a CasX variant protein comprises a substitution of Q367K and a substitution of I425S of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of A708K, a deletion of P position 793 and a substitution A793V of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of Q338R and a substitution of A339E of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of Q338R and a substitution of A339K of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of S507G and a substitution of G508R of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of C477K, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K and a deletion of P at position of 793 of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution A739V of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of M779N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of M771N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of 708K, a deletion of P at position 793 and a substitution of D489S of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of A739T of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of D732N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of G791M of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of 708K, a deletion of P at position 793 and a substitution of Y797L of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of M779N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of M771N of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of D489S of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of A739T of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of D732N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of G791M of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of Y797L of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of T620P of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of A708K, a deletion of P at position 793 and a substitution of E386S of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of E386R, a substitution of F399L and a deletion of P at position 793 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of R581I and A739V of SEQ ID NO:2. In some embodiments, a CasX variant comprises any combination of the foregoing embodiments of this paragraph. [0194] In some embodiments, a CasX variant protein comprises more than one substitution, insertion and/or deletion of a reference CasX protein amino acid sequence. In some embodiments, a CasX variant protein comprises a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of C477K, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of A739 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of T620P of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of M771 A of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of D732N of SEQ ID NO:2.
- a CasX variant comprises any combination of the foregoing embodiments of this paragraph.
- a CasX variant protein comprises a substitution of W782Q of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of M771Q of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of R458I and a substitution of A739V of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of M771N of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of A739T of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of D489S of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of D732N of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of V71 IK of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of Y797L of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K, a deletion of P at position 793 and a substitution of M771N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of A708K, a substitution of P at position 793 and a substitution of E386S of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477K, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of L792D of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of G791F of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of A708K, a deletion of P at position 793 and a substitution of A739V of SEQ ID NO:2.
- a CasX variant protein comprises a substitution of C477K, a substitution of A708K and a substitution of P at position 793 of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L249I and a substitution of M771N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of V747K of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of L379R, a substitution of C477, a substitution of A708K, a deletion of P at position 793 and a substitution of M779N of SEQ ID NO:2. In some embodiments, a CasX variant protein comprises a substitution of F755M. In some embodiments, a CasX variant comprises any combination of the foregoing embodiments of this paragraph.
- a CasX variant protein comprises at least one modification compared to the reference CasX sequence of SEQ ID NO:2, wherein the at least one modification is selected from one or more of: an amino acid substitution of L379R; an amino acid substitution of A708K; an amino acid substitution of T620P; an amino acid substitution of E385P; an amino acid substitution of Y857R; an amino acid substitution of I658V; an amino acid substitution of F399L; an amino acid substitution of Q252K; and an amino acid deletion of [P793]
- a CasX variant protein comprises at least one modification compared to the reference CasX sequence of SEQ ID NO:2, wherein the at least one modification is selected from one or more of: an amino acid substitution of L379R; an amino acid substitution of A708K; an amino acid substitution of T620P; an amino acid substitution of E385P; an amino acid substitution of Y857R; an amino acid substitution of I658V; an amino acid substitution
- the CasX variant protein comprises between 400 and 2000 amino acids, between 500 and 1500 amino acids, between 700 and 1200 amino acids, between 800 and 1100 amino acids, or between 900 and 1000 amino acids.
- the CasX variant protein comprises one or more modifications in a region of non-contiguous residues that form a channel in which gNA:target DNA complexing occurs. In some embodiments, the CasX variant protein comprises one or more modifications comprising a region of non-contiguous residues that form an interface which binds with the gNA.
- the helical I, helical P and OBD domains all contact or are in proximity to the gNA:target DNA complex, and one or more modifications to non-contiguous residues within any of these domains may improve function of the CasX variant protein.
- the CasX variant protein comprises one or more modifications in a region of non-contiguous residues that form a channel which binds with the non-target strand DNA.
- a CasX variant protein can comprise one or more modifications to non-contiguous residues of the NTSBD.
- the CasX variant protein comprises one or more modifications in a region of non-contiguous residues that form an interface which binds with the PAM.
- a CasX variant protein can comprise one or more modifications to non-contiguous residues of the helical I domain or OBD.
- the CasX variant protein comprises one or more modifications comprising a region of non-contiguous surface-exposed residues.
- surface-exposed residues refers to amino acids on the surface of the CasX protein, or amino acids in which at least a portion of the amino acid, such as the backbone or a part of the side chain is on the surface of the protein.
- Surface exposed residues of cellular proteins such as CasX which are exposed to an aqueous intracellular environment, are frequently selected from positively charged hydrophilic amino acids, for example arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine.
- a region of surface exposed residues comprises one or more insertions, deletions, or substitutions compared to a reference CasX protein.
- one or more positively charged residues are substituted for one or more other positively charged residues, or negatively charged residues, or uncharged residues, or any combinations thereof.
- one or more amino acids residues for substitution are near bound nucleic acid, for example residues in the RuvC domain or helical I domain that contact target DNA, or residues in the OBD or helical II domain that bind the gNA, can be substituted for one or more positively charged or polar amino acids.
- the CasX variant protein comprises one or more modifications in a region of non-contiguous residues that form a core through hydrophobic packing in a domain of the reference CasX protein.
- regions that form cores through hydrophobic packing are rich in hydrophobic amino acids such as valine, isoleucine, leucine, methionine, phenylalanine, tryptophan, and cysteine.
- RuvC domains comprise a hydrophobic pocket adjacent to the active site. In some embodiments, between 2 to 15 residues of the region are charged, polar, or base stacking.
- Charged amino acids may include, for example, arginine, lysine, aspartic acid, and glutamic acid, and the side chains of these amino acids may form salt bridges provided a bridge partner is also present.
- Polar amino acids may include, for example, glutamine, asparagine, histidine, serine, threonine, tyrosine, and cysteine. Polar amino acids can, in some embodiments, form hydrogen bonds as proton donors or acceptors, depending on the identity of their side chains.
- base-stacking includes the interaction of aromatic side chains of an amino acid residue (such as tryptophan, tyrosine, phenylalanine, or histidine) with stacked nucleotide bases in a nucleic acid. Any modification to a region of non-contiguous amino acids that are in close spatial proximity to form a functional part of the CasX variant protein is envisaged as within the scope of the disclosure. i.
- a chimeric CasX protein comprising protein domains from two or more different CasX proteins, such as two or more reference CasX proteins, or two or more CasX variant protein sequences as described herein.
- a “chimeric CasX protein” refers to a CasX containing at least two domains isolated or derived from different sources, such as two naturally occurring proteins, which may, in some embodiments, be isolated from different species.
- a chimeric CasX protein comprises a first domain from a first CasX protein and a second domain from a second, different CasX protein.
- the first domain can be selected from the group consisting of the NTSB, TSL, Helical I, Helical II, OBD and RuvC domains.
- the second domain is selected from the group consisting of the NTSB, TSL, Helical I, Helical II, OBD and RuvC domains with the second domain being different from the foregoing first domain.
- a chimeric CasX protein may comprise an NTSB, TSL, Helical I, Helical II, OBD domains from a CasX protein of SEQ ID NO:2, and a RuvC domain from a CasX protein of SEQ ID NO:l, or vice versa.
- a chimeric CasX protein may comprise an NTSB, TSL, Helical II, OBD and RuvC domain from CasX protein of SEQ ID NO:2, and a Helical I domain from a CasX protein of SEQ ID NO:l, or vice versa.
- a chimeric CasX protein may comprise an NTSB, TSL, Helical II, OBD and RuvC domain from a first CasX protein, and a Helical I domain from a second CasX protein.
- the domains of the first CasX protein are derived from the sequences of SEQ ID NO:l, SEQ ID NO:2 or SEQ ID NO:3
- the domains of the second CasX protein are derived from the sequences of SEQ ID NO:l, SEQ ID NO:2 or SEQ ID NO:3
- the first and second CasX proteins are not the same.
- domains of the first CasX protein comprise sequences derived from SEQ ID NO:l and domains of the second CasX protein comprise sequences derived from SEQ ID NO:2. In some embodiments, domains of the first CasX protein comprise sequences derived from SEQ ID NO:l and domains of the second CasX protein comprise sequences derived from SEQ ID NO:3. In some embodiments, domains of the first CasX protein comprise sequences derived from SEQ ID NO:2 and domains of the second CasX protein comprise sequences derived from SEQ ID NO:3. In some embodiments, the CasX variant comprises SEQ ID NOS: 130-138 or 141-144 the sequences of which are set forth in Table 4.
- the CasX variant comprises a sequence of SEQ ID NOS: 72, 94, 113, 135, 138, 144, 239, 277, or 280. In some embodiments, the CasX variant comprises a sequence of SEQ ID NOS: 94, 72, 138, 144 or 280. In some embodiments, a CasX variant protein comprises at least one chimeric domain comprising a first part from a first CasX protein and a second part from a second, different CasX protein. As used herein, a “chimeric domain” refers to a domain containing at least two parts isolated or derived from different sources, such as two naturally occurring proteins or portions of domains from two reference CasX proteins.
- the at least one chimeric domain can be any of the NTSB, TSL, helical I, helical II, OBD or RuvC domains as described herein.
- the first portion of a CasX domain comprises a sequence of SEQ ID NO:l and the second portion of a CasX domain comprises a sequence of SEQ ID NO:2.
- the first portion of the CasX domain comprises a sequence of SEQ ID NO:l and the second portion of the CasX domain comprises a sequence of SEQ ID NO:3.
- the first portion of the CasX domain comprises a sequence of SEQ ID NO:2 and the second portion of the CasX domain comprises a sequence of SEQ ID NO:3.
- the at least one chimeric domain comprises a chimeric RuvC domain.
- the chimeric RuvC domain comprises amino acids 661 to 824 of SEQ ID NO:l and amino acids 922 to 978 of SEQ ID NO:2.
- a chimeric RuvC domain comprises amino acids 648 to 812 of SEQ ID NO:2 and amino acids 935 to 986 of SEQ ID NO:l.
- a CasX protein comprises a first domain from a first CasX protein and a second domain from a second CasX protein, and at least one chimeric domain comprising at least two parts isolated from different CasX proteins using the approach of the embodiments described in this paragraph.
- the chimeric CasX proteins having domains or portions of domains derived from SEQ ID NOS:l, 2 and 3, can further comprise amino acid insertions, deletions, or substitutions of any of the embodiments disclosed herein.
- a CasX variant protein comprises a sequence set forth in Tables 4, 6, 7, 8, or 10.
- a CasX variant protein consists of a sequence set forth in Table 4.
- a CasX variant protein comprises a sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical to a sequence of SEQ ID NOS: 49-150, 233-235, 238-252, or 27
- a CasX variant protein comprises a sequence of SEQ ID NOS: 49-150 as set forth in Table 4, and further comprises one or more NLS disclosed herein at or near either the N-terminus, the C- terminus, or both. It will be understood that in some cases, the N-terminal methionine of the CasX variants of the Tables is removed from the expressed CasX variant during post- translational modification.
- the CasX variant protein comprises a sequence selected from the group consisting of SEQ ID NOs: 49-150, 233-235, 238-252, 272-281.
- the CasX variant protein has one or more improved characteristic of the CasX protein when compared to a reference CasX protein, for example a reference protein of SEQ ID NO:l, SEQ ID NO:2 or SEQ ID NO:3.
- the at least one improved characteristic of the CasX variant is at least about 1.1 to about 100,000- fold improved relative to the reference protein.
- the at least one improved characteristic of the CasX variant is at least about 1.1 to about 10,000-fold improved, at least about 1.1 to about 1,000-fold improved, at least about 1.1 to about 500-fold improved, at least about 1.1 to about 400-fold improved, at least about 1.1 to about 300-fold improved, at least about 1.1 to about 200-fold improved, at least about 1.1 to about 100-fold improved, at least about 1.1 to about 50-fold improved, at least about 1.1 to about 40-fold improved, at least about 1.1 to about 30-fold improved, at least about 1.1 to about 20-fold improved, at least about 1.1 to about 10-fold improved, at least about 1.1 to about 9-fold improved, at least about 1.1 to about 8-fold improved, at least about 1.1 to about 7-fold improved, at least about 1.1 to about 6-fold improved, at least about 1.1 to about 5-fold improved, at least about 1.1 to about 4-fold improved, at least about 1.1 to about 3-fold improved, at least about 1.1 to about 2-fold improved, at least about 1.1 to about 2-
- the one or more improved characteristics of the CasX variant protein is at least about 1.1, at least about 5, at least about 10, at least about 20, at least about 30, at least about 40, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, at least about 100, at least about 250, at least about 500, or at least about 1000, at least about 5,000, at least about 10,000, or at least about 100,000-fold improved relative to a reference CasX protein of SEQ ID NO:l, SEQ ID NO:2 or SEQ ID NO:3..
- the one or more improved characteristics of the CasX variant is about 1.1 to 100,00-fold, about 1.1 to 10,00-fold, about 1.1 to 1,000-fold, about 1.1 to 500-fold, about 1.1 to 100-fold, about 1.1 to 50-fold, about 1.1 to 20-fold, about 10 to 100,00-fold, about 10 to 10,00-fold, about 10 to 1,000-fold, about 10 to 500-fold, about 10 to 100-fold, about 10 to 50-fold, about 10 to 20-fold, about 2 to 70-fold, about 2 to 50-fold, about 2 to 30-fold, about 2 to 20-fold, about 2 to 10-fold, about 5 to 50-fold, about 5 to 30-fold, about 5 to 10-fold, about 100 to 100,00-fold, about 100 to 10,00-fold, about 100 to 1,000-fold, about 100 to 500-fold, about 500 to 100,00-fold, about 500 to 10,00-fold, about 500 to 1,000-fold, about 500 to 750-fold, about 1,000 to 100,00-fold, about 10,000 to 100,00-fold,
- Exemplary characteristics that can be improved in CasX variant proteins relative to the same characteristics in reference CasX proteins include, but are not limited to, improved folding of the variant, improved binding affinity to the gNA, improved binding affinity for a wider spectrum of PAM sequences, improved unwinding of the target DNA, increased activity, improved editing efficiency, improved editing specificity, increased activity of the nuclease, increased target strand loading for double strand cleavage, decreased target strand loading for single strand nicking, decreased off-target cleavage, improved binding of the non-target strand of DNA, improved protein stability, improved proteimgNA complex stability, improved protein solubility, improved proteimgNA complex solubility, improved protein yield, improved protein expression, and improved fusion characteristics.
- the variant comprises at least one improved characteristic. In other embodiments, the variant comprises at least two improved characteristics. In further embodiments, the variant comprises at least three improved characteristics. In some embodiments, the variant comprises at least four improved characteristics. In still further embodiments, the variant comprises at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, or more improved characteristics. These improved characteristics are described in more detail below. j. Protein Stability
- the disclosure provides a CasX variant protein with improved stability relative to a reference CasX protein.
- improved stability of the CasX variant protein results in expression of a higher steady state of protein, which improves editing efficiency.
- improved stability of the CasX variant protein results in a larger fraction of CasX protein that remains folded in a functional conformation and improves editing efficiency or improves purifiability for manufacturing purposes.
- a “functional conformation” refers to a CasX protein that is in a conformation where the protein is capable of binding a gNA and target DNA.
- the CasX variant is capable of cleaving, nicking, or otherwise modifying the target DNA.
- a functional CasX variant can, in some embodiments, be used for gene-editing, and a functional conformation refers to an “editing-competent” conformation.
- a lower concentration of CasX variant is needed for applications such as gene editing compared to a reference CasX protein.
- the CasX variant with improved stability has improved efficiency compared to a reference CasX in one or more gene editing contexts.
- the disclosure provides a CasX variant protein having improved thermostability relative to a reference CasX protein.
- the CasX variant protein has improved thermostability of the CasX variant protein at a particular temperature range.
- some reference CasX proteins natively function in organisms with niches in groundwater and sediment; thus, some reference CasX proteins may have evolved to exhibit optimal function at lower or higher temperatures that may be desirable for certain applications.
- one application of CasX variant proteins is gene editing of mammalian cells, which is typically carried out at about 37°C.
- a CasX variant protein as described herein has improved thermostability compared to a reference CasX protein at a temperature of at least 16°C, at least 18°C, at least 20°C, at least 22°C, at least 24°C, at least 26°C, at least 28°C, at least 30°C, at least 32°C, at least 34°C, at least 35°C, at least 36°C, at least 37°C, at least 38°C, at least 39°C, at least 40°C, at least 41°C, at least 42°C, at least 44°C, at least 46°C, at least 48°C, at least 50°C, at least 52°C, or greater.
- a CasX variant protein has improved thermostability and functionality compared to a reference CasX protein that results in improved gene editing functionality, such as mammalian gene editing applications, which may include human gene editing applications. Improved thermostability of the nuclease may be evaluated through a variety of methods known to one of skill in the art.
- the disclosure provides a CasX variant protein having improved stability of the CasX variant proteimgNA complex relative to the reference CasX proteimgNA complex such that the RNP remains in a functional form.
- Stability improvements can include increased thermostability, resistance to proteolytic degradation, enhanced pharmacokinetic properties, stability across a range of pH conditions, salt conditions, and tonicity. Improved stability of the complex may, in some embodiments, lead to improved editing efficiency.
- the RNP of the CasX variant and gNA variant has at least a 5%, at least a 10%, at least a 15%, or at least a 20%, or at least a 5-20% higher percentage of cleavage- competent RNP compared to an RNP of the reference CasX of SEQ ID NOS: 1-3 and the gNA of any one of SEQ ID NOS:4-16 of Table 1. Exemplary data of increased cleavage-competent RNP are provided in the Examples.
- the disclosure provides a CasX variant protein having improved thermostability of the CasX variant proteimgNA complex relative to the reference CasX proteimgNA complex.
- a CasX variant protein has improved thermostability relative to a reference CasX protein.
- the CasX variant proteimgNA complex has improved thermostability relative to a complex comprising a reference CasX protein at temperatures of at least 16°C, at least 18°C, at least 20°C, at least 22°C, at least 24°C, at least 26°C, at least 28°C, at least 30°C, at least 32°C, at least 34°C, at least 35°C, at least 36°C, at least 37°C, at least 38°C, at least 39°C, at least 40°C, at least 41°C, at least 42°C, at least 44°C, at least 46°C, at least 48°C, at least 50°C, at least 52°C, or greater.
- a CasX variant protein has improved thermostability of the CasX variant proteimgNA complex compared to a reference CasX proteimgNA complex, which results in improved function for gene editing applications, such as mammalian gene editing applications, which may include human gene editing applications. Improved thermostability of the RNP may be evaluated through a variety of methods known to one of skill in the art.
- the improved stability and/or thermostability of the CasX variant protein comprises faster folding kinetics of the CasX variant protein relative to a reference CasX protein, slower unfolding kinetics of the CasX variant protein relative to a reference CasX protein, a larger free energy release upon folding of the CasX variant protein relative to a reference CasX protein, a higher temperature at which 50% of the CasX variant protein is unfolded (Tm) relative to a reference CasX protein, or any combination thereof.
- improved thermostability of the CasX variant protein comprises a higher Tm of the CasX variant protein relative to a reference CasX protein.
- the Tm of the CasX variant protein is between about 20°C to about 30°C, between about 30°C to about 40°C, between about 40°C to about 50°C, between about 50°C to about 60°C, between about 60°C to about 70°C, between about 70°C to about 80°C, between about 80°C to about 90°C or between about 90°C to about 100°C.
- Thermal stability is determined by measuring the “melting temperature” (T m ), which is defined as the temperature at which half of the molecules are denatured. Methods of measuring characteristics of protein stability such as Tm and the free energy of unfolding are known to persons of ordinary skill in the art, and can be measured using standard biochemical techniques in vitro.
- Tm may be measured using Differential Scanning Calorimetry, a thermo- analytical technique in which the difference in the amount of heat required to increase the temperature of a sample and a reference is measured as a function of temperature (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52).
- CasX variant protein Tm may be measured using commercially available methods such as the ThermoFisher Protein Thermal Shift system.
- circular dichroism may be used to measure the kinetics of folding and unfolding, as well as the Tm (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
- CD Circular dichroism
- improved stability and/or thermostability of the CasX variant protein comprises improved folding kinetics of the CasX variant protein relative to a reference CasX protein.
- folding kinetics of the CasX variant protein are improved relative to a reference CasX protein by at least about 5, at least about 10, at least about 50, at least about 100, at least about 500, at least about 1,000, at least about 2,000, at least about 3,000, at least about 4,000, at least about 5,000, or at least about a 10,000-fold improvement.
- folding kinetics of the CasX variant protein are improved relative to a reference CasX protein by at least about 1 kJ/mol, at least about 5 kJ/mol, at least about 10 kJ/mol, at least about 20 kJ/mol, at least about 30 kJ/mol, at least about 40 kJ/mol, at least about 50 kJ/mol, at least about 60 kJ/mol, at least about 70 kJ/mol, at least about 80 kJ/mol, at least about 90 kJ/mol, at least about 100 kJ/mol, at least about 150 kJ/mol, at least about 200 kJ/mol, at least about 250 kJ/mol, at least about 300 kJ/mol, at least about 350 kJ/mol, at least about 400 kJ/mol, at least about 450 kJ/mol, or at least about 500 kJ/mol .
- Exemplary amino acid changes that can increase the stability of a CasX variant protein relative to a reference CasX protein may include, but are not limited to, amino acid changes that increase the number of hydrogen bonds within the CasX variant protein, increase the number of disulfide bridges within the CasX variant protein, increase the number of salt bridges within the CasX variant protein, strengthen interactions between parts of the CasX variant protein, increase the buried hydrophobic surface area of the CasX variant protein, or any combinations thereof.
- the disclosure provides a CasX variant protein having improved yield during expression and purification relative to a reference CasX protein.
- the yield of CasX variant proteins purified from bacterial or eukaryotic host cells is improved relative to a reference CasX protein.
- the bacterial host cells are Escherichia coli cells.
- the eukaryotic cells are yeast, plant (e.g. tobacco), insect (e.g. Spodoptera frugiperda sf9 cells), mouse, rat, hamster, guinea pig, monkey, or human cells.
- the eukaryotic host cells are mammalian cells, including, but not limited to human embryonic kidney 293 (HEK293) cells, HEK292T cells, baby hamster kidney (BHK) cells, NS0 cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS, HeLa, or Chinese hamster ovary (CHO) cells.
- HEK293 human embryonic kidney 293
- BHK baby hamster kidney
- NS0 cells NS0 cells
- SP2/0 cells NS0 cells
- YO myeloma cells P3X63 mouse myeloma cells
- PER cells PER.C6 cells
- hybridoma cells NIH3T3 cells, COS, HeLa, or Chinese hamster ovary (CHO) cells.
- improved yield of the CasX variant protein is achieved through codon optimization.
- Cells use 64 different codons, 61 of which encode the 20 standard amino acids, while another 3 function as stop codons.
- a single amino acid is encoded by more than one codon.
- Different organisms exhibit bias towards use of different codons for the same naturally occurring amino acid. Therefore, the choice of codons in a protein coding sequence, and matching codon choice to the organism in which the protein will be expressed, can, in some cases, significantly affect protein translation and therefore protein expression levels.
- the CasX variant protein is encoded by a nucleic acid that has been codon optimized.
- the nucleic acid encoding the CasX variant protein has been codon optimized for expression in a bacterial cell, a yeast cell, an insect cell, a plant cell, or a mammalian cell.
- the mammal cell is a mouse, a rat, a hamster, a guinea pig, a monkey, or a human.
- the CasX variant protein is encoded by a nucleic acid that has been codon optimized for expression in a human cell.
- the CasX variant protein is encoded by a nucleic acid from which nucleotide sequences that reduce translation rates in prokaryotes and eukaryotes have been removed. For example, runs of greater than three thymine residues in a row can reduce translation rates in certain organisms or internal polyadenylation signals can reduce translation.
- improvements in solubility and stability, as described herein, result in improved yield of the CasX variant protein relative to a reference CasX protein.
- the amount of CasX variant protein can be determined by running the protein on an SDS-page gel, and comparing the CasX variant protein to a either a control whose amount or concentration is known in advance to determine an absolute level of protein.
- a purified CasX variant protein can be run on an SDS-page gel next to a reference CasX protein undergoing the same purification process to determine relative improvements in CasX variant protein yield.
- levels of protein can be measured using immunohistochemical methods such as Western blot or ELISA with an antibody to CasX, or by HPLC.
- concentration can be determined by measuring of the protein's intrinsic UV absorbance, or by methods which use protein-dependent color changes such as the Lowry assay, the Smith copper/bicinchoninic assay or the Bradford dye assay. Such methods can be used to calculate the total protein (such as, for example, total soluble protein) yield obtained by expression under certain conditions. This can be compared, for example, to the protein yield of a reference CasX protein under similar expression conditions. /. Protein Solubility
- a CasX variant protein has improved solubility relative to a reference CasX protein. In some embodiments, a CasX variant protein has improved solubility of the CasX:gNA ribonucleoprotein complex variant relative to a ribonucleoprotein complex comprising a reference CasX protein.
- an improvement in protein solubility leads to higher yield of protein from protein purification techniques such as purification from E. coli.
- Improved solubility of CasX variant proteins may, in some embodiments, enable more efficient activity in cells, as a more soluble protein may be less likely to aggregate in cells. Protein aggregates can in certain embodiments be toxic or burdensome on cells, and, without wishing to be bound by any theory, increased solubility of a CasX variant protein may ameliorate this result of protein aggregation. Further, improved solubility of CasX variant proteins may allow for enhanced formulations permitting the delivery of a higher effective dose of functional protein, for example in a desired gene editing application.
- improved solubility of a CasX variant protein relative to a reference CasX protein results in improved yield of the CasX variant protein during purification of at least about 5, at least about 10, at least about 20, at least about 30, at least about 40, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, at least about 100, at least about 250, at least about 500, or at least about 1000- fold greater yield.
- improved solubility of a CasX variant protein relative to a reference CasX protein improves activity of the CasX variant protein in cells by at least about 1.1, at least about 1.2, at least about 1.3, at least about 1.4, at least about 1.5, at least about 1.6, at least about 1.7, at least about 1.8, at least about 1.9, at least about 2, at least about 2.1, at least about 2.2, at least about 2.3, at least about 2.4, at least about 2.5, at least about 2.6, at least about 2.7, at least about 2.8, at least about 2.9, at least about 3, at least about 3.5, at least about 4, at least about 4.5, at least about 5, at least about 5.5, at least about 6, at least about 6.5, at least about 7.0, at least about 7.5, at least about 8, at least about 8.5, at least about 9, at least about 9.5, at least about 10, at least about 11, at least about 12, at least about 13, at least about 14, or at least about 15-fold greater activity.
- Improved solubility of the nuclease may be evaluated through a variety of methods known to one of skill in the art, including by taking densitometry readings on a gel of the soluble fraction of lysed E.coli.
- improvements in CasX variant protein solubility can be measured by measuring the maintenance of soluble protein product through the course of a full protein purification.
- soluble protein product can be measured at one or more steps of gel affinity purification, tag cleavage, cation exchange purification, running the protein on a sizing column.
- the densitometry of every band of protein on a gel is read after each step in the purification process.
- CasX variant proteins with improved solubility may, in some embodiments, maintain a higher concentration at one or more steps in the protein purification process when compared to the reference CasX protein, while an insoluble protein variant may be lost at one or more steps due to buffer exchanges, filtration steps, interactions with a purification column, and the like.
- improving the solubility of CasX variant proteins results in a higher yield in terms of mg/L of protein during protein purification when compared to a reference CasX protein.
- improving the solubility of CasX variant proteins enables a greater amount of editing events compared to a less soluble protein when assessed in editing assays such as the EGFP disruption assays described herein.
- Protein Affinity for the gNA Protein Affinity for the gNA
- a CasX variant protein has improved affinity for the gNA relative to a reference CasX protein, leading to the formation of the ribonucleoprotein complex.
- Increased affinity of the CasX variant protein for the gNA may, for example, result in a lower K d for the generation of a RNP complex, which can, in some cases, result in a more stable ribonucleoprotein complex formation.
- increased affinity of the CasX variant protein for the gNA results in increased stability of the ribonucleoprotein complex when delivered to human cells. This increased stability can affect the function and utility of the complex in the cells of a subject, as well as result in improved pharmacokinetic properties in blood, when delivered to a subject.
- increased affinity of the CasX variant protein, and the resulting increased stability of the ribonucleoprotein complex allows for a lower dose of the CasX variant protein to be delivered to the subject or cells while still having the desired activity, for example in vivo or in vitro gene editing.
- a higher affinity (tighter binding) of a CasX variant protein to a gNA allows for a greater amount of editing events when both the CasX variant protein and the gNA remain in an RNP complex. Increased editing events can be assessed using editing assays such as the EGFP disruption assay described herein.
- the K d of a CasX variant protein for a gNA is increased relative to a reference CasX protein by a factor of at least about 1.1, at least about 1.2, at least about 1.3, at least about 1.4, at least about 1.5, at least about 1.6, at least about 1.7, at least about 1.8, at least about 1.9, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, or at least about 100.
- the CasX variant has about 1.1 to about 10-fold increased binding affinity to the gNA compared to the reference CasX protein of SEQ ID NO: 2.
- amino acid changes in the Helical I domain can increase the binding affinity of the CasX variant protein with the gNA targeting sequence
- changes in the Helical II domain can increase the binding affinity of the CasX variant protein with the gNA scaffold stem loop
- changes in the oligonucleotide binding domain (OBD) increase the binding affinity of the CasX variant protein with the gRNA triplex.
- Methods of measuring CasX protein binding affinity for a CasX gNA include in vitro methods using purified CasX protein and gNA.
- the binding affinity for reference CasX and variant proteins can be measured by fluorescence polarization if the gNA or CasX protein is tagged with a fluorophore.
- binding affinity can be measured by biolayer interferometry, electrophoretic mobility shift assays (EMS As), or filter binding.
- RNA binding proteins such as the reference CasX and variant proteins of the disclosure for specific gNAs such as reference gNAs and variants thereof
- ITC isothermal calorimetry
- SPR surface pi asm on resonance
- a CasX variant protein has improved binding affinity for a target nucleic acid sequence relative to the affinity of a reference CasX protein for a target nucleic acid sequence.
- the improved affinity for the target nucleic acid sequence comprises improved affinity for the target nucleic acid sequence, improved binding affinity to a wider spectrum of PAM sequences, an improved ability to search DNA for the target nucleic acid sequence, or any combinations thereof.
- CRISPR/Cas system proteins such as CasX may find their target nucleic acid sequences by one-dimension diffusion along a DNA molecule.
- the process is thought to include (1) binding of the ribonucleoprotein to the DNA molecule followed by (2) stalling at the target nucleic acid sequence, either of which may be, in some embodiments, affected by improved affinity of CasX proteins for a target nucleic acid sequence, thereby improving function of the CasX variant protein compared to a reference CasX protein.
- a CasX variant protein with improved target nucleic acid sequence affinity has increased overall affinity for DNA.
- a CasX variant protein with improved target nucleic acid affinity has increased affinity for specific PAM sequences other than the canonical TTC PAM recognized by the reference CasX proteins of SEQ ID NOS: 1 or 2, including binding affinity for PAM sequences selected from the group consisting of TTC, ATC, GTC, and CTC.
- a higher overall affinity for DNA also, in some embodiments, can increase the frequency at which a CasX protein can effectively start and finish a binding and unwinding step, thereby facilitating target strand invasion and R-loop formation, and ultimately the cleavage of a target nucleic acid sequence.
- amino acid changes in the NTSBD that increase the efficiency of unwinding, or capture, of a non-target DNA strand in the unwound state, can increase the affinity of CasX variant proteins for target DNA.
- amino acid changes in the NTSBD that increase the ability of the NTSBD to stabilize DNA during unwinding can increase the affinity of CasX variant proteins for target DNA.
- amino acid changes in the OBD may increase the affinity of CasX variant protein binding to the protospacer adjacent motif (PAM), thereby increasing affinity of the CasX variant protein for the target nucleic acid sequence.
- PAM protospacer adjacent motif
- amino acid changes in the Helical I and/or II, RuvC and TSL domains that increase the affinity of the CasX variant protein for the target nucleic acid strand can increase the affinity of the CasX variant protein for the target nucleic acid sequence.
- the CasX variant protein has increased binding affinity to the target nucleic acid sequence compared to the reference protein of SEQ ID NO: 1, SEQ ID NO:
- affinity of a CasX variant protein of the disclosure for a target nucleic acid molecule is increased relative to a reference CasX protein by a factor of at least about 1.1, at least about 1.2, at least about 1.3, at least about 1.4, at least about 1.5, at least about 1.6, at least about 1.7, at least about 1.8, at least about 1.9, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, or at least about 100.
- a CasX variant protein has improved binding affinity for the non-target strand of the target nucleic acid.
- non-target strand refers to the strand of the DNA target nucleic acid sequence that does not form Watson and Crick base pairs with the targeting sequence in the gNA, and is complementary to the target strand.
- Methods of measuring CasX protein (such as reference or variant) affinity for a target nucleic acid molecule may include electrophoretic mobility shift assays (EMS As), filter binding, isothermal calorimetry (ITC), and surface plasmon resonance (SPR), fluorescence polarization and biolayer interferometry (BLI). Further methods of measuring CasX protein affinity for a target include in vitro biochemical assays that measure DNA cleavage events over time.
- CasX variant proteins with higher affinity for their target nucleic acid sequence may, in some embodiments, cleave the target nucleic acid sequence more rapidly than a reference CasX protein that does not have increased affinity for the target nucleic acid sequence.
- the CasX variant protein is catalytically dead (dCasX).
- the disclosure provides RNP comprising a catalytically-dead CasX protein that retains the ability to bind target DNA.
- An exemplary catalytically-dead CasX variant protein comprises one or more mutations in the active site of the RuvC domain of the CasX protein.
- a catalytically-dead CasX variant protein comprises substitutions at residues 672, 769 and/or 935 of SEQ ID NO: 1.
- a catalytically-dead CasX variant protein comprises substitutions of D672A, E769A and/or D935A in the reference CasX protein of SEQ ID NO: 1.
- a catalytically-dead CasX protein comprises substitutions at amino acids 659, 765 and/or 922 of SEQ ID NO: 2.
- a catalytically-dead CasX protein comprises D659A, E756A and/or D922A substitutions in a reference CasX protein of SEQ ID NO: 2.
- a catalytically-dead reference CasX protein comprises deletions of all or part of the RuvC domain of the reference CasX protein.
- improved affinity for DNA of a CasX variant protein also improves the function of catalytically inactive versions of the CasX variant protein.
- the catalytically inactive version of the CasX variant protein comprises one or mutations in the DED motif in the RuvC.
- Catalytically dead CasX variant proteins can, in some embodiments, be used for base editing or epigenetic modifications.
- catalytically-dead CasX variant proteins can, relative to catalytically active CasX, find their target DNA faster, remain bound to target DNA for longer periods of time, bind target DNA in a more stable fashion, or a combination thereof, thereby improving the function of the catalytically-dead CasX variant protein. o. Improved Specificity for a Target Site
- a CasX variant protein has improved specificity for a target nucleic acid sequence relative to a reference CasX protein.
- specificity interchangeably referred to as “target specificity,” refers to the degree to which a CRISPR/Cas system ribonucleoprotein complex cleaves off-target sequences that are similar, but not identical to the target nucleic acid sequence; e.g., a CasX variant RNP with a higher degree of specificity would exhibit reduced off-target cleavage of sequences relative to a reference CasX protein.
- the specificity, and the reduction of potentially deleterious off-target effects, of CRISPR/Cas system proteins can be vitally important in order to achieve an acceptable therapeutic index for use in mammalian subjects.
- a CasX variant protein has improved specificity for a target site within the target nucleic acid sequence that is complementary to the targeting sequence of the gNA.
- amino acid changes in the Helical I and II domains that increase the specificity of the CasX variant protein for the target nucleic acid strand can increase the specificity of the CasX variant protein for the target nucleic acid sequence overall.
- amino acid changes that increase specificity of CasX variant proteins for target nucleic acid sequence may also result in decreased affinity of CasX variant proteins for DNA.
- Methods of testing CasX protein (such as variant or reference) target specificity may include guide and Circularization for In vitro Reporting of Cleavage Effects by Sequencing (CIRCLE-seq), or similar methods.
- CIRCLE-seq genomic DNA is sheared and circularized by ligation of stem-loop adapters, which are nicked in the stem-loop regions to expose 4 nucleotide palindromic overhangs. This is followed by intramolecular ligation and degradation of remaining linear DNA.
- Circular DNA molecules containing a CasX cleavage site are subsequently linearized with CasX, and adapter adapters are ligated to the exposed ends followed by high-throughput sequencing to generate paired end reads that contain information about the off-target site.
- Additional assays that can be used to detect off-target events, and therefore CasX protein specificity include assays used to detect and quantify indels (insertions and deletions) formed at those selected off-target sites such as mismatch-detection nuclease assays and next generation sequencing (NGS).
- mismatch-detection assays include nuclease assays, in which genomic DNA from cells treated with CasX and sgRNA is PCR amplified, denatured and rehybridized to form hetero-duplex DNA, containing one wild type strand and one strand with an indel. Mismatches are recognized and cleaved by mismatch detection nucleases, such as Surveyor nuclease or T7 endonuclease I. p. Unwinding of DNA
- a CasX variant protein has improved ability of unwinding DNA relative to a reference CasX protein. Poor dsDNA unwinding has been shown previously to impair or prevent the ability of CRISPR/Cas system proteins AnaCas9 or Casl4s to cleave DNA. Therefore, without wishing to be bound by any theory, it is likely that increased DNA cleavage activity by some CasX variant proteins of the disclosure is due, at least in part, to an increased ability to find and unwind the dsDNA at a target site.
- amino acid changes in the NTSB domain may produce CasX variant proteins with increased DNA unwinding characteristics.
- amino acid changes in the OBD or the helical domain regions that interact with the PAM may also produce CasX variant proteins with increased DNA unwinding characteristics.
- Methods of measuring the ability of CasX proteins (such as variant or reference) to unwind DNA include, but are not limited to, in vitro assays that observe increased on rates of dsDNA targets in fluorescence polarization or biolayer interferometry. q. Catalytic Activity
- the ribonucleoprotein complex of the CasX:gNA systems disclosed herein comprise a reference CasX protein or variant thereof that bind to a target nucleic acid sequence and cleaves the target nucleic acid sequence.
- a CasX variant protein has improved catalytic activity relative to a reference CasX protein.
- cleavage of the target strand can be a limiting factor for Casl2-like molecules in creating a dsDNA break.
- CasX variant proteins improve bending of the target strand of DNA and cleavage of this strand, resulting in an improvement in the overall efficiency of dsDNA cleavage by the CasX ribonucleoprotein complex.
- a CasX variant protein has increased nuclease activity compared to a reference CasX protein. Variants with increased nuclease activity can be generated, for example, through amino acid changes in the RuvC nuclease domain.
- the CasX variant comprises a nuclease domain having nickase activity.
- the CasX nickase of a CasX:gNA system generates a single-stranded break within 10- 18 nucleotides 3' of a PAM site in the non-target strand.
- the CasX variant comprises a nuclease domain having double-stranded cleavage activity.
- a CasX variant has a K c ieave constant that is at least 2-fold, or at least 3-fold, or at least 4-fold, or at least 5-fold, or at least 6-fold, or at least 7-fold, or at least 8-fold, or at least 9- fold, or at least 10-fold greater compared to a reference CasX.
- a CasX variant protein has increased target strand loading for double strand cleavage compared to a reference CasX.
- Variants with increased target strand loading activity can be generated, for example, through amino acid changes in the TLS domain.
- amino acid changes in the TSL domain may result in CasX variant proteins with improved catalytic activity.
- amino acid changes around the binding channel for the RNA:DNA duplex may also improve catalytic activity of the CasX variant protein.
- a CasX variant protein has increased collateral cleavage activity compared to a reference CasX protein.
- cold cleavage activity refers to additional, non-targeted cleavage of nucleic acids following recognition and cleavage of a target nucleic acid sequence.
- a CasX variant protein has decreased collateral cleavage activity compared to a reference CasX protein.
- improving the catalytic activity of a CasX variant protein comprises altering, reducing, or abolishing the catalytic activity of the CasX variant protein.
- a ribonucleoprotein complex comprising a dCasX variant protein binds to a target nucleic acid sequence and does not cleave the target nucleic acid.
- the CasX ribonucleoprotein complex comprising a CasX variant protein binds a target DNA but generates a single stranded nick in the target DNA.
- a CasX variant protein has decreased target strand loading for single strand nicking. Variants with decreased target strand loading may be generated, for example, through amino acid changes in the TSL domain.
- Exemplary methods for characterizing the catalytic activity of CasX proteins may include, but are not limited to, in vitro cleavage assays, including those of the Examples, below.
- electrophoresis of DNA products on agarose gels can interrogate the kinetics of strand cleavage.
- a ribonucleoprotein complex comprising a reference CasX protein or a CasX variant protein binds to a target C9orf72 DNA and cleaves the target nucleic acid sequence.
- the ribonucleoprotein complex creates a double-stranded break in the target nucleic acid. In other embodiments, the ribonucleoprotein complex creates a single-stranded break in the target nucleic acid.
- variants of a reference CasX protein increase the specificity of the CasX variant protein for a target C9orf72 RNA, and increase the activity of the CasX variant protein with respect to a target RNA when compared to the reference CasX protein.
- CasX variant proteins can display increased binding affinity for target RNAs, or increased cleavage of target RNAs, when compared to reference CasX proteins.
- a ribonucleoprotein complex comprising a CasX variant protein binds to a target RNA and/or cleaves the target RNA.
- a CasX variant has at least about two-fold to about 10-fold increased binding affinity to the C9orf72 target RNA compared to the reference protein of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the present disclosure provides Cas X variants that are a combination of mutations from separate CasX variant proteins.
- any variant to any domain described herein can be combined with other variants described herein.
- any variant within any domain described herein can be combined with other variants described herein, in the same domain.
- Combinations of different amino acid changes may in some embodiments produce new optimized variants whose function is further improved by the combination of amino acid changes.
- the effect of combining amino acid changes on CasX protein function is linear.
- a combination that is linear refers to a combination whose effect on function is equal to the sum of the effects of each individual amino acid change when assayed in isolation.
- the effect of combining amino acid changes on CasX protein function is synergistic.
- a combination of variants that is synergistic refers to a combination whose effect on function is greater than the sum of the effects of each individual amino acid change when assayed in isolation.
- combining amino acid changes produces CasX variant proteins in which more than one function of the CasX protein has been improved relative to the reference CasX protein.
- the disclosure provides CasX proteins comprising a heterologous protein fused to the CasX.
- the CasX is a reference CasX protein.
- the CasX is a CasX variant of any of the embodiments described herein.
- the CasX variant protein is fused to one or more proteins or domains thereof that has a different activity of interest, resulting in a fusion protein.
- the CasX variant protein is fused to a protein (or domain thereof) that inhibits transcription, modifies a target nucleic acid sequence, or modifies a polypeptide associated with a nucleic acid (e.g., histone modification).
- a heterologous polypeptide (or heterologous amino acid such as a cysteine residue or a non-natural amino acid) can be inserted at one or more positions within a CasX protein to generate a CasX fusion protein.
- a cysteine residue can be inserted at one or more positions within a CasX protein followed by conjugation of a heterologous polypeptide described below.
- a heterologous polypeptide or heterologous amino acid can be added at the N- or C-terminus of the reference or CasX variant protein.
- a heterologous polypeptide or heterologous amino acid can be inserted internally within the sequence of the CasX protein.
- the reference CasX or variant fusion protein retains RNA- guided sequence specific target nucleic acid binding and cleavage activity. In some cases, the reference CasX or variant fusion protein has (retains) 50% or more of the activity (e.g., cleavage and/or binding activity) of the corresponding reference CasX or variant protein that does not have the insertion of the heterologous protein.
- the reference CasX fusion or CasX variant fusion protein retains at least about 60%, or at least about 70% or more, at least about 80%, or at least about 90%, or at least about 92%, or at least about 95%, or at least about 98%, or at least about 100% of the activity (e.g., cleavage and/or binding activity) of the corresponding CasX protein that does not have the insertion of the heterologous protein.
- the reference CasX or variant fusion protein retains (has) target nucleic acid binding activity relative to the activity of the CasX protein without the inserted heterologous amino acid or heterologous polypeptide. In some cases, the reference CasX or variant fusion protein retains at least about 60%, or at least about 70% or more, at least about 80%, or at least about 90%, or at least about 92%, or at least about 95%, or at least about 98%, or at least about 100% of the binding activity of the corresponding CasX protein that does not have the insertion of the heterologous protein.
- the reference CasX or variant fusion protein retains (has) target nucleic acid binding and/or cleavage activity relative to the activity of the parent CasX protein without the inserted heterologous amino acid or heterologous polypeptide.
- the reference CasX or variant fusion protein has (retains) 50% or more of the binding and/or cleavage activity of the corresponding parent CasX protein (the CasX protein that does not have the insertion).
- the reference CasX or variant fusion protein has (retains) 60% or more (70% or more, 80% or more, 90% or more, 92% or more, 95% or more, 98% or more, or 100%) of the binding and/or cleavage activity of the corresponding CasX parent protein (the CasX protein that does not have the insertion).
- Methods of measuring cleaving and/or binding activity of a CasX protein and/or a CasX fusion protein will be known to one of ordinary skill in the art and any convenient method can be used.
- the fusion partner can modulate transcription (e.g., inhibit transcription, increase transcription) of a target DNA.
- the fusion partner is a protein (or a domain from a protein) that inhibits transcription (e.g., a transcriptional repressor, a protein that functions via recruitment of transcription inhibitor proteins, modification of target DNA such as methylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like).
- the fusion partner is a protein (or a domain from a protein) that increases transcription (e.g., a transcription activator, a protein that acts via recruitment of transcription activator proteins, modification of target DNA such as demethylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like).
- a transcription activator e.g., a transcription activator, a protein that acts via recruitment of transcription activator proteins, modification of target DNA such as demethylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like.
- a fusion partner has enzymatic activity that modifies a target nucleic acid sequence; e.g., nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity.
- nuclease activity e.g., nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase
- a fusion partner has enzymatic activity that modifies a polypeptide (e.g., a histone) associated with a target nucleic acid (e.g., methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity).
- a polypeptide e.g., a histone
- a target nucleic acid e.g., methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin
- proteins (or fragments thereof) that can be used as a fusion partner to increase transcription include but are not limited to: transcriptional activators such as VP 16, VP64, VP48, VP160, p65 subdomain (e.g., from NFkB), and activation domain of EDLL and/or TAL activation domain (e.g., for activity in plants); histone lysine methyltransferases such as SET domain containing 1 A, histone lysine methyltransferase (SET1 A), SET domain containing IB, histone lysine methyltransferase (SET1B), lysine methyltransferase 2A (MLL1 to 5, ASCL1 (ASH1) achaete-scute family bHLH transcription factor 1 (ASH1), SET and MYND domain containing 2 (SYMD2), nuclear receptor binding SET domain protein 1 (NSD1), and the like; histone lysine demethylases such as
- proteins (or fragments thereof) that can be used as a fusion partner to decrease transcription include but are not limited to: transcriptional repressors such as the Kruppel associated box (KRAB or SKD); KOX1 repression domain; the Mad mSIN3 interaction domain (SID); the ERF repressor domain (ERD), the SRDX repression domain (e.g., for repression in plants), and the like; histone lysine methyltransferases such as PR/SET domain containing protein (Pr-SET7/8), lysine methyltransferase 5B (SUV4- 20H1), PR/SET domain 2 (RIZ1), and the like; histone lysine demethylases such as lysine demethylase 4A (JMJD2A/JHDM3 A), lysine demethylase 4B (JMJD2B), lysine demethylase 4C (JMJD2C/GASC
- the fusion partner has enzymatic activity that modifies the target nucleic acid sequence (e.g., ssRNA, dsRNA, ssDNA, dsDNA).
- enzymatic activity that can be provided by the fusion partner include but are not limited to: nuclease activity such as that provided by a restriction enzyme (e.g., Fokl nuclease), methyltransferase activity such as that provided by a methyltransferase (e.g., Hhal DNA m5c-methyltransferase (M.Hhal), DNA methyltransferase 1 (DNMTl), DNA methyltransferase 3 a (DNMT3a), DNA methyltransferase 3b (DNMT3b), METI, DRM3 (plants), ZMET2, CMT1, CMT2 (plants), and the like); demethylase activity such as that provided by a demethylase (e.g., Ten-El
- a reference CasX or CasX variant protein of the present disclosure is fused to a polypeptide selected from a domain for increasing transcription (e.g., a VP16 domain, a VP64 domain), a domain for decreasing transcription (e.g., a KRAB domain, e.g., from the Koxl protein), a core catalytic domain of a histone acetyltransferase (e.g., histone acetyltransferase p300), a protein/domain that provides a detectable signal (e.g., a fluorescent protein such as GFP), a nuclease domain (e.g., a Fokl nuclease), or a base editor (e.g., cytidine deaminase such as APOBEC 1).
- a domain for increasing transcription e.g., a VP16 domain, a VP64 domain
- a domain for decreasing transcription e.g., a
- the fusion partner has enzymatic activity that modifies a protein associated with the target nucleic acid (e.g., ssRNA, dsRNA, ssDNA, dsDNA) (e.g., a histone, an RNA binding protein, a DNA binding protein, and the like).
- a protein associated with the target nucleic acid e.g., ssRNA, dsRNA, ssDNA, dsDNA
- a histone e.g., an RNA binding protein, a DNA binding protein, and the like.
- enzymatic activity that modifies a protein associated with a target nucleic acid
- enzymatic activity that modifies a protein associated with a target nucleic acid
- a histone methyltransferase HMT
- HMT histone methyltransferase
- G9A euchromatic histone lysine methyltransferase 2
- SUV39H2 ESET/SETDB 1 SUV39H2 ESET/SETDB 1, and the like
- demethylase activity such as that provided by a histone demethylase (e.g., Lysine Demethylase 1 A (KDMl A also known as LSD1), JHDM2a/b, JMJ
- a histone acetylase transferase e.g., catalytic core/fragment of the human acetyltransferase p300, GCN5, PCAF, CBP, TAF1, TIP60/PLIP, MOZ/MYST3, MORF/MYST4, HB01/MYST2, HMOF/MY
- deacetylase activity such as that provided by a histone deacetylase (e.g, HDAC1, HDAC2, HDAC3, HDAC8, HDAC4, HD AC 5, HDAC7, HDAC9, SIRT1, SIRT2, HDAC11, and the like), kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, and demyristoylation activity.
- a histone deacetylase e.g, HDAC1, HDAC2, HDAC3, HDAC8, HDAC4, HD AC 5, HDAC7, HDAC9, SIRT1, SIRT2, HDAC11, and the like
- kinase activity e.g, HDAC1, HDAC2, HDAC3, HDAC8, HDAC4, HD AC 5, HDAC7, HDAC9, SIRT1, SIRT
- Suitable fusion partners are (i) a dihydrofolate reductase (DHFR) destabilization domain (e.g., to generate a chemically controllable subject RNA-guided polypeptide or a conditionally active RNA-guided polypeptide), and (ii) a chloroplast transit peptide.
- DHFR dihydrofolate reductase
- Suitable chloroplast transit peptides include, but are not limited to:
- MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQV WPPIEKKKFETLSYLPDLTDSGGRVNC SEQ ID NO: 153;
- MAALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQ QRSVQRGSRRFPSVWC (SEQ ID NO: 158);
- a reference CasX or variant polypeptide of the present disclosure can include an endosomal escape peptide.
- an endosomal escape polypeptide comprises the amino acid sequence GLFXALLXLLXSLWXLLLXA (SEQ ID NO: 162), wherein each X is independently selected from lysine, histidine, and arginine.
- an endosomal escape polypeptide comprises the amino acid sequence
- Non-limiting examples of fusion partners for use when targeting ssRNA target nucleic acid sequences include (but are not limited to): splicing factors (e.g., RS domains); protein translation components (e.g., translation initiation, elongation, and/or release factors; e.g., eIF4G); RNA methylases; RNA editing enzymes (e.g., RNA deaminases, e.g., adenosine deaminase acting on RNA (ADAR), including A to I and/or C to U editing enzymes); helicases; RNA-binding proteins; and the like. It is understood that a heterologous polypeptide can include the entire protein or in some cases can include a fragment of the protein (e.g., a functional domain).
- splicing factors e.g., RS domains
- protein translation components e.g., translation initiation, elongation, and/or release factors; e.g.
- a fusion partner can be any domain capable of interacting with ssRNA (which, for the purposes of this disclosure, includes intramolecular and/or intermolecular secondary structures, e.g., double-stranded RNA duplexes such as hairpins, stem-loops, etc.), whether transiently or irreversibly, directly or indirectly, including but not limited to an effector domain selected from the group comprising; Endonucleases (for example RNase III, the CRR22 DYW domain, Dicer, and PIN (PilT N-terminus) domains from proteins such as SMG5 and SMG6); proteins and protein domains responsible for stimulating RNA cleavage (for example CPSF, CstF, CFIm and CFIIm); Exonucleases (for example XRN-1 or Exonuclease T); Deadenylases (for example HNT3); proteins and protein domains responsible for nonsense mediated RNA decay (for example UPF1, UPF2, UPF3, U
- the effector domain may be selected from the group comprising Endonucleases; proteins and protein domains capable of stimulating RNA cleavage; Exonucleases; Deadenylases; proteins and protein domains having nonsense mediated RNA decay activity; proteins and protein domains capable of stabilizing RNA; proteins and protein domains capable of repressing translation; proteins and protein domains capable of stimulating translation; proteins and protein domains capable of modulating translation (e.g., translation factors such as initiation factors, elongation factors, release factors, etc., e.g., eIF4G); proteins and protein domains capable of polyadenylation of RNA; proteins and protein domains capable of polyuridinylation of RNA; proteins and protein domains having RNA localization activity; proteins and protein domains capable of nuclear retention of RNA; proteins and protein domains having RNA nuclear export activity; proteins and protein domains capable of repression of RNA splicing; proteins and protein domains capable of stimulation of RNA splicing; proteins and protein domain
- RNA splicing factors that can be used (in whole or as fragments thereof) as a fusion partner have modular organization, with separate sequence-specific RNA binding modules and splicing effector domains.
- members of the serine/arginine-rich (SR) protein family contain N-terminal RNA recognition motifs (RRMs) that bind to exonic splicing enhancers (ESEs) in pre-mRNAs and C-terminal RS domains that promote exon inclusion.
- RRMs N-terminal RNA recognition motifs
- ESEs exonic splicing enhancers
- the hnRNP protein hnRNP Al binds to exonic splicing silencers (ESSs) through its RRM domains and inhibits exon inclusion through a C-terminal Glycine -rich domain.
- splicing factors can regulate alternative use of splice site (ss) by binding to regulatory sequences between the two alternative sites.
- ASF/SF2 can recognize ESEs and promote the use of intron proximal sites
- hnRNP A1 can bind to ESSs and shift splicing towards the use of intron distal sites.
- One application for such factors is to generate ESFs that modulate alternative splicing of endogenous genes, particularly disease associated genes.
- Bcl-x pre-mRNA produces two splicing isoforms with two alternative 5' splice sites to encode proteins of opposite functions.
- the long splicing isoform Bcl-xL is a potent apoptosis inhibitor expressed in long-lived post mitotic cells and is up-regulated in many cancer cells, protecting cells against apoptotic signals.
- the short isoform Bcl-xS is a pro- apoptotic isoform and expressed at high levels in cells with a high turnover rate (e.g., developing lymphocytes).
- the ratio of the two Bcl-x splicing isoforms is regulated by multiple cc -elements that are located in either the core exon region or the exon extension region (i.e., between the two alternative 5' splice sites). For more examples, see W02010075303, which is hereby incorporated by reference in its entirety.
- fusion partners include, but are not limited to proteins (or fragments thereof) that are boundary elements (e.g., CTCF), proteins and fragments thereof that provide periphery recruitment (e.g., Lamin A, Lamin B, etc.), protein docking elements (e.g.,
- a heterologous polypeptide (a fusion partner) provides for subcellular localization, i.e., the heterologous polypeptide contains a subcellular localization sequence (e.g., a nuclear localization signal (NLS) for targeting to the nucleus, a sequence to keep the fusion protein out of the nucleus, e.g., a nuclear export sequence (NES), a sequence to keep the fusion protein retained in the cytoplasm, a mitochondrial localization signal for targeting to the mitochondria, a chloroplast localization signal for targeting to a chloroplast, an ER retention signal, and the like).
- a subcellular localization sequence e.g., a nuclear localization signal (NLS) for targeting to the nucleus
- NES nuclear export sequence
- a sequence to keep the fusion protein retained in the cytoplasm e.g., a mitochondrial localization signal for targeting to the mitochondria
- chloroplast localization signal for targeting to a chloroplast
- an ER retention signal e.g.
- a subject RNA-guided polypeptide or a conditionally active RNA-guided polypeptide and/or subject CasX fusion polypeptide does not include a NLS so that the protein is not targeted to the nucleus (which can be advantageous, e.g., when the target nucleic acid sequence is an RNA that is present in the cytosol).
- a fusion partner can provide a tag (i.e., the heterologous polypeptide is a detectable label) for ease of tracking and/or purification (e.g., a fluorescent protein, e.g., green fluorescent protein (GFP), yellow fluorescent protein (YFP), red fluorescent protein (RFP), cyan fluorescent protein (CFP), mCherry, tdTomato, and the like; a histidine tag, e.g., a 6XHis tag; a hemagglutinin (HA) tag; a FLAG tag; a Myc tag; and the like).
- a fluorescent protein e.g., green fluorescent protein (GFP), yellow fluorescent protein (YFP), red fluorescent protein (RFP), cyan fluorescent protein (CFP), mCherry, tdTomato, and the like
- a histidine tag e.g., a 6XHis tag
- HA hemagglutinin
- FLAG tag a FLAG tag
- a reference or CasX variant polypeptide includes (is fused to) a nuclear localization signal (NLS) (e.g., in some cases 2 or more, 3 or more, 4 or more, or 5 or more 6 or more, 7 or more, 8 or more NLSs).
- NLS nuclear localization signal
- a reference or CasX variant polypeptide includes one or more NLSs (e.g., 2 or more, 3 or more, 4 or more, or 5 or more NLSs).
- one or more NLSs (2 or more, 3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) the N-terminus and/or the C-terminus.
- one or more NLSs (2 or more, 3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) the N-terminus. In some cases, one or more NLSs (2 or more, 3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) the C-terminus. In some cases, one or more NLSs (3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) both the N-terminus and the C-terminus.
- an NLS is positioned at the N-terminus and an NLS is positioned at the C-terminus.
- a reference or CasX variant polypeptide includes (is fused to) between 1 and 10 NLSs (e.g., 1-9, 1-8, 1-7, 1-6, 1-5, 2-10, 2-9, 2-8, 2-7, 2- 6, or 2-5 NLSs).
- a reference or CasX variant polypeptide includes (is fused to) between 2 and 5 NLSs (e.g., 2-4, or 2-3 NLSs).
- Non-limiting examples of NLSs include sequences derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 165); the NLS from nucleoplasmin (e.g., the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 166); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 167) or RQRRNELKRSP (SEQ ID NO: 168); the hRNPAl M9 NLS having the sequence NQ S SNF GPMKGGNF GGRS S GP Y GGGGQ YF AKPRN Q GGY (SEQ ID NO: 169); the sequence
- PKKK SRKPKKK SRK (SEQ ID NO: 195), HKKKHPDASVNFSEFSK (SEQ ID NO: 196), QRPGPYDRPQRPGPYDRP (SEQ ID NO: 197), LSPSLSPLLSPSLSPL (SEQ ID NO: 198), RGKGGKGLGKGGAKRHRK (SEQ ID NO: 199), PKRGRGRPKRGRGR (SEQ ID NO: 200), PKKKRKVPPPPAAKRVKLD (SEQ ID NO: 190), PKKKRKVPPPPKKKRKV (SEQ ID NO: 201), the sequence PAKRARRGYKC (SEQ ID NO: 202) from CPV, the sequence KLGPRK AT GRW (SEQ ID NO: 203) from B19, and the sequence PRRKREE (SEQ ID NO: 204) from hBOV.
- PAKRARRGYKC (SEQ ID NO: 202) from CPV
- NLS are of sufficient strength to drive accumulation of a reference or CasX variant fusion protein in the nucleus of a eukaryotic cell. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to a reference or CasX variant fusion protein such that location within a cell may be visualized. Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined.
- a reference or CasX variant fusion protein includes a "Protein Transduction Domain” or PTD (also known as a CPP - cell penetrating peptide), which refers to a protein, polynucleotide, carbohydrate, or organic or inorganic compound that facilitates traversing a lipid bilayer, micelle, cell membrane, organelle membrane, or vesicle membrane.
- PTD Protein Transduction Domain
- a PTD attached to another molecule which can range from a small polar molecule to a large macromolecule and/or a nanoparticle, facilitates the molecule traversing a membrane, for example going from an extracellular space to an intracellular space, or from the cytosol to within an organelle.
- a PTD is covalently linked to the amino terminus of a reference or CasX variant fusion protein. In some embodiments, a PTD is covalently linked to the carboxyl terminus of a reference or CasX variant fusion protein. In some cases, the PTD is inserted internally in the sequence of a reference or CasX variant fusion protein at a suitable insertion site. In some cases, a reference or CasX variant fusion protein includes (is conjugated to, is fused to) one or more PTDs (e.g., two or more, three or more, four or more PTDs). In some cases, a PTD includes one or more nuclear localization signals (NLS).
- NLS nuclear localization signals
- PTDs include but are not limited to peptide transduction domain of HIV TAT comprising Y GRKKRRQRRR (SEQ ID NO: 205), RKKRRQRR (SEQ ID NO: 206); Y ARAAARQ ARA (SEQ ID NO: 207); THRLPRRRRRR (SEQ ID NO: 208); and GGRRARRRRRR (SEQ ID NO: 209); a polyarginine sequence comprising a number of arginines sufficient to direct entry into a cell (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or 10-50 arginines (SEQ ID NO: 210)); a VP22 domain (Zender et al. (2002) Cancer Gene Ther.
- the PTD is an activatable CPP (ACPP) (Aguilera et al. (2009) Integr Biol (Camb) June; 1(5-6): 371-381).
- ACPPs comprise a polycationic CPP (e.g., Arg9 or "R9") connected via a cleavable linker to a matching polyanion (e.g., Glu9 or "E9"), which reduces the net charge to nearly zero and thereby inhibits adhesion and uptake into cells.
- a polyanion e.g., Glu9 or "E9
- a reference or CasX variant fusion protein can include a CasX protein that is linked to an internally inserted heterologous amino acid or heterologous polypeptide (a heterologous amino acid sequence) via a linker polypeptide (e.g., one or more linker polypeptides).
- a reference or CasX variant fusion protein can be linked at the C-terminal and/or N-terminal end to a heterologous polypeptide (fusion partner) via a linker polypeptide (e.g., one or more linker polypeptides)
- the linker polypeptide may have any of a variety of amino acid sequences.
- Proteins can be joined by a spacer peptide, generally of a flexible nature, although other chemical linkages are not excluded.
- Suitable linkers include polypeptides of between 4 amino acids and 40 amino acids in length, or between 4 amino acids and 25 amino acids in length. These linkers are generally produced by using synthetic, linker encoding oligonucleotides to couple the proteins. Peptide linkers with a degree of flexibility can be used.
- the linking peptides may have virtually any amino acid sequence, bearing in mind that the preferred linkers will have a sequence that results in a generally flexible peptide.
- the use of small amino acids, such as glycine and alanine are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art.
- Example linker polypeptides include glycine polymers (G)n, glycine-serine polymer (including, for example, (GS)n, GSGGSn (SEQ ID NO: 215), GGSGGSn (SEQ ID NO: 216), and GGGSn (SEQ ID NO: 217), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, glycine-proline polymers, proline polymers and proline-alanine polymers.
- G glycine polymers
- glycine-serine polymer including, for example, (GS)n, GSGGSn (SEQ ID NO: 215), GGSGGSn (SEQ ID NO: 216), and GGGSn (SEQ ID NO: 217), where n is an integer of at least one
- glycine-alanine polymers glycine-alanine polymers
- alanine-serine polymers
- Example linkers can comprise amino acid sequences including, but not limited to, GGSG (SEQ ID NO: 218), GGSGG (SEQ ID NO: 219), GSGSG (SEQ ID NO: 220), GSGGG (SEQ ID NO: 221), GGGSG (SEQ ID NO: 222), GSSSG (SEQ ID NO: 223), GPGP (SEQ ID NO: 224), GGP, PPP, PPAPPA (SEQ ID NO: 225), PPPGPPP (SEQ ID NO: 226) and the like.
- the ordinarily skilled artisan will recognize that design of a peptide conjugated to any elements described above can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure.
- CasXrgNA Systems and Methods for Modification of C9orf72 Genes [0279]
- the CasX proteins, guide nucleic acids, and variants thereof provided herein are useful for various applications, including as therapeutics, diagnostics, and for research.
- programmable CasX:gNA systems To effect the methods of the disclosure for gene editing, provided herein are programmable CasX:gNA systems.
- the programmable nature of the CasX:gNA system provided herein allows for the precise targeting to achieve the desired effect (nicking, cleaving, etc.) at one or more regions of predetermined interest in the target nucleic acid sequence encoding the C9orf72 protein,
- the CasX:gNA systems provided herein comprise a CasX variant of any one of SEQ ID NOS: 49-150, 233-235, 238-252 or 272-281 as set forth in Tables 4, 6, 7, 8, or 10 or a variant sequence at least 60% identical, at least 70% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, or at least 99.5% identical thereto, the gNA scaffold comprises a sequence of any
- the targeting sequence of the gNA hybridizes to a target nucleic acid sequence that encodes one or more mutations of the C9orf72 protein of SEQ ID NO: 227 or 228, or one or more mutations that disrupt the function or expression of the C9orf72 protein.
- the targeting sequence of the gNA hybridizes to a target nucleic acid sequence comprising a sequence that is 5’ or 3’ to the hexanucleotide repeat GGGGCC or its complement.
- the targeting sequence of the gNA hybridizes to a target nucleic acid sequence comprising a regulatory element of the C9orf72 gene.
- the targeting sequence of the gNA has a sequence that hybridizes with a C9orf72 exon sequence. In some embodiments, the targeting sequence of the gNA has a sequence that hybridizes with a C9orf72 intron sequence. In some embodiments, the targeting sequence of the gNA has a sequence that hybridizes with the intron 1 of the C9orf72 gene. In some embodiments, the targeting sequences of the plurality of gNAs have sequences that hybridize with a C9orf72 intron-exon junction sequence, a C9orf72 regulatory element, a C9orf72 coding region, a C9orf72 non-coding region, or combinations thereof.
- the gNA is chemically modified.
- the disclosure provides one or more polynucleotides encoding the foregoing CasX variant proteins and gNAs.
- the CasX:gNA system further comprises a donor template nucleic acid, wherein the donor template can be inserted by HDR or HITI repair mechanisms of the host cell to knock-down or knock-out the C9orf72 gene or, in other cases, to correct the mutation(s); e.g. by deletion of the mutant HRS repeat and insertion of an HRS having between 10 and 30 repeats of the GGGGCC sequence.
- the CasX:gNA systems provided herein comprise a CasX protein and a gNA, or one or more polynucleotides encoding a CasX protein and a gNA, wherein the targeting sequence of the gNA is complementary to, and therefore is capable of hybridizing with, a target nucleic acid sequence encoding the C9orf72 protein, C9orf72 regulatory element, a non-coding region of the C9orf72 gene (e.g., intron 1), sequences that abridge these regions, or is capable or hybridizing with a sequence complementary thereto.
- the targeting sequence of the gNA is complementary to, and therefore is capable of hybridizing with, a sequence within the HRS or a region that is 5’ or 3’ to the HRS.
- the targeting sequence of the gNA is complementary to, and therefore is capable of hybridizing with a sequence within the promoter of the C9orf72.
- Exemplary, but non-limiting targeting sequences that can be used to target the C9orf72 HRS include SEQ ID NOS: 309-343 as set forth in Table 15.
- the targeting sequence comprises a sequence of SEQ ID NOS: 309-343.
- the CasX:gNA system comprises two targeting sequences selected from SEQ ID NOS: 309-343, and the two targeting sequences are not the same.
- the CasX:gNA system comprises two targeting sequences, wherein the first targeting sequence comprises SEQ ID NO: 310 and the second targeting sequence is selected from the group consisting of SEQ ID NOS: 321-324. In some embodiments, the CasX:gNA system comprises two targeting sequences, wherein the first targeting sequence comprises SEQ ID NO: 319 and the second targeting sequence is selected from the group consisting of SEQ ID NOS: 321-325. In some embodiments, the CasX:gNA system comprises two targeting sequences, wherein the first targeting sequence comprises SEQ ID NO: 320 and the second targeting sequence is selected from the group consisting of SEQ ID NOS: 321-325.
- the two targeting sequences comprise SEQ ID NOS: 310 and 321, SEQ ID NOS: 310 and 322, SEQ ID NOS: 310 and 323, SEQ ID NOS: 310 and 324, SEQ ID NOS: 319 and 321, SEQ ID NOS: 319 and 322, SEQ ID NOS: 319 and 323, SEQ ID NOS: 319 and 324, SEQ ID NOS: 319 and 325, SEQ ID NOS: 320 and 321, SEQ ID NOS: 320 and 322, SEQ ID NOS: 320 and 323, SEQ ID NOS: 320 and 324, or SEQ ID NOS: 320 and 325.
- Introducing recombinant expression vectors comprising sequences encoding the CasX:gNA systems (and, optionally, the donor template sequences) of the disclosure into cells under in vitro conditions can occur in any suitable culture media and under any suitable culture conditions that promote the survival of the cells and production of the CasX:gNA.
- Introducing recombinant expression vectors into a target cell can be carried out in vivo , in vitro or ex vivo. In some embodiments of the method, vectors may be provided directly to a target host cell.
- cells may be contacted with vectors having nucleic acids encoding the CasX and gNA of any of the embodiments described herein and, optionally, having a donor template sequence such that the vectors are taken up by the cells.
- Methods for contacting cells with nucleic acid vectors that are plasmids include electroporation, calcium chloride transfection, microinjection, transduction and lipofection are well known in the art.
- cells can be contacted with viral particles comprising the subject viral expression vectors and the nucleic acid encoding the CasX and gNA and, optionally, the donor template.
- the vector is an Adeno-Associated Viral (AAV) vector, wherein the AAV is selected from AAVl, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV 12, AAV 44.9, AAV-Rh74, or AAVRhlO.
- AAV vectors are described more fully, below.
- the vector is a lentiviral vector.
- Retroviruses for example, lentiviruses, may be suitable for use in methods of the present disclosure.
- retroviral vectors are "defective", e.g., are unable to produce viral proteins required for productive infection, and are commonly referred to as virus-like particles. Rather, replication of the vector requires growth in a packaging cell line. Embodiments of retroviral vectors are described more fully, below.
- the disclosure provides methods of modifying target nucleic acid sequences using the CasX:gNA systems of any of the embodiments described herein, and the methods further comprise contacting the target nucleic acid sequence with an additional CRISPR protein, or a polynucleotide encoding the additional CRISPR protein.
- the additional CRISPR protein is a CasX protein having a sequence different from the CasX of the CasX:gNA system.
- the additional CRISPR protein is not a CasX protein; e.g., the additional CRISPR protein can be Cpfl, Cas9, Casl2a, or Casl3a.
- ALS amyotrophic lateral sclerosis
- FTD frontotemporal dementia
- knock-out refers to the elimination of a gene or the expression of a gene.
- a gene can be knocked out by either a deletion or an addition of a nucleotide sequence that leads to a disruption of the reading frame.
- a gene may be knocked out by replacing a part of the gene with an irrelevant or heterologous sequence.
- knock-down refers to reduction in the expression of a gene or its gene product(s).
- the protein activity or function may be attenuated or the protein levels may be reduced or eliminated.
- gNAs having targeting sequences specific for a portion of the gene encoding the C9orf72 protein or the C9orf72 regulatory elements may be used.
- the event may be a cleavage event, allowing for knock-down/knock-out of expression.
- C9orf72 gene expression may be disrupted or eliminated by introducing random insertions or deletions (indels), for example by utilizing the imprecise non-homologous DNA end joining (NHEJ) repair pathway.
- the targeted region of the C9orf72 includes coding sequences (exons) of the C9orf72 gene, as inserting or deleting nucleotides within coding sequences can generate a frame shift mutation. This approach can also be used in non-coding regions such as introns, or regulatory elements to disturb expression of the C9orf72 gene.
- the disclosure provides a CasX:gNA system utilized in methods of altering one or more target nucleic acid sequences of a cell, the methods comprising contacting said cell with the CasX:gNA system comprising a CasX protein and a gNA of the embodiments described herein, wherein the gRNA comprises a targeting sequence to a genomic target complementary to, and therefore capable of hybridizing with a sequence encoding C9orf72 protein, a sequence that is 5’ or 3’ to the HRS, the C9orf72 regulatory elements, or the complement of these sequences.
- the disclosure provides methods of altering a target nucleic acid sequence of a cell, comprising contacting said cell with a nucleic acid encoding a CasX:gNA system comprising a CasX protein and a gNA of the embodiments described herein, wherein the gRNA comprises a targeting sequence to a genomic target complementary to, and therefore capable of hybridizing with a sequence encoding the C9orf72 protein, a sequence that is 5’ or 3’ to the HRS, a C9orf72 regulatory element, or the complement of these sequences.
- the disclosure provides methods of altering a target nucleic acid sequence of a cell, comprising contacting said cell with a vector of the embodiments described herein comprising a nucleic acid encoding a CasX:gNA system comprising a CasX protein and a gNA, wherein the gNA comprises a targeting sequence complementary to, and therefore capable of hybridizing with, a sequence encoding C9orf72 protein, a sequence that is 5’ or 3’ to the HRS, a C9orf72 regulatory element, or the complement of these sequences.
- the disclosure provides methods and CasX:gNA systems to knock-down or knock-out cellular expression of both C9orf72 alleles.
- the disclosure provides methods and CasX:gNA systems to knock-down or knock-out cellular expression of a single C9orf72 allele.
- the CasX:gNA system further comprises a donor template nucleic acid corresponding to all or at least a portion of a C9orf72 gene, wherein said donor template nucleic acid comprises a heterologous sequence, or a deletion, insertion, or mutation of one or more nucleotides in comparison to a genomic nucleic acid sequence encoding said portion of C9orf72 , wherein the contacting results in the knock down or knock-out of C9orf72.
- the cell has been modified such that expression of the HRS is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to a cell that has not been modified.
- the cell has been modified such that the cell does not express a detectable level of the HRS RNA or the DPR protein.
- the donor template nucleic acid comprises a corrective sequence that upon insertion in the target nucleic acid by the CasX:gNA system, functional C9orf72 protein or physiologically-normal levels of C9orf72 can be expressed.
- the CasX:gNA systems and methods described herein can be used, in combination with conventional molecular biology methods, to modify populations of cells (examples of which are described more fully, below) to produce cells having the capacity to produce a functional C9ord72 protein.
- This approach could be used to generate populations of cells that can be administered to a subject with a disease such as ALS or FTD.
- the CasX:gNA systems and methods described herein can be used to treat a subject by administration of components of the system or vectors encoding the CasX:gNA components to modify the C9orf72 gene of the target cells of the subject.
- the present disclosure provides polynucleotides encoding the Type V nuclease proteins and the polynucleotides of the gNAs described herein.
- the disclosure provides polynucleotides encoding the CasX proteins and the polynucleotides of the gNAs (e.g., the gDNAs and gRNAs) of any of the CasX:gNA system embodiments described herein., as well as sequences complementary to polynucleotides encoding the CasX proteins and the gNAs embodiments.
- the disclosure provides donor template polynucleotides encoding portions or all of a C9orf72 gene.
- the C9orf72 gene of the donor template comprises a mutation or a heterologous sequence for knocking down or knocking out the C9orf72 gene in the target nucleic acid.
- the donor template comprises a corrective sequence for knocking in a functional C9orf72 gene or portion thereof.
- the disclosure relates to vectors comprising polynucleotides encoding the CasX proteins and the CasX gNAs described herein.
- the disclosure relates to vectors comprising polynucleotides comprising the donor templates described herein.
- the disclosure provides polynucleotide sequences encoding the reference CasX of SEQ ID NOS: 1-3. In other embodiments, the disclosure provides polynucleotide sequences encoding the CasX variants of any of the embodiments described herein, including the CasX protein variants of SEQ ID NOS: 49-150, 233-235, 238-252, 272-281 as set forth in Tables 4 6-8 and 10, or sequences having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a sequence of Table 4, or the complement of the polynucleotide sequences encoding the variants.
- the disclosure provides an isolated polynucleotide sequence encoding a gNA sequence of any of the embodiments described herein, including scaffold the sequences of Table 1 and 2, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
- the polynucleotide encodes a gNA scaffold sequence selected from the group consisting of SEQ ID NOS:2101-2294, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
- the disclosure provides polynucleotides encoding gNA scaffolds and further comprising a targeting sequence polynucleotide linked 3’ to the scaffold having a sequence of SEQ ID NOs: 309-343, 363-2100 or 2295-21835, or a sequence with at least about 65%, at least about 75%, at least about 85%, or at least about 95% identity to a sequence thereto that is complementary to, and therefore hybridizes with, the C9orf72 gene.
- the disclosure provides a targeting polynucleotide having 15 nucleotides, 16 nucleotides, 17, nucleotides, 18 nucleotides, 19 nucleotides, 20 nucleotides, or 21 nucleotides.
- the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with a C9orf72 exon. In other cases, the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with a C9orf72 intron.
- the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with a C9orf72 intron-exon junction. In other cases, the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with an intergenic region of the C9orf72 gene.
- the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with a sequence located 5’ to the HRS. In other cases, the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with a sequence located 3’ to the HRS. In other embodiments, the disclosure provides polynucleotide sequences encoding two or more gNAs, each having a scaffold and targeting sequence, that collectively hybridize with a sequence located 5’ and a sequence located 3’ to the HRS. In other embodiments, the polynucleotide sequence encodes a gNA comprising a targeting sequence that hybridizes with a C9orf72 regulatory element.
- the C9orf72 regulatory element is a C9orf72 promoter or enhancer. In some cases, the C9orf72 regulatory element is located 5’ of the C9orf72 transcription start site, 3’ of the C9orf72 transcription start, or in a C9orf72 intron. In some cases, the C9orf72 regulatory element is in an intron of the C9orf72 gene. In other cases, the C9orf72 regulatory element comprises the 5' UTR of the C9orf72 gene. In still other cases, the C9orf72 regulatory element comprises the 3'UTR of the C9orf72 gene.
- the disclosure provides donor template nucleic acids, wherein the donor template comprises a nucleotide sequence having homology to a C9orf72 target nucleic acid sequence but not complete identity to the target sequence of the target nucleic acid for which gene editing is intended.
- the C9orf72 donor template is intended for gene editing and comprises all or at least a portion of a C9orf72 gene.
- the C9orf72 donor template comprises a sequence that hybridizes with the C9orf72 gene.
- the C9orf72 donor sequence comprises a sequence that encodes at least a portion of a C9orf72 exon.
- the C9orf72 donor template has a sequence that encodes at least a portion of a C9orf72 intron. In other embodiments, the C9orf72 donor template has a sequence that encodes at least a portion of a C9orf72 intron-exon junction. In other embodiments, the C9orf72 donor template has a sequence that encodes at least a portion of an intergenic region of the C9orf72 gene. In other embodiments, the C9orf72 donor template has a sequence that encodes at least a portion of a C9orf72 regulatory element. In some cases, the C9orf72 donor template is a wild-type sequence that encodes all or a portion of SEQ ID NO: 227 or 228.
- the C9orf72 donor template sequence comprises one or more mutations relative to a wild-type C9orf72 gene and may contain one or more single base changes, insertions, deletions, inversions or rearrangements with respect to the genomic sequence, provided that there is sufficient homology with the target sequence to support homology -directed repair, or the donor template has homologous arms, whereupon insertion can result in splicing out of regions comprising, for example, the hexanucleotide repeat such that a functional C9orf72 protein can be expressed.
- the C9orf72 donor template sequence comprises from 10 to about 30 copies of the hexanucleotide repeat GGGGCC.
- the donor template can range in size from 10-10,000 nucleotides.
- the donor template is a single-stranded DNA template.
- the donor template is a single stranded RNA template.
- the donor template is a double-stranded DNA template.
- the disclosure relates to methods to produce polynucleotide sequences encoding the reference CasX, the CasX variants, or the gNA of any of the embodiments described herein, including variants thereof, as well as methods to express the proteins expressed or RNA transcribed by the polynucleotide sequences.
- the methods include producing a polynucleotide sequence coding for the reference CasX, the CasX variants, or the gNA of any of the embodiments described herein and incorporating the encoding gene into an expression vector appropriate for a host cell.
- the method includes transforming an appropriate host cell with an expression vector comprising the encoding polynucleotide, and culturing the host cell under conditions causing or permitting the resulting reference CasX, the CasX variants, or the gNA of any of the embodiments described herein to be expressed or transcribed in the transformed host cell, thereby producing the reference CasX, the CasX variants, or the gNA, which is recovered by methods described herein or by standard purification methods known in the art, including the methods of the Examples. Standard recombinant techniques in molecular biology are used to make the polynucleotides and expression vectors of the present disclosure.
- polynucleotide sequences that encode the reference CasX, the CasX variants, or the gNA of any of the embodiments described herein are used to generate recombinant DNA molecules that direct the expression in appropriate host cells.
- cloning strategies are suitable for performing the present disclosure, many of which are used to generate a construct that comprises a gene coding for a composition of the present disclosure, or its complement.
- the cloning strategy is used to create a gene that encodes a construct that comprises nucleotides encoding the reference CasX, the CasX variants, or the gNA that is used to transform a host cell for expression of the composition.
- a construct is first prepared containing the DNA sequence encoding a reference CasX, a CasX variant, or a gNA. Exemplary methods for the preparation of such constructs are described in the Examples.
- the construct is then used to create an expression vector suitable for transforming a host cell, such as a prokaryotic or eukaryotic host cell for the expression and recovery of the polypeptide construct.
- a host cell such as a prokaryotic or eukaryotic host cell for the expression and recovery of the polypeptide construct.
- the host cell is an E. coli cell.
- the host cell is selected from BHK cells, HEK293 cells, HEK293T cells, Lenti-X HEK293 cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS, HeLa, CHO, or yeast cells. Exemplary methods for the creation of expression vectors, the transformation of host cells and the expression and recovery of reference CasX, the CasX variants, or the gNA are described in the Examples.
- the gene or genes encoding for the reference CasX, the CasX variants, or the gNA constructs can be made in one or more steps, either fully synthetically or by synthesis combined with enzymatic processes, such as restriction enzyme-mediated cloning, PCR and overlap extension, including methods more fully described in the Examples.
- the methods disclosed herein can be used, for example, to ligate sequences of polynucleotides encoding the various components (e.g., CasX and gNA) genes of a desired sequence.
- Genes encoding polypeptide compositions are assembled from oligonucleotides using standard techniques of gene synthesis.
- the nucleotide sequence encoding a CasX protein is codon optimized. This type of optimization can entail a mutation of an encoding nucleotide sequence to mimic the codon preferences of the intended host organism or cell while encoding the same CasX protein. Thus, the codons can be changed, but the encoded protein remains unchanged. For example, if the intended target cell of the CasX protein was a human cell, a human codon- optimized CasX-encoding nucleotide sequence could be used. As another non-limiting example, if the intended host cell were a mouse cell, then a mouse codon-optimized CasX-encoding nucleotide sequence could be generated.
- the intended host cell were a plant cell
- a plant codon-optimized CasX protein variant-encoding nucleotide sequence could be generated.
- an insect codon-optimized CasX protein-encoding nucleotide sequence could be generated.
- the gene design can be performed using algorithms that optimize codon usage and amino acid composition appropriate for the host cell utilized in the production of the reference CasX, the CasX variants, or the gNA.
- a library of polynucleotides encoding the components of the constructs is created and then assembled, as described above. The resulting genes are then assembled and the resulting genes used to transform a host cell and produce and recover the reference CasX, the CasX variants, or the gNA compositions for evaluation of its properties, as described herein.
- a nucleotide sequence encoding a gNA is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- a nucleotide sequence encoding a CasX protein is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- the transcriptional control element can be a promoter.
- the promoter is a constitutively active promoter.
- the promoter is a regulatable promoter.
- the promoter is an inducible promoter.
- the promoter is a tissue-specific promoter.
- the promoter is a cell type-specific promoter.
- the transcriptional control element e.g., the promoter
- the transcriptional control element is functional in a targeted cell type or targeted cell population.
- the transcriptional control element can be functional in eukaryotic cells, e.g., the cell is selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the cell is selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- Non-limiting examples of eukaryotic promoters include EFlalpha, EFlalpha core promoter, those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HS V) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, and mouse metallothionein-I.
- CMV cytomegalovirus
- HS V herpes simplex virus
- LTRs long terminal repeats from retrovirus
- mouse metallothionein-I mouse metallothionein-I.
- eukaryotic promoters include the CMV promoter full-length promoter, the minimal CMV promoter, the chicken b-actin promoter, the hPGK promoter, the HSV TK promoter, the Mini- TK promoter, the human synapsin I promoter which confers neuron-specific expression, the Mecp2 promoter for selective expression in neurons, the minimal IL-2 promoter, the Rous sarcoma virus enhancer/promoter (single), the spleen focus-forming virus long terminal repeat (LTR) promoter, the SV40 promoter, the SV40 enhancer and early promoter, the TBG promoter: promoter from the human thyroxine-binding globulin gene (Liver specific), the PGK promoter, the human ubiquitin C promoter, the UCOE promoter (Promoter of HNRPA2B1-CBX3), the Histone H2 promoter, the Histone H3 promoter, the Ulal small nuclear
- the expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator.
- the expression vector may also include appropriate sequences for amplifying expression.
- the expression vector may also include nucleotide sequences encoding protein tags (e.g., 6xHis tag, hemagglutinin tag, FLAG tag, fluorescent protein, etc.) that can be fused to the CasX protein, thus resulting in a chimeric CasX protein that are used for purification or detection.
- protein tags e.g., 6xHis tag, hemagglutinin tag, FLAG tag, fluorescent protein, etc.
- a nucleotide sequence encoding each of a gNA variant or a CasX protein is operably linked to an inducible promoter, a constitutively active promoter, a spatially restricted promoter (i.e., transcriptional control element, enhancer, tissue specific promoter, cell type specific promoter, etc.), or a temporally restricted promoter.
- individual nucleotide sequences encoding the gNA or the CasX are linked to one of the foregoing categories of promoters, which are then introduced into the cells to be modified by conventional methods, described below.
- suitable promoters can be derived from viruses and can therefore be referred to as viral promoters, or they can be derived from any organism, including prokaryotic or eukaryotic organisms. Suitable promoters can be used to drive expression by any RNA polymerase (e.g., pol I, pol II, pol III).
- RNA polymerase e.g., pol I, pol II, pol III
- Exemplary promoters include, but are not limited to the SV40 early promoter, mouse mammary tumor virus long terminal repeat (LTR) promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a rous sarcoma virus (RSV) promoter, a human U6 small nuclear promoter (U6), an enhanced U6 promoter, a human HI promoter (HI), a POL1 promoter, a 7SK promoter, tRNA promoters and the like.
- LTR mouse mammary tumor virus long terminal repeat
- Ad MLP adenovirus major late promoter
- HSV herpes simplex virus
- CMV cytomegalovirus
- CMVIE CMV immediate early promoter region
- RSV rous sarcoma virus
- U6 small nuclear promoter U6 small nuclear promoter
- one or more nucleotide sequences encoding a CasX and gNA and, optionally, comprising a donor template are each operably linked to (under the control of) a promoter operable in a eukaryotic cell.
- inducible promoters may include, but are not limited to, T7 RNA polymerase promoter, T3 RNA polymerase promoter, isopropyl -beta-D- thiogalactopyranoside (IPTG) -regulated promoter, lactose induced promoter, heat shock promoter, tetracycline-regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor-regulated promoter, etc.
- Inducible promoters can therefore, in some embodiments, be regulated by molecules including, but not limited to, doxycycline; estrogen and/or an estrogen analog; IPTG; etc.
- inducible promoters suitable for use may include any inducible promoter described herein or known to one of ordinary skill in the art.
- inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol -regulated promoters, tetracycline-regulated promoters (e.g., anhydrotetracycline (aTc)-responsive promoters and other tetracycline - responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA), steroid-regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the steroid/retinoid/thyroid receptor superfamily), metal-regulated promoters (e.g
- the promoter is a spatially restricted promoter (i.e., cell type specific promoter, tissue specific promoter, etc.) such that in a multi-cellular organism, the promoter is active (i.e., “ON”) in a subset of specific cells.
- Spatially restricted promoters may also be referred to as enhancers, transcriptional control elements, control sequences, etc. Any convenient spatially restricted promoter may be used as long as the promoter is functional in the targeted host cell (e.g., eukaryotic cell; prokaryotic cell).
- the promoter is a reversible promoter.
- Suitable reversible promoters including reversible inducible promoters are known in the art.
- Such reversible promoters may be isolated and derived from many organisms, e.g., eukaryotes and prokaryotes. Modification of reversible promoters derived from a first organism for use in a second organism, e.g., a first prokaryote and a second a eukaryote, a first eukaryote and a second a prokaryote, etc., is well known in the art.
- Such reversible promoters, and systems based on such reversible promoters but also comprising additional control proteins include, but are not limited to, alcohol regulated promoters (e.g., alcohol dehydrogenase I (alcA) gene promoter, promoters responsive to alcohol transactivator proteins (AlcR, etc.), tetracycline regulated promoters, (e.g., promoter systems including Tet Activators, TetON, TetOFF, etc.), steroid regulated promoters (e.g., rat glucocorticoid receptor promoter systems, human estrogen receptor promoter systems, retinoid promoter systems, thyroid promoter systems, ecdysone promoter systems, mifepristone promoter systems, etc.), metal regulated promoters (e.g., metallothionein promoter systems, etc.), pathogenesis-related regulated promoters (e.g., salicylic acid regulated promoters, ethylene regulated promoter
- Recombinant expression vectors of the disclosure can also comprise elements that facilitate robust expression of CasX proteins and the gNAs of the disclosure.
- recombinant expression vectors can include one or more of a polyadenylation signal (PolyA), an intronic sequence or a post-transcriptional regulatory element such as a woodchuck hepatitis post-transcriptional regulatory element (WPRE).
- Exemplary polyA sequences include hGH poly(A) signal (short), HSV TK poly(A) signal, synthetic polyadenylation signals, SV40 poly(A) signal, b-globin poly(A) signal and the like.
- the polynucleotides encoding the reference CasX, the CasX variants, and the gNA sequences can then be individually cloned into one or more expression vectors.
- the present disclosure provides vectors comprising the polynucleotides selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a virus-like particle (VLP), a herpes simplex virus (HSV) vector, a plasmid, a minicircle, a nanoplasmid, a DNA vector, and an RNA vector.
- the vector is a recombinant expression vector that comprises a nucleotide sequence encoding a CasX protein.
- the disclosure provides a recombinant expression vector comprising a nucleotide sequence encoding a CasX protein and a nucleotide sequence encoding a gNA.
- the nucleotide sequence encoding the CasX protein variant and/or the nucleotide sequence encoding the gNA are operably linked to a promoter that is operable in a cell type of choice.
- the nucleotide sequence encoding the CasX protein variant and the nucleotide sequence encoding the gNA are provided in separate vectors operably linked to a promoter.
- recombinant expression vectors comprising one or more of: (i) a nucleotide sequence of a donor template nucleic acid where the donor template comprises a nucleotide sequence having homology to a target sequence of a target nucleic acid (e.g., a target genome); (ii) a nucleotide sequence that encodes a gNA that hybridizes to a target sequence of the locus of the targeted genome (e.g., configured as a single or dual guide RNA) operably linked to a promoter that is operable in a target cell such as a eukaryotic cell; and (iii) a nucleotide sequence encoding a CasX protein operably linked to a promoter that is operable in a target cell such as a eukaryotic cell.
- a target sequence of a target nucleic acid e.g., a target genome
- the sequences encoding the donor template, the gNA and the CasX protein are in different recombinant expression vectors, and in other embodiments one or more polynucleotide sequences (for the donor template, CasX, and the gNA) are in the same recombinant expression vector.
- the CasX and gNA are delivered to the target cell as an RNP (e.g., by electroporation or chemical means) and the donor template is delivered by a vector.
- the polynucleotide sequence(s) are inserted into the vector by a variety of procedures.
- DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art.
- Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan. Such techniques are well known in the art and well described in the scientific and patent literature. Various vectors are publicly available.
- the vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage that may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced.
- the vector may be an autonomously replicating vector, i.e., a vector, which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid.
- the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.
- expression of the protein involved in antigen processing, antigen presentation, antigen recognition, and/or antigen response can be determined using any nucleic acid or protein assay known in the art.
- the presence of transcribed mRNA of reference CasX or the CasX variants can be detected and/or quantified by conventional hybridization assays (e.g., Northern blot analysis), amplification procedures (e.g. RT-PCR), SAGE (U.S. Pat. No. 5,695,937), and array-based technologies (see e.g., U.S. Pat. Nos. 5,405,783, 5,412,087 and 5,445,934), using probes complementary to any region of the polynucleotide.
- the disclosure provides for the use of plasmid expression vectors containing replication and control sequences that are compatible with and recognized by the host cell and are operably linked to the gene encoding the polypeptide for controlled expression of the polypeptide or transcription of the RNA.
- vector sequences are well known for a variety of bacteria, yeast, and viruses.
- Useful expression vectors that can be used include, for example, segments of chromosomal, non-chromosomal and synthetic DNA sequences.
- “Expression vector” refers to a DNA construct containing a DNA sequence that is operably linked to a suitable control sequence capable of effecting the expression of the DNA encoding the polypeptide in a suitable host. The requirements are that the vectors are replicable and viable in the host cell of choice.
- control sequences of the vector include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences that control termination of transcription and translation.
- the promoter may be any DNA sequence, which shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell.
- the polynucleotides and recombinant expression vectors can be delivered to the target host cells by a variety of methods. Such methods include, but are not limited to, viral infection, transfection, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, microinjection, liposome- mediated transfection, particle gun technology, nucleofection, direct addition by cell penetrating CasX proteins that are fused to or recruit donor DNA, cell squeezing, calcium phosphate precipitation, direct microinjection, nanoparticle-mediated nucleic acid delivery, and using the commercially available TransMessenger® reagents from Qiagen, StemfectTM RNA Transfection Kit from Stemgent, and TransIT®-mRNA Transfection Kit from Mirus Bio LLC, Lonza nucleofection, Maxagen electroporation and the like.
- PKI polyethyleneimine
- DEAE-dextran mediated transfection DEAE
- nucleic acid sequences that encode the reference CasX, the CasX variants, or the gNA of any of the embodiments described herein (or their complement) are used to generate recombinant DNA molecules that direct the expression in appropriate host cells.
- Several cloning strategies are suitable for performing the present disclosure, many of which are used to generate a construct that comprises a gene coding for a composition of the present disclosure, or its complement.
- the cloning strategy is used to create a gene that encodes a construct that comprises nucleotides encoding the reference CasX, the CasX variants, or the gNA that is used to transform a host cell for expression of the composition.
- a construct is first prepared containing the DNA sequence encoding a reference CasX, a CasX variant, or a gNA. Exemplary methods for the preparation of such constructs are described in the Examples. The construct is then used to create an expression vector suitable for transforming a host cell, such as a prokaryotic or eukaryotic host cell for the expression and recovery of the polypeptide construct. Where desired, the host cell is an E. coli cell.
- the host cell is selected from BHK cells, HEK293 cells, HEK293T cells, Lenti-X HEK293 cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS, HeLa, CHO, or yeast cells. Exemplary methods for the creation of expression vectors, the transformation of host cells and the expression and recovery of reference CasX, the CasX variants, or the gNA are described in the Examples.
- the gene or genes encoding for the reference CasX, the CasX variants, or the gNA constructs can be made in one or more steps, either fully synthetically or by synthesis combined with enzymatic processes, such as restriction enzyme-mediated cloning, PCR and overlap extension, including methods more fully described in the Examples.
- the methods disclosed herein can be used, for example, to ligate sequences of polynucleotides encoding the various components (e.g., CasX and gNA) genes of a desired sequence.
- Genes encoding polypeptide compositions are assembled from oligonucleotides using standard techniques of gene synthesis.
- the nucleotide sequence encoding a CasX protein is codon optimized. This type of optimization can entail a mutation of an encoding nucleotide sequence to mimic the codon preferences of the intended host organism or cell while encoding the same CasX protein. Thus, the codons can be changed, but the encoded protein remains unchanged. For example, if the intended target cell of the CasX protein was a human cell, a human codon- optimized CasX-encoding nucleotide sequence could be used. As another non-limiting example, if the intended host cell were a mouse cell, then a mouse codon-optimized CasX-encoding nucleotide sequence could be generated.
- the intended host cell were a plant cell
- a plant codon-optimized CasX protein variant-encoding nucleotide sequence could be generated.
- an insect codon-optimized CasX protein-encoding nucleotide sequence could be generated.
- the gene design can be performed using algorithms that optimize codon usage and amino acid composition appropriate for the host cell utilized in the production of the reference CasX, the CasX variants, or the gNA.
- a library of polynucleotides encoding the components of the constructs is created and then assembled, as described above. The resulting genes are then assembled and the resulting genes used to transform a host cell and produce and recover the reference CasX, the CasX variants, or the gNA compositions for evaluation of its properties, as described herein.
- a nucleotide sequence encoding a gNA is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- a nucleotide sequence encoding a CasX protein is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- the transcriptional control element can be a promoter.
- the promoter is a constitutively active promoter.
- the promoter is a regulatable promoter.
- the promoter is an inducible promoter.
- the promoter is a tissue-specific promoter.
- the promoter is a cell type-specific promoter.
- the transcriptional control element e.g., the promoter
- the transcriptional control element is functional in a targeted cell type or targeted cell population.
- the transcriptional control element can be functional in eukaryotic cells, e.g., the cell is selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the cell is selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- Non-limiting examples of eukaryotic promoters include EF1 alpha, EF1 alpha core promoter, those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, and mouse metallothionein-I.
- CMV cytomegalovirus
- HSV herpes simplex virus
- LTRs long terminal repeats
- eukaryotic promoters include the CMV promoter full-length promoter, the minimal CMV promoter, the chicken b-actin promoter, the RSV promoter, the FQV-Ltr promoter, the hPGK promoter, the HSV TK promoter, the Mini-TK promoter, the human synapsin I promoter which confers neuron-specific expression, the Mecp2 promoter for selective expression in neurons, the minimal IL-2 promoter, the Rous sarcoma virus enhancer/promoter (single), the spleen focus forming virus long terminal repeat (LTR) promoter, the SV40 promoter, the SV40 enhancer and early promoter, the TBG promoter: promoter from the human thyroxine-binding globulin gene (Liver specific), the PGK promoter, the human ubiquitin C promoter, the UCOE promoter (Promoter of HNRPA2B1-CBX3), the Histone H2 promoter
- the promoter used in the gNA construct is U6 (Kunkel, GR et al. U6 small nuclear RNA is transcribed by RNA polymerase PI. Proc Natl Acad Sci U S A. 83(22):8575 (1986)).
- the expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator.
- the expression vector may also include appropriate sequences for amplifying expression.
- the expression vector may also include nucleotide sequences encoding protein tags (e.g., 6xHis tag, hemagglutinin tag, fluorescent protein, etc.) that can be fused to the CasX protein, thus resulting in a chimeric CasX protein that are used for purification or detection.
- a nucleotide sequence encoding each of a gNA variant or a CasX protein is operably linked to an inducible promoter, a constitutively active promoter, a spatially restricted promoter (i.e., transcriptional control element, enhancer, tissue specific promoter, cell type specific promoter, etc.), or a temporally restricted promoter.
- individual nucleotide sequences encoding the gNA or the CasX are linked to one of the foregoing categories of promoters, which are then introduced into the cells to be modified by conventional methods, described below.
- suitable promoters can be derived from viruses and can therefore be referred to as viral promoters, or they can be derived from any organism, including prokaryotic or eukaryotic organisms. Suitable promoters can be used to drive expression by any RNA polymerase (e.g., pol I, pol II, pol III).
- RNA polymerase e.g., pol I, pol II, pol III
- Exemplary promoters include, but are not limited to the SV40 early promoter, mouse mammary tumor virus long terminal repeat (LTR) promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a rous sarcoma virus (RSV) promoter, a human U6 small nuclear promoter (U6), an enhanced U6 promoter, a human HI promoter (HI), a POL1 promoter, a 7SK promoter, tRNA promoters and the like.
- LTR mouse mammary tumor virus long terminal repeat
- Ad MLP adenovirus major late promoter
- HSV herpes simplex virus
- CMV cytomegalovirus
- CMVIE CMV immediate early promoter region
- RSV rous sarcoma virus
- U6 small nuclear promoter U6 small nuclear promoter
- one or more nucleotide sequences encoding a CasX and gNA and, optionally, comprising a donor template are each operably linked to (under the control of) a promoter operable in a eukaryotic cell.
- inducible promoters may include, but are not limited to, T7 RNA polymerase promoter, T3 RNA polymerase promoter, isopropyl -beta-D- thiogalactopyranoside (IPTG) -regulated promoter, lactose induced promoter, heat shock promoter, tetracycline-regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor-regulated promoter, etc.
- Inducible promoters can therefore, in some embodiments, be regulated by molecules including, but not limited to, doxycycline; estrogen and/or an estrogen analog; IPTG; etc.
- inducible promoters suitable for use may include any inducible promoter described herein or known to one of ordinary skill in the art.
- inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol -regulated promoters, tetracycline-regulated promoters (e.g., anhydrotetracycline (aTc)-responsive promoters and other tetracycline - responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA), steroid-regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the steroid/retinoid/thyroid receptor superfamily), metal-regulated promoters (e.g
- the promoter is a spatially restricted promoter (i.e., cell type specific promoter, tissue specific promoter, etc.) such that in a multi-cellular organism, the promoter is active (i.e., “ON”) in a subset of specific cells.
- Spatially restricted promoters may also be referred to as enhancers, transcriptional control elements, control sequences, etc. Any convenient spatially restricted promoter may be used as long as the promoter is functional in the targeted host cell (e.g., eukaryotic cell; prokaryotic cell).
- the promoter is a reversible promoter.
- Suitable reversible promoters including reversible inducible promoters are known in the art.
- Such reversible promoters may be isolated and derived from many organisms, e.g., eukaryotes and prokaryotes. Modification of reversible promoters derived from a first organism for use in a second organism, e.g., a first prokaryote and a second a eukaryote, a first eukaryote and a second a prokaryote, etc., is well known in the art.
- Such reversible promoters, and systems based on such reversible promoters but also comprising additional control proteins include, but are not limited to, alcohol regulated promoters (e.g., alcohol dehydrogenase I (alcA) gene promoter, promoters responsive to alcohol transactivator proteins (AlcR, etc.), tetracycline regulated promoters, (e.g., promoter systems including Tet Activators, TetON, TetOFF, etc.), steroid regulated promoters (e.g., rat glucocorticoid receptor promoter systems, human estrogen receptor promoter systems, retinoid promoter systems, thyroid promoter systems, ecdysone promoter systems, mifepristone promoter systems, etc.), metal regulated promoters (e.g., metallothionein promoter systems, etc.), pathogenesis-related regulated promoters (e.g., salicylic acid regulated promoters, ethylene regulated promoter
- Recombinant expression vectors of the disclosure can also comprise elements that facilitate robust expression of CasX proteins and the gNAs of the disclosure.
- recombinant expression vectors can include one or more of a polyadenylation signal (PolyA), an intronic sequence or a post-transcriptional regulatory element such as a woodchuck hepatitis post-transcriptional regulatory element (WPRE).
- Exemplary polyA sequences include hGH poly(A) signal (short), HSV TK poly(A) signal, synthetic polyadenylation signals, SV40 poly(A) signal, b-globin poly(A) signal and the like.
- the polynucleotides encoding the reference CasX, the CasX variants, and the gNA sequences can then be individually cloned into one or more expression vectors.
- the present disclosure provides vectors comprising the polynucleotides selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a virus-like particle (VLP), a herpes simplex virus (HSV) vector, a plasmid, a minicircle, a nanoplasmid, a DNA vector, and an RNA vector.
- the vector is a recombinant expression vector that comprises a nucleotide sequence encoding a CasX protein.
- the disclosure provides a recombinant expression vector comprising a nucleotide sequence encoding a CasX protein and a nucleotide sequence encoding a gNA.
- the nucleotide sequence encoding the CasX protein variant and/or the nucleotide sequence encoding the gNA are operably linked to a promoter that is operable in a cell type of choice.
- the nucleotide sequence encoding the CasX protein variant and the nucleotide sequence encoding the gNA are provided in separate vectors operably linked to a promoter.
- recombinant expression vectors comprising one or more of: (i) a nucleotide sequence of a donor template nucleic acid where the donor template comprises a nucleotide sequence having homology to a target sequence of a target nucleic acid (e.g., a target genome); (ii) a nucleotide sequence that encodes a gNA that hybridizes to a target sequence of the locus of the targeted genome (e.g., configured as a single or dual guide RNA) operably linked to a promoter that is operable in a target cell such as a eukaryotic cell; and (iii) a nucleotide sequence encoding a CasX protein operably linked to a promoter that is operable in a target cell such as a eukaryotic cell.
- the sequences encoding the donor template, the gNA and the CasX protein are in different recombinant expression vectors, and in other embodiments one or more polynucleotide sequences (for the donor template, CasX, and the gNA) are in the same recombinant expression vector.
- the CasX and gNA are delivered to the target cell as an RNP (e.g., by electroporation or chemical means) and the donor template is delivered by a vector.
- the polynucleotide sequence(s) are inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art.
- Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan. Such techniques are well known in the art and well described in the scientific and patent literature. Various vectors are publicly available. The vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage that may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced.
- the vector may be an autonomously replicating vector, i.e., a vector, which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid.
- the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.
- expression of the protein involved in antigen processing, antigen presentation, antigen recognition, and/or antigen response can be determined using any nucleic acid or protein assay known in the art.
- the presence of transcribed mRNA of reference CasX or the CasX variants can be detected and/or quantified by conventional hybridization assays (e.g., Northern blot analysis), amplification procedures (e.g. RT-PCR), SAGE (U.S. Pat. No. 5,695,937), and array-based technologies (see e.g., U.S. Pat. Nos. 5,405,783, 5,412,087 and 5,445,934), using probes complementary to any region of the polynucleotide.
- hybridization assays e.g., Northern blot analysis
- amplification procedures e.g. RT-PCR
- SAGE U.S. Pat. No. 5,695,937
- array-based technologies see e.g., U.S. Pat. Nos. 5,405,783, 5,412,087 and 5,445,934.
- the disclosure provides for the use of plasmid expression vectors containing replication and control sequences that are compatible with and recognized by the host cell and are operably linked to the gene encoding the polypeptide for controlled expression of the polypeptide or transcription of the RNA.
- vector sequences are well known for a variety of bacteria, yeast, and viruses.
- Useful expression vectors that can be used include, for example, segments of chromosomal, non-chromosomal and synthetic DNA sequences.
- “Expression vector” refers to a DNA construct containing a DNA sequence that is operably linked to a suitable control sequence capable of effecting the expression of the DNA encoding the polypeptide in a suitable host. The requirements are that the vectors are replicable and viable in the host cell of choice.
- control sequences of the vector include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences that control termination of transcription and translation.
- the promoter may be any DNA sequence, which shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell.
- the polynucleotides and recombinant expression vectors can be delivered to the target host cells by a variety of methods. Such methods include, but are not limited to, viral infection, transfection, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, microinjection, liposome- mediated transfection, particle gun technology, nucleofection, direct addition by cell penetrating CasX proteins that are fused to or recruit donor DNA, cell squeezing, calcium phosphate precipitation, direct microinjection, nanoparticle-mediated nucleic acid delivery, and using the commercially available TransMessenger® reagents from Qiagen, StemfectTM RNA Transfection Kit from Stemgent, and TransIT®-mRNA Transfection Kit from Mirus Bio LLC, Lonza nucleofection, Maxagen electroporation and the like.
- PKI polyethyleneimine
- DEAE-dextran mediated transfection DEAE
- a recombinant expression vector sequence can be packaged into a virus or virus-like particle (also referred to herein as a “VLP” or “virion”) for subsequent infection and transformation of a cell, ex vivo, in vitro or in vivo.
- VLP virus-like particle
- Such VLP or virions will typically include proteins that encapsidate or package the vector genome.
- Suitable expression vectors may include viral expression vectors based on vaccinia virus; poliovirus; adenovirus; a retroviral vector (e.g., Murine Leukemia Virus), spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Vims, avian leukosis vims, retrovims, a lentivims, human immunodeficiency vims, myeloproliferative sarcoma vims, and mammary tumor vims; and the like.
- a recombinant expression vector of the present disclosure is a recombinant adeno-associated vims (AAV) vector.
- a recombinant expression vector of the present disclosure is a recombinant retrovims vector.
- a recombinant expression vector of the present disclosure is a recombinant lentivims vector.
- AAV is a small (20 nm), nonpathogenic vims that is useful in treating human diseases in situations that employ a viral vector for delivery to a cell such as a eukaryotic cell, either in vivo or ex vivo for cells to be prepared for administration to a subject.
- a constmct is generated, for example, encoding any of the CasX proteins and gNA embodiments as described herein, and optionally a donor template, and can be flanked with AAV inverted terminal repeat (ITR) sequences, thereby enabling packaging of the AAV vector into an AAV viral particle.
- ITR inverted terminal repeat
- An “AAV” vector may refer to the naturally occurring wild-type virus itself or derivatives thereof. The term covers all subtypes, serotypes and pseudotypes, and both naturally occurring and recombinant forms, except where required otherwise.
- serotype refers to an AAV which is identified by and distinguished from other AAVs based on capsid protein reactivity with defined antisera, e.g., there are many known serotypes of primate AAVs.
- the AAV vector is selected from AAVl, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV 10, AAV-Rh74 (Rhesus macaque-derived AAV), and AAVRhlO, and modified capsids of these serotypes.
- serotype AAV-2 is used to refer to an AAV which contains capsid proteins encoded from the cap gene of AAV-2 and a genome containing 5' and 3' ITR sequences from the same AAV-2 serotype.
- Pseudotyped AAV refers to an AAV that contains capsid proteins from one serotype and a viral genome including 5 '-3' ITRs of a second serotype.
- Pseudotyped rAAV would be expected to have cell surface binding properties of the capsid serotype and genetic properties consistent with the ITR serotype.
- Pseudotyped recombinant AAV are produced using standard techniques described in the art.
- rAAVl may be used to refer an AAV having both capsid proteins and 5 '-3' ITRs from the same serotype or it may refer to an AAV having capsid proteins from serotype 1 and 5 '-3' ITRs from a different AAV serotype, e.g., AAV serotype 2.
- AAV serotype 2 e.g., AAV serotype 2
- An “AAV virus” or “AAV viral particle” refers to a viral particle composed of at least one AAV capsid protein (preferably by all of the capsid proteins of a wild-type AAV) and an encapsidated polynucleotide. If the particle additionally comprises a heterologous polynucleotide (i.e., a polynucleotide other than a wild-type AAV genome to be delivered to a mammalian cell), it is typically referred to as “rAAV”.
- An exemplary heterologous polynucleotide is a polynucleotide comprising a CasX protein and/or sgNA and, optionally, a donor template of any of the embodiments described herein.
- AAV ITRs adeno-associated virus inverted terminal repeats
- AAV ITRs the art recognized regions found at each end of the AAV genome which function together in cis as origins of DNA replication and as packaging signals for the virus.
- AAV ITRs, together with the AAV rep coding region, provide for the efficient excision and rescue from, and integration of a nucleotide sequence interposed between two flanking ITRs into a mammalian cell genome.
- the nucleotide sequences of AAV ITR regions are known. See, for example Kotin, R. M. (1994) Human Gene Therapy 5:793-801; Berns, K. I.
- an AAV ITR need not have the wild-type nucleotide sequence depicted, but may be altered, e.g., by the insertion, deletion or substitution of nucleotides. Additionally, the AAV ITR may be derived from any of several AAV serotypes, including without limitation, AAV1, AAV2, AAV3,
- AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV-Rh74, and AAVRhlO, and modified capsids of these serotypes need not necessarily be identical or derived from the same AAV serotype or isolate, so long as they function as intended, i.e., to allow for excision and rescue of the sequence of interest from a host cell genome or vector, and to allow integration of the heterologous sequence into the recipient cell genome when AAV Rep gene products are present in the cell.
- Use of AAV serotypes for integration of heterologous sequences into a host cell is known in the art (see, e.g., WO2018195555A1 and US20180258424A1, incorporated by reference herein.)
- AAV rep coding region is meant the region of the AAV genome which encodes the replication proteins Rep 78, Rep 68, Rep 52 and Rep 40. These Rep expression products have been shown to possess many functions, including recognition, binding and nicking of the AAV origin of DNA replication, DNA helicase activity and modulation of transcription from AAV (or other heterologous) promoters. The Rep expression products are collectively required for replicating the AAV genome.
- AAV cap coding region is meant the region of the AAV genome which encodes the capsid proteins VP1, VP2, and VP3, or functional homologues thereof. These Cap expression products supply the packaging functions which are collectively required for packaging the viral genome.
- AAV capsids utilized for delivery of the CasX, gNA, and, optionally, donor template nucleotides, to a host cell can be derived from any of several AAV serotypes, including without limitation, AAVl, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV-Rh74 (Rhesus macaque-derived AAV), and AAVRhlO, and the AAV ITRs are derived from AAV serotype 2.
- AAVl , AAV7, AAV6, AAV8, or AAV9 are utilized for delivery of the CasX, gNA, and, optionally, donor template nucleotides, to a host muscle cell.
- an AAV expression vector is introduced into a suitable host cell using known techniques, such as by transfection.
- Packaging cells are typically used to form virus particles; such cells include HEK293 or HEK293T cells (and other cells described herein or known in the art), which package adenovirus.
- transfection techniques are generally known in the art; see, e.g., Sambrook et al. (1989) Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York.
- transfection methods include calcium phosphate co-precipitation, direct microinjection into cultured cells, electroporation, liposome mediated gene transfer, lipid-mediated transduction, and nucleic acid delivery using high-velocity microprojectiles.
- host cells transfected with the above-described AAV expression vectors are rendered capable of providing AAV helper functions in order to replicate and encapsidate the nucleotide sequences flanked by the AAV ITRs to produce rAAV viral particles.
- AAV helper functions are generally AAV-derived coding sequences which can be expressed to provide AAV gene products that, in turn, function in trans for productive AAV replication.
- AAV helper functions are used herein to complement necessary AAV functions that are missing from the AAV expression vectors.
- AAV helper functions include one, or both of the major AAV ORFs (open reading frames), encoding the rep and cap coding regions, or functional homologues thereof.
- Accessory functions can be introduced into and then expressed in host cells using methods known to those of skill in the art. Commonly, accessory functions are provided by infection of the host cells with an unrelated helper virus. In some embodiments, accessory functions are provided using an accessory function vector. Depending on the host/vector system utilized, any of a number of suitable transcription and translation control elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc., may be used in the expression vector. In some embodiments, the disclosure provides host cells comprising the AAV vectors of the embodiments disclosed herein.
- suitable vectors may include virus-like particles (VLP).
- VLPs virus like particles
- VLPs are particles that closely resemble viruses, but do not contain viral genetic material and are therefore non-infectious.
- VLPs comprise a polynucleotide encoding a transgene of interest, for example any of the CasX protein and/or a gNA embodiments, and, optionally, donor template polynucleotides described herein, packaged with one or more viral structural proteins.
- the disclosure provides VLPs produced in vitro that comprise a CasX:gNA RNP complex and, optionally, a donor template.
- Combinations of structural proteins from different viruses can be used to create VLPs, including components from virus families including Parvoviridae (e.g., adeno-associated virus), Retroviridae (e.g., alpharetrovirus, a betaretrovirus, a gammaretrovirus, a deltaretrovirus, a epsilonretrovirus, or a lentivirus), Flaviviridae (e.g., Hepatitis C virus), Paramyxoviridae (e.g., Nipah) and bacteriophages (e.g.,
- Parvoviridae e.g., adeno-associated virus
- Retroviridae e.g., alpharetrovirus, a betaretrovirus, a gammaretrovirus, a deltaretrovirus, a eps
- the disclosure provides VLP systems designed using components of retrovirus, including lentiviruses (such as HIV) and alpharetrovirus, betaretrovirus, gammaretrovirus, deltaretrovirus, epsilonretrovirus, in which individual plasmids comprising polynucleotides encoding the various components are introduced into a packaging cell that, in turn, produce the VLP.
- retrovirus including lentiviruses (such as HIV) and alpharetrovirus, betaretrovirus, gammaretrovirus, deltaretrovirus, epsilonretrovirus, in which individual plasmids comprising polynucleotides encoding the various components are introduced into a packaging cell that, in turn, produce the VLP.
- the disclosure provides VLP comprising one or more components of i) protease, ii) a protease cleavage site, iii) one or more components of a gag polyprotein selected from a matrix protein (MA), a nucleocapsid protein (NC), a capsid protein (CA), a pi peptide, a p6 peptide, a P2A peptide, a P2B peptide, a P10 peptide, a pl2 peptide, a PP21/24 peptide, a P12/P3/P8 peptide, and a P20 peptide; v) CasX; vi) gNA, and vi) targeting glycoproteins or antibody fragments wherein the resulting VLP particle encapsidates a CasX:gNA RNP.
- a gag polyprotein selected from a matrix protein (MA), a nucleocapsid protein (NC), a capsid protein (CA),
- the disclosure provides VLP of the foregoing and further comprises one or more components of a pol polyprotein (e.g. a protease), and, optionally, a second CasX or a donor template.
- a pol polyprotein e.g. a protease
- a second CasX or a donor template e.g. a second CasX or a donor template.
- the disclosure provides host cells comprising polynucleotides or vectors encoding one or more components selected from i) one or more components of a gag polyprotein (the components of which are listed, supra ); ii) a CasX protein of any of the embodiments described herein; iii) a protease cleavage site; iv) a protease; v) a guide RNA of any of the embodiments described herein; vi) a pol polyprotein or portions thereof (e.g., a protease); vii) a pseudotyping glycoprotein or antibody fragment that provides for binding and fusion of the VLP to a target cell; and viii) a donor template.
- a gag polyprotein the components of which are listed, supra
- a CasX protein of any of the embodiments described herein iii) a protease cleavage site; iv) a protease; v) a guide RNA of any of the embodiments
- the disclosure contemplates multiple configurations of the arrangement of the encoded components, including duplicates of some of the encoded components.
- the envelope glycoprotein can be derived from any enveloped viruses known in the art to confer tropism to VLP, including but not limited to the group consisting of Argentine hemorrhagic fever virus, Australian bat virus, Autographa californica multiple nucleopolyhedrovirus, Avian leukosis virus, baboon endogenous virus, Venezuelan hemorrhagic fever virus, Borna disease virus, Breda virus, Bunyamwera virus, Chandipura virus, Chikungunya virus, Crimean-Congo hemorrhagic fever virus, Dengue fever virus, Duvenhage virus, Eastern equine encephalitis virus, Ebola hemorrhagic fever virus, Ebola Zaire virus, enteric adenovirus, Ephemerovirus, Epstein-Bar virus (EBV), European bat virus 1, European bat virus 2, Fug Synthetic gP Fusion,
- the packaging cell used for the production of VLP is selected from the group consisting of HEK293 cells, Lenti-X HEK293T cells, BHK cells, HepG2 cells, Saos-2 cells, HuH7 cells, NSO cells, SP2/0 cells, YO myeloma cells, A549 cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, VERO cells, NIH3T3 cells, COS cells, WI38 cells, MRC5 cells, A549 cells, HeLa cells, CHO cells, or HT1080 cells.
- the VLP can be used in methods to edit target cells of subjects by the administering of such VLP, as described more fully, below.
- cells comprising a C9orf72 gene modified by any of the CasX:gNA systems embodiments described herein.
- cells that have been genetically modified in this way may be administered to a subject for purposes such as gene therapy, e.g., to treat a disease associated with a defect in the C9orf72 gene.
- the cells are modified in vivo in a subject with a C9orf72- related disease.
- the present disclosure provides a population of cells that has been modified to excise the hexanucleotide repeat expansion region of the C9orf72 gene such that a functional C9orf72 protein is expressed.
- the cell to be modified comprises one or more mutations in the C9orf72 gene that disrupt the function or expression of the C9orf72 protein.
- the cell to be modified comprises a HRS expansion in the C9orf72 gene such that excess RNA or DPR protein is produced and incorporated into the cell.
- the cell to be modified comprises one or more mutations or truncations of the C9orp2 protein of SEQ ID NO: 227 or 228.
- the population of cells are modified by a Type V Cas nuclease and one or more guides targeted to sequences proximal to the associated with the hexanucleotide repeat expansion region of the C9orf72 target nucleic acid.
- the disclosure provides methods and populations of cells modified by introducing into each cell of the population: i) a CasX:gNA system comprising a CasX and a gNA of any one of the embodiments described herein; ii) a CasX:gNA system comprising a CasX, a gNA, and a donor template of any one of the embodiments described herein; iii) a nucleic acid encoding the CasX and the gNA, and optionally comprising the donor template ; iv) a vector selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno- associated viral (AAV) vector, and a herpes simplex virus (HSV) vector and comprising the nucleic acid of (iii), above; v) a VLP comprising the CasX:gNA system of any one of the embodiments described herein; or vi) combinations of two or more of
- the donor template comprises at least a portion of a C9orf72 gene, wherein the C9orf72 gene portion is selected from a C9orf72 exon, a C9orf72 intron, a C9orf72 intr on-exon junction, a C9orf72 regulatory element (e.g., a promoter), a C9orf72 coding region, a C9orf72 non-coding region, or combinations thereof or the entirety of the C9orf72 gene, and the modification of the cell results in the correction of the mutation to a wild-type sequence, the replacement of all or a portion of the hexanucleotide repeat expansion region or the knocking-down or knocking-out of the C9orf72 gene.
- the donor template can comprise a nucleic acid encoding all or a portion of the sequence of SEQ ID NO: 227 or 228 or comprises a polynucleotide sequence that spans all or a portion of chr9
- the donor template can comprise a heterologous sequence compared to a wild-type C9orf72 gene in order to knock down or knock out the gene.
- the donor template comprises a hexanucleotide repeat of a GGGGCC sequence wherein the number of repeats ranges from 10 to about 30 repeats.
- the donor template would be used to replace the defective sequence of the cell having hundreds to thousands of the hexanucleotide repeats.
- the donor template would further comprise homologous arms that are 5' and 3' to the cleavage sites introduced by the nuclease to facilitate its insertion by HDR.
- the donor template can range in size from 10-30,000 nucleotides, or 20-10,000 nucleotides, or 100-1000 nucleotides.
- the donor template is a single-stranded DNA template or a single stranded RNA template. In other cases, the donor template is a double-stranded DNA template.
- the cell is contacted with a CasX and at least a first gNA wherein the gNA is a guide RNA (gRNA). In some cases, the cell is contacted with a CasX and at least a first and a second gNA wherein the gNA is a guide RNA (gRNA). In other cases, the cell is contacted with a CasX and a gNA wherein the gNA is a guide DNA (gDNA). In other cases, the cell is contacted with a CasX and a gNA wherein the gNA is a chimera comprising DNA and RNA.
- gRNA guide RNA
- gRNA guide RNA
- the cell is contacted with a CasX and a gNA wherein the gNA is a chimera comprising DNA and RNA.
- each of said gNA molecules (a combination of the scaffold and targeting sequence, which can be configured as a sgRNA or a dgRNA) can be provided as an RNP with a CasX embodiment described herein for incorporation into the cells of the embodiments.
- the cells of the population are contacted with an RNP of a CasX comprising a sequence of SEQ ID NOS: 49-150, 233-235, 238-252, or 272-281 as set forth in Tables 4, 6-8 and 10, or a sequence at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, or at least 99.5% identical thereto, the gNA scaffold comprises a sequence of SEQ ID NOS: 2101-2294 as set forth in Table 2 or a sequence
- the modified C9orf72 gene of the modified cell comprises a single- stranded break, resulting in a mutation, an insertion, or a deletion by the repair mechanisms of the cell.
- the modified C9orf72 gene of the cell comprises a double-stranded break, resulting in a mutation, an insertion, or a deletion by the repair mechanisms of the cell.
- the CasX:gNA system can introduce into the cell an indel, e.g., a frameshift mutation, at or near the initiation point of the C9orf72 gene.
- the cell is modified by contact with a CasX and a first gNA targeting the target nucleic acid 5’ to the hexanucleotide repeat expansion region and a second gNA targeting the target nucleic acid 3’ to the hexanucleotide repeat expansion region wherein the hexanucleotide repeat expansion region is excised from the C9orf72 gene, wherein the modification results in the cells ability to produce a wild-type or a functional C9orf72 protein.
- the population of cells have been modified such that expression of the hexanucleotide transcript RNA or the DPR is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 95% in comparison to a cell that has not been modified.
- at least 30%, at least 40%, at least 50%, at least 60%, at least 05%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the modified cells do not express a detectable level of the hexanucleotide transcript RNA or the DPR.
- the first gNA targeting sequence is selected from the group consisting of SEQ ID NOS: 310 and 319-320
- the second gNA targeting sequence is selected from the group consisting of SEQ ID NOS: 321-325.
- Reduced or eliminated expression of a hexanucleotide transcript RNA or the DPR can be measured by ELISA or electrochemiluminescence assays
- sense G4C2-repeat transcripts can be analyzed by RNA fluorescence in situ hybridization (FISH) assay (Batra, R and Lee, C. Mouse Models of C9orf72 Hexanucleotide Repeat Expansion in Amyotrophic Lateral Sclerosis/ Frontotemporal Dementia. Frontiers Cell.
- FISH RNA fluorescence in situ hybridization
- the disclosure provides a population of cells modified such that expression of a functional C9orf72 protein is increased by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to a cell that has not been modified.
- the modification of a cell’s C9orf72 gene that comprises one or more mutations or duplications occurs in vitro.
- a population of the modified cell can then be administered to a subject.
- An RNP can be introduced into the cells to be modified via any suitable method, including via electroporation, injection, nucleofection, delivery via liposomes, delivery by nanoparticles, or using a protein transduction domain (PTD) conjugated to one or more components of the CasX:gNA.
- PTD protein transduction domain
- the CasX and the one or more gNA are introduced into the population of cells as encoding polynucleotides using a vector; embodiments of which are described herein.
- Additional methods of modification of the cells using the CasX:gNA system components include viral infection, transfection, conjugation, protoplast fusion, particle gun technology, calcium phosphate precipitation, direct microinjection, and the like.
- the choice of method is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place; e.g., in vitro, ex vivo, or in vivo.
- a general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995.
- the modification of a cell s C9orf72 gene that comprises one or more mutations or duplications occurs in vivo.
- the CasX and gNA, and, optionally, the donor template are administered to the subject.
- the CasX and gNA, and, optionally, the donor template are administered to a subject within a vector that encodes the CasX and one or more gNA and, optionally, contains the donor template.
- the CasX and gNA, and, optionally, the donor template are administered to a subject within a vector such as a VLP that encapsidates the RNP and, optionally, contains the donor template.
- the modification corrects the one or more mutations or, in the alternative, the modification is the inhibition or suppression of the expression of the hexanucleotide transcript RNA or the DPR, the expression of a functional C9orf72 protein, or the expression of the wild- type or a functional C9orf72 protein.
- a cell that can serve as a recipient for a CasX protein and/or gNA of the present disclosure and/or a nucleic acid comprising a nucleotide sequence encoding a CasX protein and/or a CasX gNA variant and, optionally, a donor template can be any of a variety of cells, including, e.g., in vitro cells; in vivo cells; ex vivo cells; primary cells; cancer cells; animal cells; etc.
- a cell can be a recipient of a CasX RNP of the present disclosure.
- a cell can be a recipient of a single component of a CasX system of the present disclosure.
- a cell can be an in vitro cell (e.g., established cultured cell line including, but not limited to HEK293 cells, HEK293-F cells, BHK cells, NS0 cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS, HeLa, or CHO cells).
- a cell can be an ex vivo cell (cultured cell from an individual).
- a cell can be an in vivo cell (e.g., a cell in an individual).
- a cell can be an isolated cell.
- a cell can be a cell inside of an organism.
- a cell can be an organism.
- a cell can be a cell in a cell culture (e.g., in vitro cell culture).
- a cell can be one of a collection of cells.
- a cell can be an animal cell or derived from an animal cell.
- a cell can be a vertebrate cell or derived from a vertebrate cell.
- a cell can be a mammalian cell or derived from a mammalian cell.
- a cell can be a rodent cell or derived from a rodent cell.
- a cell can be a non -human primate cell or derived from a non human primate cell.
- a cell can be a human cell or derived from a human cell.
- the modified cell is a eukaryotic cell, wherein the eukaryotic cell is selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
- the modified cell is a human cell.
- the cells are autologous with respect to a subject to be administered the cell.
- the cells are allogeneic with respect to a subject to be administered the cell.
- the modified cell is a cell of the central nervous system (CNS).
- CNS central nervous system
- the modified cell is selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the populations of cells have utility in the treatment of a C9orf72- related disease, wherein the population of cells are administered to a subject having a C9orf72- related disease.
- the cell to be modified comprises one or more mutations in the C9orf72 gene that disrupt the function or expression of the C9orf72 protein.
- the cell to be modified comprises a HRS expansion in the C9orf72 gene such that excess RNA or DPR protein is produced and incorporated into the cell.
- the cell to be modified comprises one or more mutations or truncations of the C9orf72 protein of SEQ ID NO: 227 or 228.
- the disclosure provides populations of modified cells for use in in a subject with a C9orf72- related disease.
- the disclosure provides a method of treating a subject having a C9orf72- related disease, the method comprising administering to the subject an effective amount of a plurality of modified cells of any one of the embodiments described herein wherein the modified cells express physiologically-normal levels of C9orf72.
- the C9orf72- related disease is selected from the group consisting of amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD).
- the CasX:gNA systems comprising CasX proteins, guides, and variants thereof provided herein are useful in methods for modifying the C9orf72 target nucleic acid sequence in various applications, including therapeutics, diagnostics, and research.
- the methods utilize any of the embodiments of the CasX:gNA system described herein, and optionally include a donor template described herein.
- the methods knock down the expression of the mutant C9orf72.
- the methods knock-out the expression of the mutant C9orf72.
- the methods result in the expression of functional C9orf72 protein.
- the methods comprise contacting the target nucleic acid sequence with a CasX protein and a guide nucleic acid (gNA) comprising a targeting sequence , wherein said contacting results in modification of the target nucleic acid sequence by the CasX protein.
- gNA guide nucleic acid
- the methods comprise introducing into a cell the CasX protein or a nucleic acid encoding the CasX protein and the gNA or the nucleic acid encoding the gNA, wherein the target nucleic acid sequence comprises a C9orf72 gene and wherein the targeting sequence comprises a sequence complementary to a portion of the C9orf72 gene encoding the C9orf72 protein, a C9orf72 regulatory element, or both the C9orf72 encoding sequence and a C9orf72 regulatory element, wherein the contacting results in the modification of the C9orf72 gene.
- the targeting sequence of the gNA comprises a sequence of SEQ ID NOS: 309-343, 363-2100 and 2295-21835, or a sequence having at least about 65%, at least about 75%, at least about 85%, or at least about 95% identity thereto.
- the scaffold of the gNA comprises a sequence of SEQ ID NOS: 4, 5 or 2101-2294, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity thereto.
- the CasX protein is a CasX variant protein of any of the embodiments described herein, or a reference CasX protein SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the modified C9orf72 gene of the modified cell comprises a single-stranded break, resulting in a mutation, an insertion, or a deletion by the repair mechanisms of the cell.
- the modified C9orf72 gene of the modified cell comprises a double-stranded break, resulting in a mutation, an insertion, or a deletion by the repair mechanisms of the cell.
- the CasX:gNA system can introduce into the cell an indel, e.g., a frameshift mutation, at or near the initiation point of the C9orf72 gene.
- the modified C9orf72 gene of the cell has been modified by the insertion of the donor template wherein the C9orf72 gene has been knocked down or knocked out.
- the cells have been modified such that expression of the HRS or the DPR protein is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to a cell that has not been modified.
- at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the modified cells do not express a detectable level of HRS RNA or DPR.
- Reduced or eliminated expression of a HRS RNA or DPR protein can be measured by ELISA or electrochemiluminescence assays (Mcdonald, D., et al. Quantification Assays for Total and Polyglutamine-Expanded Huntingtin Proteins. PLoS ONE 9(5): e96854 (2014)) or other methods know in the art, or as described in the Examples.
- the target nucleic acid sequence comprises a C9orf72 gene having one or more mutations or duplications, and the targeting sequence of the gNA has a sequence that is complementary to, and therefore can hybridize with the C9orf72 gene.
- the C9orf72 gene has a wild-type nucleic acid sequence.
- the method comprises contacting the target nucleic acid sequence with a plurality (e.g., two or more) of gNAs targeted to different or overlapping regions of the C9orf72 gene with one or more mutations or duplications.
- the target nucleic acid is a DNA.
- the target nucleic acid is an RNA.
- the gNA is a guide RNA (gRNA).
- the gNA is a guide DNA (gDNA).
- the gNA is a single-molecule gNA (sgNA).
- the gNA is a dual-molecule gNA (dgNA).
- the gNA is a chimeric gRNA-gDNA.
- the method comprises contacting the target nucleic acid sequence with a pre-complexed CasX protein-gNA (i.e., an RNP).
- the C9orf72 gene comprises a mutation or duplication and the modifying comprises introducing a single-stranded break in the target nucleic acid. In other embodiments, the C9orf72 gene comprises a mutation or duplication and the modifying comprises introducing a double-stranded break in the target nucleic acid.
- the resulting modification can be an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides as compared to the wild-type sequence.
- the modification corrects a gain of function mutation. In other embodiments, the modification corrects a loss of function mutation.
- the mutations to be modified can comprise one or more mutations or duplications that disrupt the function or expression of the C9orf72 protein.
- the methods of modifying a target nucleic acid sequence comprise contacting a C9orf72 gene with a CasX protein and gNA pair and a donor template comprising a corrective sequence that can be inserted or knocked-in at the break site introduced by the CasX.
- a donor template comprising a corrective sequence that can be inserted or knocked-in at the break site introduced by the CasX.
- an exogenous donor template which may comprise a corrective sequence (or a deletion or insertion to knock-out the defective sequence) to be integrated is flanked by an upstream sequence and a downstream sequence (e.g., homologous arms) with homology to the target nucleic acid sequence to facilitate its introduction into a cell.
- the donor template ranges in size from 10-10,000 nucleotides.
- the donor template ranges in size from 100-1,000 nucleotides. In some embodiments, the donor template is a single-stranded DNA template or a single stranded RNA template. In other embodiments, the donor template is a double-stranded DNA template.
- the CasX is a catalytically inactive CasX (dCasX) protein that retains the ability to bind to the gNA and the target nucleic acid sequence comprising the mutation, thereby interfering with transcription of mutant C9orf72.
- the methods comprise contacting a C9orf72 gene with a CasX protein and gNA and does not comprise contacting the target nucleic acid sequence with a donor template polynucleotide, and the target nucleic acid sequence is cleaved by the CasX nuclease and is modified such that nucleotides within the target nucleic acid sequence are deleted or inserted according to the cells own repair pathways.
- the editing occurs in vivo inside of a cell, for example in a cell in an organism or subject.
- the cell is a eukaryotic cell.
- Exemplary eukaryotic cells may include cells selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
- the cell is a human cell.
- the cell is a non-human primate cell.
- the cell is a selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- Methods of introducing a nucleic acid into a cell are known in the art, and any convenient method can be used to introduce a nucleic acid (e.g., an expression construct) into a cell. Suitable methods include; e.g., viral infection or contact with a virus-like particle (VLP) with tropism for the target cell.
- VLP virus-like particle
- Retroviruses for example, lentiviruses, may be suitable for use in methods of the present disclosure. Commonly used retroviral vectors are “defective”, e.g., are unable to produce viral proteins required for productive infection. Rather, replication of the vector requires growth in a packaging cell line.
- the retroviral nucleic acids comprising the nucleic acid are packaged into viral capsids by a packaging cell line.
- Different packaging cell lines provide a different envelope protein (ecotropic, amphotropic or xenotropic) to be incorporated into the capsid, and this envelope protein determines the specificity of the viral particle for the cells (ecotropic for murine and rat; amphotropic for most mammalian cell types including human, dog and mouse; and xenotropic for most mammalian cell types except murine cells).
- the appropriate packaging cell line may be used to ensure that the cells are targeted by the packaged viral particles.
- the disclosure relates to methods to produce CasX proteins and nucleic acids encoding the CasX compositions of any of the embodiments described herein, or sequences complementary to the polynucleotide sequences, including homologous variants thereof, as well as methods to express the CasX proteins expressed by the polynucleotide sequences.
- a CasX protein of the present disclosure may be produced in vitro by eukaryotic cells or by prokaryotic cells.
- the methods include producing a polynucleotide sequence coding for the CasX proteins of any of the embodiments described herein and incorporating the encoding gene into an expression vector appropriate for a host cell.
- the method includes transforming an appropriate host cell with an expression vector, and culturing the host cell under conditions causing or permitting the resulting CasX protein to be expressed in the transformed host cell, thereby producing the CasX protein, which is recovered by methods described herein or by standard protein purification methods known in the art. Standard recombinant techniques in molecular biology are used to make the polynucleotides and expression vectors of the present disclosure.
- the CasX gNA and/or the CasX protein of the present disclosure and/or the donor template sequence, whether they be introduced as nucleic acids or polypeptides are provided to the cells by a vector or particle of the embodiments described herein.
- Providing the vector or particle to the cells may be repeated with a frequency of about every day to about every 4 days, e.g., every 1.5 days, every 2 days, every 3 days, or any other frequency from about every day to about every four days, or weekly, or monthly.
- the agent(s) may be provided to the subject cells one or more times, e.g., one time, twice, three times, or more than three times.
- the complexes may be provided simultaneously (e.g., as two polypeptides and/or nucleic acids), or delivered simultaneously. Alternatively, they may be provided consecutively, e.g., the targeting complex being provided first, followed by the second targeting complex, etc. or vice versa.
- a nucleic acid of the present disclosure e.g., a recombinant expression vector of the present disclosure
- lipids in an organized structure like a micelle or a liposome.
- the organized structure is complexed with DNA it is called a lipoplex.
- lipids There are three types of lipids, anionic (negatively-charged), neutral, or cationic (positively-charged). Lipoplexes that utilize cationic lipids have proven utility for gene transfer.
- Cationic lipids due to their positive charge, naturally complex with the negatively charged DNA. Also, as a result of their charge, they interact with the cell membrane. Endocytosis of the lipoplex then occurs, and the DNA is released into the cytoplasm.
- the cationic lipids also protect against degradation of the DNA by the cell.
- polyplexes Complexes of polymers with DNA are referred to as polyplexes. Most polyplexes consist of cationic polymers and their production is regulated by ionic interactions. One large difference between the methods of action of polyplexes and lipoplexes is that polyplexes cannot release their DNA load into the cytoplasm, so to this end, co-transfection with endosome-lytic agents (to lyse the endosome that is made during endocytosis) such as inactivated adenovirus must occur. However, this is not always the case; polymers such as polyethylenimine have their own method of endosome disruption as does chitosan and trimethylchitosan.
- Dendrimers a highly branched macromolecule with a spherical shape, may be also be used to genetically modify stem cells.
- the surface of the dendrimer particle may be functionalized to alter its properties.
- a cationic dendrimer i.e., one with a positive surface charge.
- charge complementarity leads to a temporary association of the nucleic acid with the cationic dendrimer.
- the dendrimer-nucleic acid complex can be taken up into a cell by endocytosis.
- the present disclosure provides methods of treating a C9orf72- related disease in a subject in need thereof, including but not limited to amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD).
- the methods of the disclosure can prevent, treat and/or ameliorate a C9orf72- related disease of a subject by the administering to the subject of a composition of the disclosure.
- a number of therapeutic strategies have been used to design the compositions for use in the methods of treatment of a subject with a C9orf72- related disease.
- the methods can be used to treat a subject in advance of any symptom of a C9orf72- related disease.
- the prophylactic administration of a modified cell population or a therapeutically effective amount of the CasX:gNA system composition(s) or the polynucleic acids encoding the CasX:gNA systems of the embodiments can serve to prevent a C9orf72-related disease.
- the composition administered to the subject further comprises pharmaceutically acceptable carrier, diluent or excipient.
- one of the alleles of the C9orf72 gene of the subject comprises an HRS. In some cases, one or both alleles of the C9orf72 gene of the subject comprises a mutation. In other cases, one or both alleles of the C9orf72 gene of the subject comprises a duplication of at least a portion of the C9orf72 gene. In other cases, one or both alleles of the C9orf72 gene of the subject comprises a duplication of the C9orf72 gene.
- the C9orf72 gene encodes a mutation that alters the function or expression of the C9orf72 protein such as, but not limited to, substitutions, deletions or insertions of one or more nucleotides as compared to the wild-type sequence.
- the disclosure provides methods of treating a C9orf72 or related disease in a subject in need thereof comprising modifying a C9orf72 gene in a cell of the subject, the modifying comprising contacting said cells with a therapeutically effective dose of i) a composition comprising a CasX and a gNA of any of the embodiments described herein; ii) a composition comprising a CasX, a gNA, and a donor template of any of the embodiments described herein; iii) one or more nucleic acids encoding or comprising the compositions of (i) or (ii); iv) a vector selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a herpes simplex virus (HSV) vector and comprising the nucleic acids of (iii); v) a VLP comprising the composition of (
- a second gNA is utilized, wherein the second gNA has a targeting sequence complementary to a different or overlapping portion of the target nucleic acid compared to the first gNA (e.g., 5’ and 3’ to the hexanucleotide repeat expansion), resulting in an additional break in the C9orf72 target nucleic acid of the cells of the subject.
- the gene can be modified by the NHEJ host repair mechanisms, or utilized in conjunction with a donor template that is inserted by HDR or HITI mechanisms to either excise, correct, or compensate for the mutation, such that expression of a wild-type or functional C9orf72 protein in modified cells is increased by at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 95% in comparison to a cell that has not been modified.
- the method of treatment by administration of the modalities of (i)-(v), above results in a knocking-down or knocking out of the C9orf72 gene such that expression of the HRS RNA and/or the DPR in modified cells is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to cells that have not been modified.
- the C9orf72- related disease includes all diseases occurring due to expression of the HRS RNA and/or the DPR, the mutation of C9orf72 , the duplication of the C9orf72 gene, or the abnormal expression of C9orf72 in the subject.
- the method comprises administration of the vector comprising or encoding a CasX and a plurality of gNAs targeted to different locations in the C9orf72 gene, wherein the contacting of the cells of the subject with the CasX:gNA complexes results in modification of the target nucleic acid of the cells.
- the vector of the embodiments are administered to the subject at a therapeutically effective dose.
- the vector is an AAV of the embodiments described herein, encoding components of the CasX:gNA system and, optionally, the donor template.
- the AAV vector is selected from AAVl, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV 12, AAV 44.9, AAV- Rh74, or AAVRhlO.
- the AAV vector is administered to the subject at a dose of at least about 1 x 10 5 vector genomes/kg (vg/kg), at least about 1 x 10 6 vg/kg, at least about 1 x 10 7 vg/kg, at least about 1 x 10 8 vg/kg, at least about 1 x 10 9 vg/kg, at least about 1 x 10 10 vg/kg, at least about 1 x 10 11 vg/kg, at least about 1 x 10 12 vg/kg, at least about 1 x 10 13 vg/kg, at least about 1 x 10 14 vg/kg, at least about 1 x 10 15 vg/kg, or at least about 1 x 10 16 vg/kg.
- the AAV vector is administered to the subject at a dose of at least about 1 x 10 5 vg/kg to about 1 x 10 16 vg/kg, at least about 1 x 10 6 vg/kg to about 1 x 10 15 vg/kg, or at least about 1 x 10 7 vg/kg to about 1 x 10 14 vg/kg.
- the method comprises administering a therapeutically effective dose of a VLP of the embodiments described herein to the subject, comprising components of the CasX:gNA system and, optionally, the donor template.
- the VLP is administered to the subject at a dose of at least about 1 x 10 5 particles/kg, at least about 1 x 10 6 particles/kg, at least about 1 x 10 7 particles/kg at least about 1 x 10 8 particles/kg, at least about 1 x 10 9 particles/kg, at least about 1 x 10 10 particles/kg, at least about 1 x 10 11 particles/kg, at least about 1 x 10 12 particles/kg, at least about 1 x 10 13 particles/kg, at least about 1 x 10 14 particles/kg, at least about 1 x 10 15 particles/kg, or at least about 1 x 10 16 particles/kg.
- the VLP is administered to the subject at a dose of at least about 1 x 10 5 particles/kg to about 1 x 10 16 particles/kg, or at least about 1 x 10 6 particles/kg to about 1 x 10 15 particles/kg, or at least about 1 x 10 7 particles/kg to about 1 x 10 14 particles/kg.
- the vector or VLP can be administered according to any of the treatment regimens disclosed herein, below.
- administering the C9orf72- targeting vector compositions of the disclosure to a subject delivers the CasX:gNA compositions to a cell of the subject, resulting in the editing of the C9orf72 target nucleic acid in said cell.
- the modified cell of the treated subject can be a eukaryotic cell selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
- the eukaryotic cell of the treated subject is a human cell.
- the cell is a cell selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the cell comprises at least one modified allele of a C9orf72 gene in a cell wherein the modification is used to correct or compensate for a mutation or a duplication of a portion of the C9orf72 gene in the subject; e.g., the HRS.
- the cell comprises at least one modified allele of a C9orf72 gene in a cell wherein the modification is used to knock-down or knock out the C9orf72 gene in the subject.
- the methods comprises further administering an additional CRISPR protein, or a polynucleotide encoding the additional CRISPR protein to the subject.
- the additional CRISPR protein has a sequence different from the first CasX protein of the method.
- the additional CRISPR protein is not a CasX protein; i.e., is a Cpfl, Cas9, CaslO, Casl2a, or Casl3a.
- the gNA used in the method of treatment is a single-molecule gNA (sgNA).
- the gNA is a dual-molecule gNA (dgNA).
- the method comprises contacting the target nucleic acid sequence with a plurality of gNAs targeted to different or overlapping sequences of the C9orf72 gene.
- the method of treatment comprises administering to the subject the CasX:gNA compositions or vectors via an administration route selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method comprises injection, transfusion, or implantation.
- the subject is selected from the group consisting of mouse, rat, pig, non human primate, and human.
- the subject is a human.
- the cell of the subject to be modified by the methods of disclosure is a cell is selected from the group consisting of a Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the invention provides a method of treatment of a subject having a C9orf72- related disease, the method comprising administering to the subject a CasX:gNA composition or a vector of any of the embodiments disclosed herein according to a treatment regimen comprising one or more consecutive doses using a therapeutically effective dose.
- the therapeutically effective dose of the composition or vector is administered as a single dose.
- the therapeutically effective dose is administered to the subject as two or more doses over a period of at least two weeks, or at least one month, or at least two months, or at least three months, or at least four months, or at least five months, or at least six months.
- the effective doses are administered by a route selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
- the administering to the subject with a C9orf72- related disease of the therapeutically effective amount of a CasX:gNA modality or a vector comprising a polynucleotide encoding a CasX protein and a guide nucleic acid disclosed herein corrects or compensates for the mutations such that expression of a wild-type or functional C9orf72 protein leads to the prevention or amelioration of the underlying C9orf72- related disease such that an improvement is observed in the subject, notwithstanding that the subject may still be afflicted with the underlying disease.
- the administration of the therapeutically effective amount of the CasX-gNA modality leads to an improvement in at least one clinically- relevant parameter for a C9orf72- related disease, including, but not limited to neuronal cell death, neuroinflammation, TDP-43 related pathology, axonal and neuromuscular junction (NMJ) abnormalities, dendritic spine density changes at prefrontal cortex, electrophysiological deficits in neonatal cortical neurons, change from baseline in percent of predicted slow vital capacity (SVC), change from baseline in muscle strength, change from baseline in bulbar strength, ALS Functional Rating Scale (ALSFRS-(R)), combined assessment of function and survival, duration of response, time to death, time to tracheostomy, time to persistent assisted ventilation (DTP), forced vital capacity (%FVC); manual muscle test, maximum voluntary isometric contraction, duration of response, progression-free survival, time to progression of disease, and time-to- treatment failure.
- a C9orf72- related disease including, but not limited to neuronal cell death,
- the administration of the therapeutically effective amount of the CasX-gNA modality leads to an improvement in at least two clinically-relevant parameters for treatment of a C9orf72- related disease.
- the C9orf72- related disease can be FTD, ALS, or both.
- the subject is selected from mouse, rat, pig, dog, non-human primate, and human.
- the method of treatment comprises administering a therapeutically-effective dose of a population of cells modified to correct or compensate for the mutation of the C9orf72 gene. Methods for modification of such populations of cells are described herein, supra.
- the administration of the modified cells results in the expression of wild-type or a functional C9orf72 protein in the subject.
- the dose of total cells is within a range of between at or about 10 4 and at or about 10 9 cells/kilograms (kg) body weight, such as between 10 5 and 10 6 cells/kg body weight, for example, at or about lx lO 5 cells/kg, 1.5 10 5 cells/kg, 2 / 10 5 cells/kg, or 1 10 6 cells/kg body weight.
- the cells are administered at, or within a certain range of error of, between at or about 10 4 and at or about 10 9 cells/kilograms (kg) body weight, such as between 10 5 and 10 6 cells/kg body weight, for example, at or about lxlO 5 cells/kg, 1.5xl0 5 cells/kg, 2x l0 5 cells/kg, or lxlO 6 cells/kg body weight.
- the cells are autologous with respect to the subject to be administered the cells.
- the cells are allogeneic with respect to the subject to be administered the cells.
- the methods of treatment further comprise administering a chemotherapeutic agent wherein the agent is effective in improving the signs or symptoms associated with a C9orf72- related disease, including but not limited to riluzole, ranolazine, radicava, and dextromethorphan HBr in combination with quinidine sulfate.
- a chemotherapeutic agent wherein the agent is effective in improving the signs or symptoms associated with a C9orf72- related disease, including but not limited to riluzole, ranolazine, radicava, and dextromethorphan HBr in combination with quinidine sulfate.
- Biomarkers of C9orf72 diseases include, but are not limited to, C9orf72 levels, C9orf72 RNA, GGGGCC repeat-containing RNA species (as well as the antisense GGCCCC RNA), polyadenylated C9orf72 RNA species retaining the hexanucleotide repeat-containing intron, DPR levels, and DPR RNA levels.
- kits comprising a CasX protein, one or a plurality of CasX gNA of any of the embodiments of the disclosure comprising a targeting sequence specific for a C9orf72 gene, and a suitable container (for example a tube, vial or plate).
- the kit further comprises a buffer, a nuclease inhibitor, a protease inhibitor, a liposome, a therapeutic agent, a label, a label visualization reagent, or any combination of the foregoing.
- the kit further comprises a pharmaceutically acceptable carrier, diluent or excipient.
- the kit comprises appropriate control compositions for gene modifying applications, and instructions for use.
- the kit comprises a vector comprising a sequence encoding a CasX protein of the disclosure, a CasX gNA of the disclosure, optionally a donor template, or a combination thereof, and the kit further comprises a pharmaceutically acceptable carrier, diluent or excipient.
- a CasX:gNA system comprising a CasX protein and a guide nucleic acid (gNA), wherein the gNA comprises a targeting sequence complementary to a target nucleic acid sequence comprising a chromosome 9 open reading frame 72 ( C9orf72 ) gene.
- gNA guide RNA
- SNPs single nucleotide polymorphisms
- the targeting sequence of the gNA comprises a sequence of Table 3 with five nucleotides removed from the 3’ end of the sequence.
- SNP single nucleotide polymorphisms
- the CasX:gNA system of embodiment 37 wherein the at least one modification comprises at least one amino acid substitution, deletion, or insertion in a domain of the CasX variant protein relative to the reference CasX protein.
- the domain is selected from the group consisting of a non-target strand binding (NTSB) domain, a target strand loading (TSL) domain, a helical I domain, a helical II domain, an oligonucleotide binding domain (OBD), and a RuvC DNA cleavage domain.
- NTSB non-target strand binding
- TSL target strand loading
- OBD oligonucleotide binding domain
- PKTRRRPRRS QRKRPPT SEQ ID NO: 191
- RRKKRRPRRKKRR SEQ ID NO: 194
- PKKKSRKPKKKSRK SEQ ID NO: 195
- HKKKHPDASVNFSEFSK SEQ ID NO: 196
- QRPGPYDRPQRPGPYDRP SEQ ID NO: 197
- LSPSLSPLLSPSLSPL SEQ ID NO: 198
- RGKGGKGLGKGGAKRHRK SEQ ID NO: 199
- PKRGRGRPKRGRGR SEQ ID NO: 200
- MSRRRKANPTKLSENAKKLAKEVEN SEQ ID NO: 192
- PKKKRKVPPPPAAKRVKLD SEQ ID NO: 190
- PKKKRKVPPPPKKKRKV SEQ ID NO: 201).
- the CasX:gNA system of embodiment 45 wherein the improved characteristic is selected from the group consisting of improved folding of the CasX protein, improved binding affinity of the CasX protein to the gNA, improved ribonuclear protein complex (RNP) formation, higher percentage of cleavage-competent RNP, improved binding affinity to the target nucleic acid sequence, improved binding affinity for a PAM sequence, improved unwinding of the target nucleic acid sequence, increased activity, increased target nucleic acid sequence cleavage rate, improved editing efficiency, improved editing specificity, increased activity of the nuclease, increased target strand loading for double strand cleavage, decreased target strand loading for single strand nicking, decreased off-target cleavage, improved binding of the non-target strand of DNA, improved CasX protein stability, improved proteimguide RNA complex stability, improved protein solubility, improved protein :gNA complex solubility, improved protein yield, improved protein expression, and improved fusion characteristics.
- RNP ribonuclear protein complex
- the increased binding affinity for the one or more PAM sequences is at least 1.5 -fold greater compared to the binding affinity of any one of the CasX proteins of SEQ ID NOS: 1-3 for the PAM sequences.
- CasX variant protein and the gNA are associated together in an RNP.
- the CasX:gNA system of embodiment 61 wherein the donor template comprises a nucleic acid comprising at least a portion of the C9orf72 gene, wherein the C9orf72 gene portion is selected from the group consisting of a C9orf72 exon, a C9orf72 intron, a C9orf72 intron-exon junction, a C9orf72 regulatory element, or a combination thereof.
- the donor template comprises homologous arms complementary to sequences flanking a cleavage site in the target nucleic acid.
- a nucleic acid comprising a sequence that encodes the CasX:gNA system of any one of embodiments 1-60.
- a vector comprising the nucleic acid of embodiment 70 or embodiment 71.
- a vector comprising a donor template, wherein the donor template comprises a nucleic acid comprising at least a portion of a C9orf72 gene, wherein the C9orf72 gene portion is selected from the group consisting of a C9orf72 exon, a C9orf72 intron, a C9orf72 intron-exon junction, and a C9orf72 regulatory element.
- 76 The vector of embodiment 74 or embodiment 75, further comprising the nucleic acid of embodiment 70 or embodiment 71.
- 77 The vector of any one of embodiments 72-76, wherein the vector is selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno- associated viral (AAV) vector, a herpes simplex virus (HSV) vector, a virus-like particle (VLP), a plasmid, a minicircle, a nanoplasmid, and an RNA vector.
- vector encoding the VLP comprises one or more nucleic acids encoding a gag polyprotein, the CasX protein of any one of embodiments 36-60, and the gNA of any one of embodiments 1-35.
- VLP virus-like particle
- VLP of embodiment 82 or embodiment 83 further comprising a pseudotyping viral envelope glycoprotein or antibody fragment that provides for binding and fusion of the VLP to a target cell.
- a method of modifying a C9orf72 target nucleic acid sequence comprising contacting the target nucleic acid sequence with a CasX protein and a guide nucleic acid (gNA) comprising a targeting sequence wherein said contacting comprises introducing into a cell : a. the CasX:gNA system of any one of embodiments 1-69; b. the nucleic acid of embodiment 70 or embodiment 71; c. the vector as in any one of embodiments 72-81; d. the VLP of any one of embodiments 82-84; or e. combinations thereof,
- eukaryotic cell is selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a pig cell, a primate cell, and a non human primate cell.
- eukaryotic cell is a human cell.
- 101 The method of any one of embodiments 85-100, wherein the cell is selected from the group consisting of Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- any one of embodiments 111-115 wherein the vector is administered by a route of administration selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
- a route of administration selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
- CasX protein having a sequence different from the CasX protein of any of the preceding embodiments.
- a method of altering a C9orf72 target nucleic acid sequence of a cell comprising contacting said cell with: a) the CasX:gNA system of any one of embodiments 1-69; b) the nucleic acid of embodiment 70 or embodiment 71; c) the vector of any one of embodiments 72-81; d) the VLP of any one of embodiments 82-84; or e) combinations thereof, wherein said contacting results in modification of the C9orf72 target nucleic acid sequence by the CasX protein.
- 121 the CasX:gNA system of any one of embodiments 1-69
- the nucleic acid of embodiment 70 or embodiment 71 comprising contacting said cell with: a) the CasX:gNA system of any one of embodiments 1-69; b) the nucleic acid of embodiment 70 or embodiment 71; c) the vector of any one of embodiments 72-81; d) the VLP of any one of embodiments 82-84; or e) combinations thereof, wherein said
- the method of embodiment 120 wherein the cell has been modified such that expression of the HRS and/or the DPR is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to a cell that has not been modified.
- DPR dipeptide repeat protein
- the cells have been modified such that at least 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the modified cells do not express a detectable level of DPR.
- a method of treating a C9orf72- related disorder in a subject in need thereof comprising modifying a C9orf72 gene in a cell of the subject, the modifying comprising contacting said cell with; a. CasX:gNA system of any one of embodiments 1-69; b. the nucleic acid of embodiment 70 or embodiment 71; c. the vector as in any one of embodiments 72-81; d. the VLP of any one of embodiments 82-84; or e. combinations thereof, wherein said contacting results in modification of the C9orf72 target nucleic acid sequence by the CasX protein.
- 127 The method of embodiment 126, wherein the C9orf72 -related disorder is amyotrophic lateral sclerosis (ALS) or frontotemporal dementia (FTD).
- ALS amyotrophic lateral sclerosis
- FTD frontotemporal dementia
- 133 The method of any one of embodiments 126-132, wherein the cell is selected from the group consisting of a Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- the cell is selected from the group consisting of a Purkinje cell, frontal cortex neuron, motor cortex neuron, hippocampus neuron, cerebellum neuron, upper motor neuron, spinal cord neuron, spinal cord motor neuron, glial cell, and astrocytes.
- [0526] 138 The method of any one of embodiments 126-136, wherein the vector is administered by a route of administration selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatic, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
- 139 The method of any one of embodiments 126-138, comprising further contacting the target nucleic acid sequence with an additional CRISPR nuclease, or a polynucleotide encoding the additional CRISPR protein.
- 143 The method of any one of embodiments 126-142, wherein the method results in improvement in at least one clinically-relevant parameter selected from the group consisting of neuronal cell death, neuroinflammation, TDP-43 related pathology, axonal and neuromuscular junction (NMJ) abnormalities, dendritic spine density changes at prefrontal cortex, electrophysiological deficits in neonatal cortical neurons, change from baseline in percent of predicted slow vital capacity (SVC), change from baseline in muscle strength, change from baseline in bulbar strength, ALS Functional Rating Scale (ALSFRS-(R)), combined assessment of function and survival, duration of response, time to death, time to tracheostomy, time to persistent assisted ventilation (DTP), forced vital capacity (%FVC); manual muscle test, maximum voluntary isometric contraction, duration of response, progression-free survival, time to progression of disease, and time-to-treatment failure.
- SVC slow vital capacity
- DTP persistent assisted ventilation
- %FVC forced vital capacity
- CasX Stx2 also referred to herein as CasX2
- Planctomycetes having the CasX amino acid sequence of SEQ ID NO: 2 and encoded by the sequence in Table 5, below
- the assembled construct contains a TEV-cleavable, C- terminal, TwinStrep tag and was cloned into a pBR322-derivative plasmid backbone containing an ampicillin resistance gene.
- the expression construct was transformed into chemically competent BL21 * (DE3) E.
- the cultures were induced at 16°C, 200 RPM for 20 hours before being harvested by centrifugation at 4,000xg for 15 minutes, 4°C.
- the cell paste was weighed and resuspended in lysis buffer (50 mM HEPES-NaOH, 250 mMNaCl, 5 mM MgCl 2 , 1 mM TCEP, 1 mM benzamidine-HCL, 1 mM PMSF, 0.5% CHAPS, 10% glycerol, pH 8) at a ratio of 5 mL of lysis buffer per gram of cell paste. Once resuspended, the sample was frozen at -80°C until purification.
- the column was washed with 5 CV of Heparin Buffer A (50 mM HEPES-NaOH, 250 mM NaCl, 5 mM MgCb, 1 mM TCEP, 10% glycerol, pH 8), then with 5 CV of Heparin Buffer B (Buffer A with the NaCl concentration adjusted to 500 mM). Protein was eluted with 5 CV of Heparin Buffer C (Buffer A with the NaCl concentration adjusted to 1 M), collected in fractions. Fractions were assayed for protein by Bradford Assay and protein-containing fractions were pooled. The pooled heparin eluate was applied to a Strep-Tactin XT Superflow column (IBA Life Sciences) by gravity flow.
- Heparin Buffer A 50 mM HEPES-NaOH, 250 mM NaCl, 5 mM MgCb, 1 mM TCEP, 10% glycerol, pH 8
- Heparin Buffer B
- the column was washed with 5 CV of Strep Buffer (50 mM HEPES-NaOH, 500 mM NaCl, 5 mM MgCb, 1 mM TCEP, 10% glycerol, pH 8). Protein was eluted from the column using 5 CV of Strep Buffer with 50 mM D-Biotin added and collected in fractions. CasX-containing fractions were pooled, concentrated at 4°C using a 30 kDa cut-off spin concentrator, and purified by size exclusion chromatography on a Superdex 200 pg column (GE Life Sciences).
- Strep Buffer 50 mM HEPES-NaOH, 500 mM NaCl, 5 mM MgCb, 1 mM TCEP, 10% glycerol, pH 8
- Protein was eluted from the column using 5 CV of Strep Buffer with 50 mM D-Biotin added and collected in fractions. CasX-containing fractions were
- the column was equilibrated with SEC Buffer (25 mM sodium phosphate, 300 mM NaCl, 1 mM TCEP, 10% glycerol, pH 7.25) operated by an AKTA Pure FPLC system (GE Life Sciences). CasX-containing fractions that eluted at the appropriate molecular weight were pooled, concentrated at 4°C using a 30 kDa cut-off spin concentrator, aliquoted, and snap-frozen in liquid nitrogen before being stored at -80°C.
- SEC Buffer 25 mM sodium phosphate, 300 mM NaCl, 1 mM TCEP, 10% glycerol, pH 7.25
- AKTA Pure FPLC system GE Life Sciences
- FIG. 1 Samples from throughout the purification were resolved by SDS-PAGE and visualized by colloidal Coomassie staining, as shown in FIG. 1 and FIG. 3.
- the lanes from right to left are the injection (sample of protein injected onto the gel filtration column,) molecular weight markers, lanes 3-9 are samples from the indicated elution volumes. Results from the gel filtration are shown in FIG. 2.
- the 68.36 mL peak corresponds to the apparent molecular weight of CasX and contained the majority of CasX protein.
- the average yield was 0.75 mg of purified CasX protein per liter of culture, with 75% purity, as evaluated by colloidal Coomassie staining.
- the codon-optimized CasX 37 construct (based on the CasX Stx2 construct of Example 1, encoding Planctomycetes CasX SEQ ID NO:2, with a A708K substitution and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) was cloned into a mammalian expression plasmid (pStX; see FIG. 4) using standard cloning methods.
- the CasX 37 construct DNA was PCR amplified in two reactions using Q5 DNA polymerase (New England BioLabs Cat# M0491L) according to the manufacturer’s protocol, using primers oIC539 and 0IC88 as well as oIC87 and oIC540 respectively (see FIG. 5).
- the CasX 365 construct DNA was PCR amplified in four reactions using Q5 DNA polymerase using primers oIC539 and oIC212, oIC211 and oIC376, oIC375 and oIC551, and oIC550 and oIC540 respectively.
- the CasX 119 construct DNA was PCR amplified in four reactions using Q5 DNA polymerase using primers oIC539 and oIC689, 0IC688 and oIC376, oIC375 and oIC551, and oIC550 and oIC540 respectively.
- the resulting PCR amplification products were then purified using Zymoclean DNA clean and concentrator (Zymo Research Cat# 4014) according to the manufacturer’s protocol.
- the pStX backbone was digested using Xbal and Spel in order to remove the 2931 base pair fragment of DNA between the two sites in plasmid pStx34.
- the digested backbone fragment was purified by gel extraction from a 1% agarose gel (Gold Bio Cat# A-201-500) using Zymoclean Gel DNA Recovery Kit (Zymo Research Cat#D4002) according to the manufacturer’s protocol. The three fragments were then pieced together using Gibson assembly (New England BioLabs Cat# E2621S) following the manufacturer’s protocol. Assembled products in the pStx34 were transformed into chemically- competent or electro-competent Turbo Competent A. coli bacterial cells, plated on LB-Agar plates (LB: Teknova Cat# L9315, Agar: Quartzy Cat# 214510) containing carbenicillin.
- pStX34 includes an EF-la promoter for the protein as well as a selection marker for both puromycin and carbenicillin. Sequences encoding the targeting sequences that target the gene of interest were designed based on CasX PAM locations. Targeting sequence DNA was ordered as single-stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting sequence and the reverse complement of this sequence.
- ssDNA single-stranded DNA
- SaCas9 and SpyCas9 control plasmids were prepared similarly to pStX plasmids described above, with the protein and guide regions of pStX exchanged for the respective protein and guide.
- Targeting sequences for SaCas9 and SpyCas9 were either obtained from the literature or were rationally designed according to established methods.
- the expression and recovery of the CasX 119 and 457 proteins was performed using the general methodologies of Example 1 (however the DNA sequences were codon optimized for expression in E. coli). The results of analytical assays for CasX 119 are shown in FIGS. 6-8.
- FIG. 6 shows an SDS-PAGE gel of purification samples, visualized on a Bio-Rad Stain-FreeTM gel, as described.
- the lanes, from left to right, are: Pellet: insoluble portion following cell lysis, Lysate: soluble portion following cell lysis, Flow Thru: protein that did not bind the Heparin column, Wash: protein that eluted from the column in wash buffer, Elution: protein eluted from the heparin column with elution buffer, Flow Thru: Protein that did not bind the StrepTactinXT column, Elution: protein eluted from the StrepTactin XT column with elution buffer, Injection: concentrated protein injected onto the s200 gel filtration column, Frozen: pooled fractions from the s200 elution that have been concentrated and frozen. [0537] FIG.
- FIG. 7 shows the chromatogram of Superdex 200 16/600 pg Gel Filtration, as described.
- Gel filtration run of CasX variant 119 protein plotted as 280 nm absorbance against elution volume.
- the 65.77 mL peak corresponds to the apparent molecular weight of CasX variant 119 and contained the majority of CasX variant 119 protein.
- FIG. 8 shows an SDS- PAGE gel of gel filtration samples, stained with colloidal Coomassie, as described. Samples from the indicated fractions were resolved by SDS-PAGE and stained with colloidal Coomassie. From right to left, Injection: sample of protein injected onto the gel filtration column, molecular weight markers, lanes 3 -10: samples from the indicated elution volumes.
- the codon- optimized CasX 119 construct (based on the CasX Stx2 construct of Example 1, encoding Planctomycetes CasX SEQ ID NO:2, with a A708K substitution, a L379R substitution, and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) was cloned into a mammalian expression plasmid (pStX; see FIG. 4) using standard cloning methods.
- CasX 1 (based on the CasX Stxl construct of Example 1, encoding CasX SEQ ID NO: 1) was cloned into a destination vector using standard cloning methods.
- the CasX 119 construct DNA was PCR amplified using Q5 DNA polymerase using primers oIC765 and oIC762 (see FIG. 5).
- the CasX 1 construct was PCR amplified using Q5 DNA polymerase using primers oIC766 and oIC784.
- the PCR products were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit . The two fragments were then pieced together using Gibson assembly.
- Assembled products in pStxl were transformed into chemically-competent Turbo Competent A. coli bacterial cells, plated on LB-Agar plates containing kanamycin. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. The correct clones were then subcloned into the mammalian expression vector pStx34 using restriction enzyme cloning. The pStx34 backbone and the CasX 488 clone in pStxl were digested with Xbal and BamHI respectively.
- the digested backbone and insert fragments were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit .
- the clean backbone and insert were then ligated together using T4 Ligase (New England Biolabs Cat# M0202L) according to the manufacturer’s protocol.
- the ligated product was transformed into chemically-competent Turbo Competent A. coli bacterial cells, plated on LB- Agar plates containing carbenicillin. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit.
- the resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly.
- the CasX 484 construct DNA was PCR amplified using Q5 DNA polymerase using primers oIC765 and oIC762 (see FIG. 5).
- the CasX 1 construct was PCR amplified using Q5 DNA polymerase using primers oIC766 and oIC784.
- the PCR products were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit . The two fragments were then pieced together using Gibson assembly. Assembled products in pStxl were transformed into chemically-competent Turbo Competent A coli bacterial cells, plated on LB-Agar plates containing kanamycin.
- pStX34 includes an EF-la promoter for the protein as well as a selection marker for both puromycin and carbenicillin. Sequences encoding the targeting sequences that target the gene of interest were designed based on CasX PAM locations.
- Targeting sequence DNA was ordered as single-stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting sequence and the reverse complement of this sequence. These two oligos were annealed together and cloned into pStX individually or in bulk by Golden Gate assembly using T4 DNA Ligase and an appropriate restriction enzyme for the plasmid. Golden Gate products were transformed into chemically or electro-competent cells such as NEB Turbo competent A. coli , plated on LB-Agar plates containing carbenicillin. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct ligation.
- ssDNA single-stranded DNA
- SaCas9 and SpyCas9 control plasmids were prepared similarly to pStX plasmids described above, with the protein and guide regions of pStX exchanged for the respective protein and guide.
- Targeting sequences for SaCas9 and SpyCas9 were either obtained from the literature or were rationally designed according to established methods. The expression and recovery of the CasX constructs was performed using the general methodologies of Example 1 and Example 2, with similar results obtained.
- the N- and C-termini of the codon-optimized CasX 119 construct (based on the CasX Stx37 construct of Example 2, encoding Planctomycetes CasX SEQ ID NO:2, with a A708K substitution and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) in a mammalian expression vector were manipulated to delete or add NLS sequences (sequences in Table 9).
- Constructs 278, 279, and 280 were manipulations of the N- and C-termini using only an SV40 NLS sequence.
- Construct 280 had no NLS on the N-terminus and added two SV40 NLS’ on the C-terminus with a triple proline linker in between the two SV40 NLS sequences.
- Constructs 278, 279, and 280 were made by amplifying pStx34.119.174.NT with Q5 DNA polymerase using primers oIC527 and oIC528, oIC730 and oIC522, and oIC730 and oIC530 for the first fragments each and using oIC529 and oIC520, oIC519 and oIC731, and oIC529 and oIC731 to create the second fragments each.
- fragments were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit. The respective fragments were cloned together using Gibson assembly. Assembled products in the pStx34 were transformed into chemically-competent Turbo Competent E. coli bacterial cells, plated on LB-Agar plates containing carbenicillin and incubated at 37oC. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Sequences encoding the targeting sequences that target the gene of interest were designed based on CasX PAM locations.
- Targeting sequence DNA was ordered as single- stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting sequence and the reverse complement of this sequence. These two oligos were annealed together and cloned into pStX individually or in bulk by Golden Gate assembly using T4 DNA Ligase and an appropriate restriction enzyme for the plasmid. Golden Gate products were transformed into chemically- or electro-competent cells such as NEB Turbo competent E. coli, plated on LB- Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct ligation.
- ssDNA single- stranded DNA
- constructs 285-288, 290, 291, 293, and 300 were used for cloning.
- the backbone vector and PCR template used was construct pStx34 279.119.174.NT, having the CasX 119, guide 174, and non-targeting spacer.
- Construct 278 has the configuration SV40NLS-CasXl 19.
- Construct 279 has the configuration CasXl 19- SV40NLS.
- Construct 280 has the configuration CasXl 19-SV40NLS-PPP linker-SV40NLS.
- Construct 285 has the configuration CasXl 19-SV40NLS-PPP linker-SynthNLS3.
- Construct 286 has the configuration CasXl 19-SV40NLS-PPP linker-SynthNLS4.
- Construct 287 has the configuration CasXl 19-SV40NLS-PPP linker-SynthNLS5.
- Construct 288 has the configuration CasXl 19-SV40NLS-PPP linker-SynthNLS6.
- Constrict 290 has the configuration CasXl 19- SV40NLS-PPP linker-EGL-13 NLS.
- Construct 291 has the configuration CasXl 19-SV40NLS- PPP linker-c-Myc NLS.
- Construct 293 has the configuration CasXl 19-SV40NLS-PPP linker- Nucleolar RNA Helicase II NLS.
- Construct 300 has the configuration CasXl 19-SV40NLS-PPP linker-influenza A protein NLS.
- Construct 492 has the configuration SV40NLS-CasXl 19- SV40NLS-PPP linker-SV40NLS.
- Construct 493 has the configuration SV40NLS-CasXl 19- SV40NLS-PPP linker-c-Myc NLS.
- Each variant had a set of three PCRs; two of which were nested, were purified by gel extraction, digested, and then ligated into the digested and purified backbone. Assembled products in the pStx34 were transformed into chemically-competent Turbo Competent E.
- coli bacterial cells plated on LB-Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Sequences encoding the targeting sequences that target the gene of interest were designed based on CasX PAM locations. Targeting sequence DNA was ordered as single- stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting sequence and the reverse complement of this sequence.
- ssDNA single- stranded DNA
- Golden Gate products were transformed into chemically- or electro-competent cells such as NEB Turbo competent E. coli, plated on LB-Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct ligation.
- constructs 280 and 291 were digested using Xbal and BamHI (NEB# R0145S and NEB# R3136S) according to the manufacturer’s protocol. Next, they were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit. Finally, they were ligated using T4 DNA ligase (NEB# M0202S) according to the manufacturer’s protocol into the digested and purified pStx34.119.174.NT using Xbal and BamHI and Zymoclean Gel DNA Recovery Kit. Assembled products in the pStx34 were transformed into chemically-competent Turbo Competent E.
- coli bacterial cells plated on LB- Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Sequences encoding the targeting spacer sequences that target the gene of interest were designed based on CasX PAM locations.
- Targeting sequence DNA was ordered as single-stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting spacer sequence and the reverse complement of this sequence. These two oligos were annealed together and cloned into each pStX individually or in bulk by Golden Gate assembly using T4 DNA Ligase and an appropriate restriction enzyme for the respective plasmids.
- Golden Gate products were transformed into chemically- or electro- competent cells such as NEB Turbo competent E. coli plated on LB-Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct ligation. The plasmids were used to produce and recover CasX protein utilizing the general methodologies of Examples 1 and 2.
- Example 5 Design and Generation of CasX Constructs 387, 395, 485-491, and 494 [0543]
- CasX 485, CasX 486, CasX 487, the codon optimized CasX 119 (based on the CasX 37 construct of Example 2, encoding Planctomycetes CasX SEQ ID NO: 2, with a A708K substitution and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences), CasX 435, CasX 438, and CasX 484 (each based on CasX 119 construct of Example 2 encoding Planctomycetes CasX SEQ ID NO: 2, with a L379R substitution, a A708K substitution, and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) were cloned respectively into a 4kb staging vector comprising a KanR marker, colEl ori, and CasX
- Gibson primers were designed to amplify the CasX SEQ ID NO: 1 Helical I domain from amino acid 192-331 in its own vector to replace this corresponding region (aa 193-332) on CasX 119, CasX 435, CasX 438, and CasX 484 in pStxl respectively.
- the Helical I domain from CasX SEQ ID NO: 1 was amplified with primers oIC768 and oIC784 using Q5 DNA polymerase according to the manufacturer’s protocol.
- the destination vector containing the desired CasX variant was amplified with primers oIC765 and oIC764 using Q5 DNA polymerase according to the manufacturer’s protocol.
- the two fragments were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit.
- the insert and backbone fragments were then pieced together using Gibson assembly.
- Assembled products in the pStxl staging vector were transformed into chemically-competent Turbo Competent A. coli bacterial cells, plated on LB- Agar plates containing kanamycin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit.
- the resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Correct clones were then cut and pasted into a mammalian expression plasmid (see FIG. 5) using standard cloning methods.
- the resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Sequences encoding the targeting spacer sequences that target the gene of interest were designed based on CasX PAM locations. Targeting spacer sequence DNA was ordered as single-stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting sequence and the reverse complement of this sequence. These two oligos were annealed together and cloned into pStX individually or in bulk by Golden Gate assembly using T4 DNA Ligase and an appropriate restriction enzyme for the plasmid. Golden Gate products were transformed into chemically or electro-competent cells such as NEB Turbo competent A. coli plated on LB-Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct ligation.
- ssDNA single-stranded DNA
- the codon optimized CasX 119 (based on the CasX 37 construct of Example 2, encoding Planctomycetes CasX SEQ ID NO: 2, with a A708K substitution and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences), CasX 435, CasX 438, and CasX 484 (each based on CasXl 19 construct of Example 2 encoding Planctomycetes CasX SEQ ID NO: 2, with a L379R substitution, a A708K substitution, and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) were cloned respectively into a 4kb staging vector that was made up of a KanR marker, colEl ori, and STX with fused NLS (pStxl) using
- Gibson primers were designed to amplify the CasX Stxl NTSB domain from amino acid 101-191 and Helical I domain from amino acid 192-331 in its own vector to replace this similar region (aa 103-332) on CasX 119, CasX 435, CasX 438, and CasX 484 in pStxl respectively.
- the NTSB and Helical I domain from CasX SEQ ID NO: 1 were amplified with primers oIC766 and oIC784 using Q5 DNA polymerase according to the manufacturer’s protocol.
- the destination vector containing the desired CasX variant was amplified with primers oIC762 and oIC765 using Q5 DNA polymerase according to the manufacturer’s protocol.
- the two fragments were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit.
- the insert and backbone fragments were then pieced together using Gibson assembly.
- Assembled products in the pStxl staging vector were transformed into chemically-competent Turbo Competent A. coli bacterial cells, plated on LB- Agar plates containing kanamycin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit.
- the resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Correct clones were then cut and pasted into a mammalian expression plasmid (see FIG. 5) using standard cloning methods.
- the resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Sequences encoding the targeting spacer sequences that target the gene of interest were designed based on CasX PAM locations. Targeting spacer sequence DNA was ordered as single-stranded DNA (ssDNA) oligos (Integrated DNA Technologies) consisting of the targeting sequence and the reverse complement of this sequence. These two oligos were annealed together and cloned into pStX individually or in bulk by Golden Gate assembly using T4 DNA Ligase and an appropriate restriction enzyme for the plasmid. Golden Gate products were transformed into chemically or electro-competent cells such as NEB Turbo competent A. coli plated on LB-Agar plates containing carbenicillin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct ligation.
- ssDNA single-stranded DNA
- the codon optimized CasX 119 (based on the CasX 37 construct of Example 2, encoding Planctomycetes CasX SEQ ID NO:2, with a A708K substitution and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) and CasX 484 (based on CasXl 19 construct of Example 2 encoding Planctomycetes CasX SEQ ID NO: 2, with a L379R substitution, a A708K substitution, and a [P793] deletion with fused NLS, and linked guide and non-targeting sequences) were cloned respectively into a 4kb staging vector that was made up of a KanR marker, colEl ori, and STX with fused NLS (pStxl) using standard cloning methods.
- Gibson primers were designed to amplify the CasX Stxl NTSB domain from amino acid 101-191 in its own vector to replace this similar region (aa 103-192) on CasX 119 and CasX 484 in pStxl respectively.
- the NTSB domain from CasX Stxl was amplified with primers oIC766 and oIC767 using Q5 DNA polymerase according to the manufacturer’s protocol.
- the destination vector containing the desired CasX variant was amplified with primers oIC763 and oIC762 using Q5 DNA polymerase according to the manufacturer’s protocol.
- the two fragments were purified by gel extraction from a 1% agarose gel using Zymoclean Gel DNA Recovery Kit.
- the insert and backbone fragments were then pieced together using Gibson assembly. Assembled products in the pStxl staging vector were transformed into chemically-competent Turbo Competent A. coli bacterial cells, plated on LB-Agar plates containing kanamycin and incubated at 37°C. Individual colonies were picked and miniprepped using Qiagen Qiaprep spin Miniprep Kit. The resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly. Correct clones were then cut and pasted into a mammalian expression plasmid (see FIG. 5) using standard cloning methods. The resultant plasmids were sequenced using Sanger sequencing to ensure correct assembly.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202180034169.7A CN116096885A (zh) | 2020-03-18 | 2021-03-17 | 用于靶向C9orf72的组合物和方法 |
| IL296477A IL296477A (en) | 2020-03-18 | 2021-03-17 | Compositions and methods for the targeting of c9orf72 |
| AU2021237633A AU2021237633A1 (en) | 2020-03-18 | 2021-03-17 | Compositions and methods for the targeting of C9orf72 |
| MX2022011460A MX2022011460A (es) | 2020-03-18 | 2021-03-17 | Composiciones y métodos para el direccionamiento de c9orf72. |
| JP2022556229A JP7847853B2 (ja) | 2020-03-18 | 2021-03-17 | C9orf72の標的化のための組成物及び方法 |
| EP21718316.9A EP4121535A1 (en) | 2020-03-18 | 2021-03-17 | Compositions and methods for the targeting of c9orf72 |
| CA3172178A CA3172178A1 (en) | 2020-03-18 | 2021-03-17 | Compositions and methods for the targeting of c9orf72 |
| KR1020227035510A KR20230002401A (ko) | 2020-03-18 | 2021-03-17 | C9orf72의 표적화를 위한 조성물 및 방법 |
| BR112022018673A BR112022018673A2 (pt) | 2020-03-18 | 2021-03-17 | Composições e métodos para o direcionamento de c9orf72 |
| US17/932,798 US20240309344A1 (en) | 2020-03-18 | 2022-09-16 | COMPOSITIONS AND METHODS FOR THE TARGETING OF C9orf72 |
| CONC2022/0014598A CO2022014598A2 (es) | 2020-03-18 | 2022-10-14 | Composiciones y métodos para el direccionamiento de c9orf72 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062991403P | 2020-03-18 | 2020-03-18 | |
| US62/991,403 | 2020-03-18 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/932,798 Continuation US20240309344A1 (en) | 2020-03-18 | 2022-09-16 | COMPOSITIONS AND METHODS FOR THE TARGETING OF C9orf72 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021188729A1 true WO2021188729A1 (en) | 2021-09-23 |
Family
ID=75478206
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/022840 Ceased WO2021188729A1 (en) | 2020-03-18 | 2021-03-17 | Compositions and methods for the targeting of c9orf72 |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US20240309344A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4121535A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP7847853B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20230002401A (cg-RX-API-DMAC7.html) |
| CN (1) | CN116096885A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2021237633A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022018673A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3172178A1 (cg-RX-API-DMAC7.html) |
| CO (1) | CO2022014598A2 (cg-RX-API-DMAC7.html) |
| IL (1) | IL296477A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2022011460A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021188729A1 (cg-RX-API-DMAC7.html) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022120095A1 (en) * | 2020-12-03 | 2022-06-09 | Scribe Therapeutics Inc. | Engineered class 2 type v crispr systems |
| US11560555B2 (en) | 2019-06-07 | 2023-01-24 | Scribe Therapeutics Inc. | Engineered proteins |
| WO2023086389A1 (en) * | 2021-11-09 | 2023-05-19 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of amyotrophic lateral sclerosis |
| WO2023077095A3 (en) * | 2021-10-29 | 2023-07-27 | Mammoth Biosciences, Inc. | Effector proteins, compositions, systems, devices, kits and methods of use thereof |
| WO2023240162A1 (en) * | 2022-06-08 | 2023-12-14 | Scribe Therapeutics Inc. | Aav vectors for gene editing |
| WO2023240074A1 (en) | 2022-06-07 | 2023-12-14 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of pcsk9 |
| WO2023240076A1 (en) | 2022-06-07 | 2023-12-14 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of pcsk9 |
| WO2023235725A3 (en) * | 2022-05-31 | 2024-01-18 | Regeneron Pharmaceuticals, Inc. | Crispr-based therapeutics for c9orf72 repeat expansion disease |
| WO2023240157A3 (en) * | 2022-06-08 | 2024-01-18 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of dmd |
| US11976277B2 (en) | 2021-06-09 | 2024-05-07 | Scribe Therapeutics Inc. | Particle delivery systems |
| WO2024192291A1 (en) | 2023-03-15 | 2024-09-19 | Renagade Therapeutics Management Inc. | Delivery of gene editing systems and methods of use thereof |
| WO2024173479A3 (en) * | 2023-02-15 | 2024-10-24 | The Trustees Of Columbia University In The City Of New York | Compositions and methods for treating motor neuron diseases |
| US12171813B2 (en) | 2021-02-05 | 2024-12-24 | Christiana Care Gene Editing Institute, Inc. | Methods of and compositions for reducing gene expression and/or activity |
| WO2025024285A1 (en) * | 2023-07-21 | 2025-01-30 | Mammoth Biosciences, Inc. | Compositions for the modification of the human c9orf72 gene |
| WO2025049959A2 (en) | 2023-09-01 | 2025-03-06 | Renagade Therapeutics Management Inc. | Gene editing systems, compositions, and methods for treatment of vexas syndrome |
| WO2025174765A1 (en) | 2024-02-12 | 2025-08-21 | Renagade Therapeutics Management Inc. | Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents |
Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| US5405783A (en) | 1989-06-07 | 1995-04-11 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of an array of polymers |
| US5412087A (en) | 1992-04-24 | 1995-05-02 | Affymax Technologies N.V. | Spatially-addressable immobilization of oligonucleotides and other biological polymers on surfaces |
| US5695937A (en) | 1995-09-12 | 1997-12-09 | The Johns Hopkins University School Of Medicine | Method for serial analysis of gene expression |
| WO2010075303A1 (en) | 2008-12-23 | 2010-07-01 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Splicing factors with a puf protein rna-binding domain and a splicing effector domain and uses of same |
| WO2012068627A1 (en) | 2010-11-24 | 2012-05-31 | The University Of Western Australia | Peptides for the specific binding of rna targets |
| WO2017109757A1 (en) * | 2015-12-23 | 2017-06-29 | Crispr Therapeutics Ag | Materials and methods for treatment of amyotrophic lateral sclerosis and/or frontal temporal lobular degeneration |
| WO2018064371A1 (en) * | 2016-09-30 | 2018-04-05 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| US20180258424A1 (en) | 2015-11-11 | 2018-09-13 | Coda Biotherapeutics, Inc. | Crispr compositions and methods of using the same for gene therapy |
| WO2018195555A1 (en) | 2017-04-21 | 2018-10-25 | The Board Of Trustees Of The Leland Stanford Junior University | Crispr/cas 9-mediated integration of polynucleotides by sequential homologous recombination of aav donor vectors |
| WO2018208972A1 (en) * | 2017-05-09 | 2018-11-15 | University Of Massachusetts | Methods of treating amyotrophic lateral sclerosis (als) |
| WO2019030306A1 (en) * | 2017-08-08 | 2019-02-14 | Depixus | ISOLATION AND IN VITRO ENRICHMENT OF NUCLEIC ACIDS USING SITE-SPECIFIC NUCLEASES |
| WO2019084148A1 (en) * | 2017-10-25 | 2019-05-02 | Monsanto Technology Llc | TARGETED RNA GUIDED ENDONUCLEASE ENDONUCLEASE ACTIVITY IN EUKARYOTES |
| WO2020247882A1 (en) | 2019-06-07 | 2020-12-10 | Scribe Therapeutics Inc. | Engineered casx systems |
-
2021
- 2021-03-17 AU AU2021237633A patent/AU2021237633A1/en active Pending
- 2021-03-17 CN CN202180034169.7A patent/CN116096885A/zh active Pending
- 2021-03-17 JP JP2022556229A patent/JP7847853B2/ja active Active
- 2021-03-17 BR BR112022018673A patent/BR112022018673A2/pt unknown
- 2021-03-17 KR KR1020227035510A patent/KR20230002401A/ko active Pending
- 2021-03-17 IL IL296477A patent/IL296477A/en unknown
- 2021-03-17 MX MX2022011460A patent/MX2022011460A/es unknown
- 2021-03-17 WO PCT/US2021/022840 patent/WO2021188729A1/en not_active Ceased
- 2021-03-17 CA CA3172178A patent/CA3172178A1/en active Pending
- 2021-03-17 EP EP21718316.9A patent/EP4121535A1/en active Pending
-
2022
- 2022-09-16 US US17/932,798 patent/US20240309344A1/en active Pending
- 2022-10-14 CO CONC2022/0014598A patent/CO2022014598A2/es unknown
Patent Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5405783A (en) | 1989-06-07 | 1995-04-11 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of an array of polymers |
| US5445934A (en) | 1989-06-07 | 1995-08-29 | Affymax Technologies N.V. | Array of oligonucleotides on a solid substrate |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| US5412087A (en) | 1992-04-24 | 1995-05-02 | Affymax Technologies N.V. | Spatially-addressable immobilization of oligonucleotides and other biological polymers on surfaces |
| US5695937A (en) | 1995-09-12 | 1997-12-09 | The Johns Hopkins University School Of Medicine | Method for serial analysis of gene expression |
| WO2010075303A1 (en) | 2008-12-23 | 2010-07-01 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Splicing factors with a puf protein rna-binding domain and a splicing effector domain and uses of same |
| WO2012068627A1 (en) | 2010-11-24 | 2012-05-31 | The University Of Western Australia | Peptides for the specific binding of rna targets |
| US20180258424A1 (en) | 2015-11-11 | 2018-09-13 | Coda Biotherapeutics, Inc. | Crispr compositions and methods of using the same for gene therapy |
| WO2017109757A1 (en) * | 2015-12-23 | 2017-06-29 | Crispr Therapeutics Ag | Materials and methods for treatment of amyotrophic lateral sclerosis and/or frontal temporal lobular degeneration |
| WO2018064371A1 (en) * | 2016-09-30 | 2018-04-05 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| WO2018195555A1 (en) | 2017-04-21 | 2018-10-25 | The Board Of Trustees Of The Leland Stanford Junior University | Crispr/cas 9-mediated integration of polynucleotides by sequential homologous recombination of aav donor vectors |
| WO2018208972A1 (en) * | 2017-05-09 | 2018-11-15 | University Of Massachusetts | Methods of treating amyotrophic lateral sclerosis (als) |
| WO2019030306A1 (en) * | 2017-08-08 | 2019-02-14 | Depixus | ISOLATION AND IN VITRO ENRICHMENT OF NUCLEIC ACIDS USING SITE-SPECIFIC NUCLEASES |
| WO2019084148A1 (en) * | 2017-10-25 | 2019-05-02 | Monsanto Technology Llc | TARGETED RNA GUIDED ENDONUCLEASE ENDONUCLEASE ACTIVITY IN EUKARYOTES |
| WO2020247882A1 (en) | 2019-06-07 | 2020-12-10 | Scribe Therapeutics Inc. | Engineered casx systems |
Non-Patent Citations (39)
| Title |
|---|
| "Immunology Methods Manual", 1997, ACADEMIC PRESS |
| "NCBI", Database accession no. NC_000009.12 |
| AGUILERA ET AL., INTEGR BIOL (CAMB) JUNE, vol. 1, no. 5-6, 2009, pages 371 - 381 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| AUSUBEL ET AL.: "Short Protocols in Molecular Biology", 1995, ACADEMIC PRESS |
| BALENDRA RISAACS AM: "C9 rf72-mediated ALS and FTD: multiple pathways to disease", NAT REV NEUROL, vol. 14, 2018, pages 544, XP036579395, DOI: 10.1038/s41582-018-0047-2 |
| BERNS, K. I.: "Parvoviridae and their Replication", FUNDAMENTAL VIROLOGY |
| BOLLAG ET AL.: "Protein Methods", 1996, JOHN WILEY & SONS |
| CHEN ET AL., PHARM RES, vol. 20, 2003, pages 1952 - 60 |
| DEJESUS-HERNANDEZ, M ET AL.: "Expanded GGGGCC hexanucleotide repeat in noncoding region of C90RF72 causes chromosome 9p-linked FTD and ALS", NEURON, vol. 72, 2011, pages 245, XP028322560, DOI: 10.1016/j.neuron.2011.09.011 |
| DOYLEGRIFFITHS: "Cell and Tissue Culture: Laboratory Procedures in Biotechnology", 1998, JOHN WILEY & SONS |
| GHIRLANDO ET AL., IMMUNOL LETT, vol. 68, 1999, pages 47 - 52 |
| GIESSELMANN PAY ET AL: "Analysis of short tandem repeat expansions and their methylation state with nanopore sequencing", NATURE BIOTECHNOLOGY, GALE GROUP INC, NEW YORK, vol. 37, no. 12, 18 November 2019 (2019-11-18), pages 1478 - 1481, XP036954224, ISSN: 1087-0156, [retrieved on 20191118], DOI: 10.1038/S41587-019-0293-X * |
| GIESSELMANN PAY ET AL: "Supportive Information - Analysis of short tandem repeat expansions and their methylation state with nanopore sequencing", NATURE BIOTECHNOLOGY, vol. 37, no. 12, 18 November 2019 (2019-11-18), New York, pages 1478 - 1481, XP055812570, ISSN: 1087-0156, DOI: 10.1038/s41587-019-0293-x * |
| GRAFF-RADFORD, NWOODRUFF, B: "Frontotemporal dementia", SEMIN. NEUROL., vol. 27, no. 1, 2007, pages 48 |
| GREG T. HERMANSON: "Bioconjugate Techniques", 2013, ESLSEVIER SCIENCE |
| HAO, Z. ET AL.: "Motor dysfunction and neurodegeneration in a C9orf72 mouse line expressing poly-PR", NAT. COMMUN., vol. 10, 2019, pages 2906 |
| HERMONATMUZYCZKA, PNAS, vol. 81, 1984, pages 6466 - 6470 |
| HIRTZ ET AL., NEUROLOGY, vol. 68, 2007, pages 326 - 337 |
| IYER ET AL.: "C9Orf72, a protein associated with amyotrophic lateral sclerosis (ALS) is a guanine nucleotide exchange factor", PEERJ, vol. 6, 2018, pages e5815 |
| JIANG, J. ET AL.: "Gain of Toxicity from ALS/FTD-Linked Repeat Expansions in C90RF72 Is Alleviated by Antisense Oligonucleotides Targeting GGGGCC-Containing RNAs", NEURON, vol. 90, 2016, pages 535, XP029531466, DOI: 10.1016/j.neuron.2016.04.006 |
| KOTIN, R. M., HUMAN GENE THERAPY, vol. 5, 1994, pages 793 - 801 |
| KUNKEL, GR ET AL.: "U6 small nuclear RNA is transcribed by RNA polymerase ΠI.", PROC NATL ACAD SCI USA., vol. 83, no. 22, 1986, pages 8575 |
| LIU JUN-JIE ET AL: "CasX enzymes comprise a distinct family of RNA-guided genome editors", NATURE, MACMILLAN JOURNALS LTD., ETC, LONDON, vol. 566, no. 7743, 4 February 2019 (2019-02-04), pages 218 - 223, XP036746431, ISSN: 0028-0836, [retrieved on 20190204], DOI: 10.1038/S41586-019-0908-X * |
| MORI K. ET AL.: "The C9orj72 GGGGCC repeat is translated into aggregating dipeptide-repeat proteins in FTLD/ALS", SCIENCE, vol. 339, 2013, pages 1335, XP055283697, DOI: 10.1126/science.1232927 |
| MURRAY ET AL., J. CHROMATOGR SCI, vol. 40, 2002, pages 343 - 9 |
| NIBLOCK, M. ET AL.: "Retention of hexanucleotide repeat-containing intron in C9orf72 mRNA: implications for the pathogenesis of ALS/FTD", ACTA NEUROPATHOLOGICA COMMUNICATIONS, vol. 4, 2016, pages 18, XP055702947, DOI: 10.1186/s40478-016-0289-4 |
| NOGUCHI ET AL., DIABETES, vol. 52, no. 7, 2003, pages 1732 - 1737 |
| O'ROURKE ET AL.: "C9orj72 BAC transgenic mice display typical pathologic features of ALS/FTD", NEURON, vol. 88, 2015, pages 892, XP055429746, DOI: 10.1016/j.neuron.2015.10.027 |
| ROWLAND AND SHNEIDER, N. ENGL. J. MED., vol. 344, 2001, pages 1688 - 1700 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, HARBOR LABORATORY PRESS |
| SAMULSKI ET AL., J. VIROL., vol. 63, 1989, pages 03822 - 3828 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 - 489 |
| TRATSCHIN ET AL., MOL. CELL. BIOL., vol. 4, 1984, pages 2072 - 2081 |
| TRATSCHIN ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 3251 - 3260 |
| TREHIN ET AL., PHARM. RESEARCH, vol. 21, 2004, pages 1248 - 1256 |
| WENDER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 13003 - 13008 |
| ZENDER ET AL., CANCER GENE THER., vol. 9, no. 6, 2002, pages 489 - 96 |
| ZHANGMADDEN, GENOME RES., vol. 7, 1997, pages 649 - 656 |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12084692B2 (en) | 2019-06-07 | 2024-09-10 | Scribe Therapeutics Inc. | Guide scaffolds |
| US11560555B2 (en) | 2019-06-07 | 2023-01-24 | Scribe Therapeutics Inc. | Engineered proteins |
| GB2616584A (en) * | 2020-12-03 | 2023-09-13 | Scribe Therapeutics Inc | Engineered class 2 type V CRISPR systems |
| US12559743B2 (en) | 2020-12-03 | 2026-02-24 | Scribe Therapeutics Inc. | Engineered guide scaffolds |
| WO2022120095A1 (en) * | 2020-12-03 | 2022-06-09 | Scribe Therapeutics Inc. | Engineered class 2 type v crispr systems |
| AU2021392719B2 (en) * | 2020-12-03 | 2025-08-14 | Scribe Therapeutics Inc. | Engineered class 2 type v crispr systems |
| US12163125B2 (en) | 2020-12-03 | 2024-12-10 | Scribe Therapeutics Inc. | Engineered class 2 type V CRISPR systems |
| US12171813B2 (en) | 2021-02-05 | 2024-12-24 | Christiana Care Gene Editing Institute, Inc. | Methods of and compositions for reducing gene expression and/or activity |
| US11976277B2 (en) | 2021-06-09 | 2024-05-07 | Scribe Therapeutics Inc. | Particle delivery systems |
| WO2023077095A3 (en) * | 2021-10-29 | 2023-07-27 | Mammoth Biosciences, Inc. | Effector proteins, compositions, systems, devices, kits and methods of use thereof |
| WO2023086389A1 (en) * | 2021-11-09 | 2023-05-19 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of amyotrophic lateral sclerosis |
| WO2023235725A3 (en) * | 2022-05-31 | 2024-01-18 | Regeneron Pharmaceuticals, Inc. | Crispr-based therapeutics for c9orf72 repeat expansion disease |
| WO2023240074A1 (en) | 2022-06-07 | 2023-12-14 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of pcsk9 |
| EP4314267A1 (en) * | 2022-06-07 | 2024-02-07 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of pcsk9 |
| WO2023240076A1 (en) | 2022-06-07 | 2023-12-14 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of pcsk9 |
| US12551573B2 (en) | 2022-06-07 | 2026-02-17 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of PCSK9 |
| US12594349B2 (en) | 2022-06-07 | 2026-04-07 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of PCSK9 |
| WO2023240157A3 (en) * | 2022-06-08 | 2024-01-18 | Scribe Therapeutics Inc. | Compositions and methods for the targeting of dmd |
| WO2023240162A1 (en) * | 2022-06-08 | 2023-12-14 | Scribe Therapeutics Inc. | Aav vectors for gene editing |
| WO2024173479A3 (en) * | 2023-02-15 | 2024-10-24 | The Trustees Of Columbia University In The City Of New York | Compositions and methods for treating motor neuron diseases |
| WO2024192291A1 (en) | 2023-03-15 | 2024-09-19 | Renagade Therapeutics Management Inc. | Delivery of gene editing systems and methods of use thereof |
| WO2025024285A1 (en) * | 2023-07-21 | 2025-01-30 | Mammoth Biosciences, Inc. | Compositions for the modification of the human c9orf72 gene |
| WO2025049959A2 (en) | 2023-09-01 | 2025-03-06 | Renagade Therapeutics Management Inc. | Gene editing systems, compositions, and methods for treatment of vexas syndrome |
| WO2025174765A1 (en) | 2024-02-12 | 2025-08-21 | Renagade Therapeutics Management Inc. | Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20230002401A (ko) | 2023-01-05 |
| JP2023518541A (ja) | 2023-05-02 |
| CN116096885A (zh) | 2023-05-09 |
| BR112022018673A2 (pt) | 2022-12-27 |
| MX2022011460A (es) | 2022-12-15 |
| AU2021237633A1 (en) | 2022-10-06 |
| US20240309344A1 (en) | 2024-09-19 |
| JP7847853B2 (ja) | 2026-04-20 |
| CO2022014598A2 (es) | 2022-10-31 |
| IL296477A (en) | 2022-11-01 |
| CA3172178A1 (en) | 2021-09-23 |
| EP4121535A1 (en) | 2023-01-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240309344A1 (en) | COMPOSITIONS AND METHODS FOR THE TARGETING OF C9orf72 | |
| US11613742B2 (en) | Compositions and methods for the targeting of SOD1 | |
| US20230032369A1 (en) | Compositions and methods for the targeting of htt | |
| US12559743B2 (en) | Engineered guide scaffolds | |
| US11535835B1 (en) | Compositions and methods for the targeting of rhodopsin | |
| US20230167424A1 (en) | Compositions and methods for the targeting of pcsk9 | |
| CA3142883A1 (en) | Engineered casx systems | |
| US20240026386A1 (en) | Compositions and methods for the targeting of bcl11a | |
| US20240100185A1 (en) | Compositions and methods for the targeting of ptbp1 | |
| HK40094068A (zh) | 用於靶向c9orf72的组合物和方法 | |
| IL303360A (en) | Engineered class 2 type v crispr systems | |
| HK40076804A (en) | Compositions and methods for the targeting of pcsk9 | |
| HK40091632A (zh) | 用於靶向bcl11a的组合物和方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21718316 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2022556229 Country of ref document: JP Kind code of ref document: A Ref document number: 3172178 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022018673 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2021237633 Country of ref document: AU Date of ref document: 20210317 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2022/0014598 Country of ref document: CO |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021718316 Country of ref document: EP Effective date: 20221018 |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2022/0014598 Country of ref document: CO |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022018673 Country of ref document: BR Free format text: FAVOR EFETUAR, EM ATE 60 (SESSENTA) DIAS, O PAGAMENTO DE GRU CODIGO DE SERVICO 260 PARA A REGULARIZACAO DO PEDIDO, CONFORME ART 2O 1O DA RESOLUCAO 189/2017 E NOTA DE ESCLARECIMENTO PUBLICADA NA RPI 2421 DE 30/05/2017, UMA VEZ QUE A PETICAO NO 870220107141 DE 18/11/2022 APRESENTA DOCUMENTOS REFERENTES A DOIS SERVICOS DIVERSOS (COMPLEMENTACAO E MODIFICACAO DO PEDIDO) TENDO SIDO PAGA SOMENTE UMA RETRIBUICAO. DEVERA SER PAGA MAIS 1 (UMA) GRU CODIGO DE SERVICO 260 E A GRU CODIGO DE SERVICO 207 REFERENTE A RESPOSTA DESTA EXIGENCIA. |
|
| ENP | Entry into the national phase |
Ref document number: 112022018673 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220916 |