WO2021188590A2 - T-cell bispecific binding proteins - Google Patents
T-cell bispecific binding proteins Download PDFInfo
- Publication number
- WO2021188590A2 WO2021188590A2 PCT/US2021/022626 US2021022626W WO2021188590A2 WO 2021188590 A2 WO2021188590 A2 WO 2021188590A2 US 2021022626 W US2021022626 W US 2021022626W WO 2021188590 A2 WO2021188590 A2 WO 2021188590A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- bispecific
- amino acid
- binding
- seq
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention relates to the use of T-cell bispecific binding proteins, such as anti-CD3 bispecific antibodies, to mediate immune-driven depletion of target cells, including antigens expressed on HSC cells.
- the invention further relates to anti-CD117 bispecific binding proteins or fragments thereof compositions and uses thereof, comprising a first binding domain which binds to an antigen expressed on the surface of a hematopoietic cell, such as a hematopoietic stem cell, and a second binding domain which binds to a T cell.
- Background of the Disclosure Selective cell depletion has potential for treatment of a number of therapies, including conditioning for stem cell transplantation, treatment of autoimmune diseases, and treatment of certain cancers.
- B cell depletion therapy can be used to treat certain autoimmune conditions (Lee et al. (2020) Nature Reviews Drug Discovery, volume 20, pp.179–199).
- Conditioning is a process by which a patient is prepared (i.e., “conditioned”) to receive a transplant containing hematopoietic stem cells. Conditioning procedures thereby promote the engraftment of a hematopoietic stem cell transplant. Conditioning is performed prior to engraftment in order to create proper conditions (e.g., creation of stem cell niches) for the patient to receive the transplant. Further, in some situations, 20% engraftment of transplanted cells may alleviate or cure a particular disease state.
- non-specific (i.e., non-targeting) conditioning methods used in hematopoietic stem cell therapy (HSCT) indications and hemoglobinopathies including, but not limited to, the use of irradiation (e.g., total body irradiation (TBI)) and DNA alkylating/modifying agents, both of which are highly toxic not only to the many of the patients organ systems, but also affects hematopoietic and non-hematopoietic cells and the hematopoietic microenvironment.
- TBI total body irradiation
- DNA alkylating/modifying agents both of which are highly toxic not only to the many of the patients organ systems, but also affects hematopoietic and non-hematopoietic cells and the hematopoietic microenvironment.
- CD117 (also referred to as c-kit or Stem Ceil Factor Receptor (SCRF)) is a single transmembrane, receptor tyrosine kinase that binds the ligand Stem Cell Factor (SCF). SCF induces homodimerization of cKIT which acfivafes its tyrosine kinase activity and signals through both the PI3- AKT and MARK pathways (Kindblom et al, Am J. Path. 1998 152(5):1259). CD117 was initially discovered as an oncogene and has been studied in the field of oncology (see, for example, Stankov et al. (2014) Curr Pharm Des. 2G(17):2849-80).
- CD117 is highly expressed on hematopoietic stem cells (HSCs). This expression pattern makes CD117 a potential target for conditioning across a broad range of diseases. There remains, however, a need for anti-CD 117 based therapy that is effective for conditioning a patient for transplantation, such as a bone marrow transplantation.
- HSCs hematopoietic stem cells
- target stem cells e.g., CD117+ stem cells that can be used as conditioning agents to promote the engraftment of exogenous stem cells.
- Such therapies and agents may also be useful for freating other diseases, where selective ceil depletion would be therapeutic.
- Described herein are methods and compositions relating to T cell bispecific binding proteins that mediate immune-driven depletion of target cells.
- the methods and compositions disclosed herein relate to a CD3 bispecific binding protein, such as a bispecific antibody, that also binds to a target antigen expressed on a stem cell, such as a hematopoietic stem ceil (HSC).
- HSC hematopoietic stem ceil
- anti-CD117 bispecific binding proteins or fragments thereof comprising a first binding domain which binds to an antigen expressed on the surface of a hematopoietic ceil, such as a hematopoietic stem ceil (i.e., human CD117; also known as c-kit), and a second binding domain which binds to an antigen expressed on the surface of an immune cell, such as a T cell (e.g., CD3), as well as compositions and methods of using said bispecific binding proteins.
- a hematopoietic ceil such as a hematopoietic stem ceil (i.e., human CD117; also known as c-kit)
- an immune cell such as a T cell (e.g., CD3)
- the present disclosure provides a bispecific binding polypeptide having a first antigen binding moiety that binds to CD117 expressed on a hematopoietic stem cell (HSC) or a hematopoietic progenitor cell; and a second antigen binding moiety that binds to an antigen expressed on a T cell, in on embodiment, the first antigen binding moiety is derived from an anti- CD117 antibody, or an antigen-binding fragment thereof. In another embodiment, the first antigen binding moiety comprises a single-chain variable fragment (scFv).
- scFv single-chain variable fragment
- the first antigen binding moiety is selected from the group consisting of a Fab, a Fab', a di-scFv, a tandem di- scFv, a tri-scFv, a tandem tri-scFv, a Fv, a disulfide linked Fv, a DART, a single domain antibody (sdAb), a diabody, a tandem diabody, a triabody and a tandem triabody.
- the first antigen binding moiety comprises an anti-CD117 scFv.
- the anti-CD117 scFv comprises (i) a heavy chain variable region comprising a CDR1 , a GDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 7, 8, and 9, respectively, and comprises a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in 8EG ID NOs: 10, 11 , and 12, respectively; or (ii) a heavy chain variable region comprising an amino acid sequence as set forth in SEG ID NO: 13 and a light chain variable region comprising an amino acid sequence as set forth in 8EG ID NO: 14; or; (iii) a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 21 , 22, and 23, respectively, and comprises a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino amino acid sequence as
- a bispecific anti-CD3 / CD117 antibody comprises binding regions ⁇ e.g., VH and VL; or VH and VL CDRs) as described in the anti-CD117 antibody and the anti-CD3 anitbody amino acid sequences described in Table 4.
- the second antigen binding moiety is derived from an antibody, or an antigen-binding fragment thereof, in one embodiment, the second antigen binding moiety comprises a single-chain variable fragment (scFv). in another embodiment, the second antigen binding moiety is selected from the group consisting of a Fab, a Fab', a di-scFv, a tandem di-scFv, a tri-scFv, a tandem tri-scFv, a Fv, a DART, a disulfide linked Fv, a single domain antibody (sdAb), a diabody, a tandem diabody, a triabody and a tandem triabody.
- sdAb single domain antibody
- the antigen expressed on the immune cell is CD3, in some embodiments, the CD3 is encoded by a gene selected form the group consisting of CD3D (CD3 d), CD3E (CD3 e), CD3G (CD3 g), and CD3Z (CD3 z).
- the second antigen binding moiety comprises an anti-CD3 scFv.
- the anti-CD3 scFv comprises an anti-CD117 VH amino acid sequence as set forth in SEQ ID NO: 37 and an anti-CD117 VL amino acid sequence as set forth in SEQ ID NO: 38,
- the first antigen binding moiety comprises a first single-chain variable fragment (scFv) and wherein the second antigen binding moiety comprises a second scFv.
- the bispecific binding polypeptide is a tandem single-chain variable fragment (ta-scFv) comprising a first scFv and a second scFv. in certain other embodiments, the first scFv and the second scFv are connected by a linker, in some embodiments, the first scFv is an anti-CD117 scFv and wherein the second scFv is an anti-CD3 scFv.
- the anti-CD117 scFv comprises (i) a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NQs: 7, 8, and 9, respectively, and comprises a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NQs: 10, 11 , and 12, respectively; or (ii) a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 13 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 14; or; (iii) a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NQs: 21 , 22, and 23, respectively, and comprises a light chain variable region comprising a CDR1 , a GDR2, and a CDR3
- the anfi-CD3 scFv comprises an anti-CD117 VH amino add sequence as set forth in SEQ ID NO: 37 and an anti-CD117 VL amino add sequence as set forth in SEQ ID NO: 38.
- the bispecific binding polypeptide has an Fc region comprising a first Fc domain and a second Fc domain capable of stable association.
- the Fc region is an isotype selected from the group consisting ot lgG, IgA, lgM, EgD, and IgE, In other embodiments, the IgG Is an lgG1 or an lgG4.
- the Fc region comprises amino acid substitutions relative to a wild-type Fc region at positions L234, L235 (EU index), and D265 (EU index).
- the amino acid substitution at position L234 is L234A.
- the amino acid substitution at position L235 is L235A.
- the bispecitic binding polypeptide is a bispecific antibody, or a bispecific antigen-binding portion thereof.
- the present disclosure provides a pharmaceutical composition having a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof as disclosed herein.
- the present disclosure provides a method of treating a stem cell disorder in a human patient, by administering to the patient a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispedfic antigen-binding portion thereof as disclosed herein.
- the present disclosure provides a method of treating an immunodeficiency disorder in a human patient by administering to the patient a therapeutically effective amount of a bispedfic binding polypeptide, bispedfic antibody, or a bispedfic antigen-binding portion thereof as described herein.
- the immunodeficiency disorder is a congenital immunodeficiency or an acquired immunodeficiency.
- the present disclosure provides a method of treating a metabolic disorder in a human patient by administering to the patient a therapeutically effective amount of a bispedfic binding polypeptide, bispedfic antibody, or a bispedfic antigen-binding portion thereof as disclosed herein, in one embodiment, the metabolic disorder is selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy.
- the present disclosure provides a method of treating an autoimmune disorder in a human patient by administering to the patient a therapeutically effective amount of a bispedfic binding polypeptide, bispedfic antibody, or a bispedfic antigen-binding portion thereof as disclosed herein, in one embodiment, the autoimmune disorder is selected from the group consisting of multiple sclerosis, human systemic lupus, rheumatoid arthritis, inflammatory bowel disease, treating psoriasis, Type 1 diabetes meliitus, acute disseminated encephalomyelitis, Addison's disease, alopecia universalis, ankylosing spondylitis, antiphospholipid antibody syndrome, aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome, autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction
- the present disclosure provides a method of treating a cancer in a human patient, the method comprising administering to the patient a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof as disclosed hererin.
- the cancer is selected from the group consisting of leukemia, lymphoma, multiple myeloma, and neuroblastoma.
- the present disclosure provides a method of depleting a population of stem cells in a human patient, the method comprising administering to the patient an effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof of as disclosed herein.
- the method involves administering to the patient a transplant comprising hematopoietic stem cells.
- bispecific binding polypeptide comprising a first antigen binding moiety that binds to CD117 expressed on a hematopoietic stem ceil (HSC) or a hematopoietic progenitor cell; and a second antigen binding moiety that binds to an antigen expressed on a T cell.
- HSC hematopoietic stem ceil
- T cell hematopoietic progenitor cell
- the second antigen binding moiety binds to CD3.
- the first antigen binding moiety comprises an anti-CD117 single-chain variable fragment (scFv) and the second antigen binding moiety comprises an anti ⁇ CD3 scFv.
- the bispecific binding polypeptide is a bispecitic antibody, or a bispecific antigen-binding fragment thereof.
- the anti-CD117 binding moiety comprises a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 7, 8, and 9, respectively, and a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 10, 11 , and 12, respectively.
- the anti-CD117 binding moiety comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 13 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 14.
- the anti-CD117 binding moiety comprises a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NGs: 21 , 22, and 23, respectively, and a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 24, 25, and 26, respectively.
- the anti-CD117 binding moiety comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 27 and a light chain variable region comprising an amino add sequence as set forth in SEQ ID NO: 28.
- the anti-CD3 binding moiety comprises a heavy chain variable region comprising an amino add sequence as set forth in SEQ ID NO: 37 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 38. in one embodiment, the anti-CD3 binding moiety comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 41 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 45.
- a bispecific antibody or a bispecific antigen-binding portion thereof, comprising a CD117 binding region and a CD3 binding region, wherein the CD117 binding region comprises a heavy chain variable region comprising a CDR1 , a GDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 7, 8, and 9, respectively, and a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NQs: 10, 11 , and 12, respectively; a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 13 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 14: a heavy chain variable region comprising a CDR1 , a GDR2, and a GDR3 having an amino acid sequence as set forth in SEQ ID NOs: 21 , 22, and 23, respectively, and a light chain variable region comprising a CDR1
- the CD3 binding region of the bispecific antibody, or a bispecific antigen- binding portion thereof comprises (I) an anti-CD117 VH amino acid sequence as set forth in SEQ ID NO: 37 and an anti-CD117 VL amino acid sequence as set forth in SEQ ID NO: 38; or (II) a heavy- chain variable region comprising an amino add sequence as set forth in SEQ ID NO: 41 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 45.
- the bispecific antibody, or a bispecific antigen-binding portion thereof comprises an Fc region comprising a first CHS region of a first heavy chain and a second CH3 region of a second heavy chain, wherein the first and the second CHS regions are capable of stable association via a knob-in-hoie interaction.
- the bispecific antibody, or a bispecific antigen-binding portion thereof is an isotype selected from the group consisting of IgG (e.g., lgG1 or an lgG4), IgA, lgM, IgD, and IgE.
- the Fc region of the bispecific antibody, or a bispecific antigen-binding portion thereof comprises an amino acid substitutions) relative to a wild-type Fc region at position L234, L235, H435, or combinations thereof (EU index).
- the amino acid substitution at position 1234 is L234A.
- the amino acid substitution at position L235 is L235A.
- the amino acid substitution at position H435 is H435A.
- the bispecific antibody, or a bispecific antigen-binding portion thereof comprises a first CHS region comprising amino acid substitutions at positions T366, L368, and Y407 (EU index), and a second CHS region comprising amino acid substitutions at position T366 (EU index).
- the amino acid substitution at position T366 is T366S.
- the amino acid substitution at position L368 is L368A.
- the amino add substitution at position Y407 is Y407V or Y407T. in one embodiment, the amino acid substitution at position 1366 is T366W or T366Y.
- composition comprising a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof disclosed herein.
- Yet further embodiments include a method treating an immunodeficiency disorder in a human patient, the method comprising administering to the patient a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof, disclosed herein, in one embodiment, the immunodeficiency disorder is a congenital immunodeficiency or an acquired immunodeficiency.
- Another embodiment includes a method of treating a metabolic disorder in a human patient, the method comprising administering to the patient a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof, as disclosed herein, in one embodiment, a metabolic disorder is selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy
- Yet another embodiment includes a method of treating an autoimmune disorder in a human patient, the method comprising administering to the patient a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof, as disclosed herein.
- an autoimmune disorder includes multiple sclerosis, human systemic lupus, rheumatoid arthritis, inflammatory bowel disease, treating psoriasis, Type 1 diabetes meiiitus, acute disseminated encephalomyelitis, Addison's disease, alopecia universalis, ankylosing spondylitis, antiphospholipid antibody syndrome, aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune iymphoproliferative syndrome, autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas’ disease, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicatrical pemphigoid, coeliac sprue-dermatitis herpetiformis, cold agglutinin disease, CREST syndrome, Degos disease, discoid
- Yet another embodiment includes a method of treating a cancer in a human patient, the method comprising administering to the patient a therapeutically effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof, as disclosed herein.
- the cancer is selected from the group consisting of leukemia, lymphoma, multiple myeloma, and neuroblastoma.
- Still a further embodiment includes a method of depleting a population of stem cells in a human patient, the method comprising administering to the patient an effective amount of a bispecific binding polypeptide, bispecific antibody, or a bispecific antigen-binding portion thereof, as disclosed herein, in certain embodiments, the method further comprises administering to the patient a transplant comprising hematopoietic stem cells.
- HSCs hematopoietic stem cells
- the bispecific antibody, or a bispecific antigen-binding portion thereof comprises a first binding moiety that specifically binds to a human HSC cell surface antigen and comprise a second binding moiety that specifically binds to a human T cell surface antigen
- the first antigen binding moiety binds to a human HSC cell surface antigen selected from the group consisting of CD7, CDw!2, CD13, GDI 5, CD19, CD21 , CD22, CD29, CD30, CD33, CD34, CD36, CD38, CD40, CD41 , CD42a, CD42b, CD42c, CD42d, CD43, CD48, CD49b, CD49d,
- CD001 CD205, CD217, CD220, CD221 , CD222, CD223, CD224, CD225, CD226, CD227, GD228, CD229, GD230, GD235a, CD235b, CD236, CD236R, GD238, GD240, GD242, GD243, GD277, GD292, GDw293, GD295, CD298, CD309, CD318, CD324, CD325, CD338, CD344, CD349 and CD350.
- the first antigen binding moiety binds to CD117.
- the second antigen binding moiety binds to human CD3.
- the first antigen binding moiety comprises (i) a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino acid sequence as set forth in SEQ ID NOs: 7, 8, and 9, respectively, and comprises a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an amino add sequence as set forth in SEQ ID NGs: 10, 11 , and 12, respectively; or (ii) a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 13 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 14; or; (iii) a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 having an
- the second antigen binding moiety binds to CD3, and wherein the second antigen binding moiety comprises (i) a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 37 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 38; or (ii) a heavy chain variable region comprising an amino add sequence as set forth in SEQ ID NO: 41 and a light chain variable region comprising an amino add sequence as set forth in SEQ ID NO: 45.
- the bispecific antibody, or the bispecific antigen-binding fragment thereof is an IgG, e.g., an lgG1 or an lgG4.
- the bispecific antibody, or the bispecific antigen binding fragment thereof comprises an Fc region comprising a first CH3 region ot a first heavy chain, and comprises a second CH3 region of a second heavy chain, wherein the first and the second CHS regions are capable of stable association via a knob-in-hole interaction
- the first CHS region comprises amino acid substitutions at positions T366, L368, and Y407 (EU index)
- the second CHS region comprises amino acid substitutions at position T366 (EU index).
- the amino acid substitution at position T366 is T366S.
- the amino acid substitution at position 1368 is L368A.
- the amino acid substitution at position Y407 is Y407V or Y407T. in one embodiment, the amino acid substitution at position T366 is T386W or T366Y.
- the patient has a stem ceil disorder and is in need of a transplant.
- the method further comprises administering an HSC transplant to the patient following depletion.
- the patient has an immunodeficiency disorder, a metabolic disorder, an autoimmune disorder, or cancer.
- Fig. 1 graphically depicts the results of an in vitro ceil killing assay using CD117 expressing target cells (Kasumi-1 cells) for an anti-CD117 / CD3 bispeciflc antibody ⁇ i.e., “bs-Ab-1”) in comparison to antibody controls having one non -targeting arm and one targeting arm (i.e., either a CD3 or a CD117 targeting arm).
- the control antibodies are referred to as “Anti-CD117-!sotype antibody” and “Anti-CD3-lsotype antibody” in Fig. 1 .
- Fig. 2 graphically depict the results of in vitro cell killing assays using primary human hematopoietic stem cells for the bs-Ab-1 bispecific antibody in comparison to antibody controls having one non-targeting arm and one targeting arm (i.e., either a CD3 or CD117 targeting arm).
- the controls are referred to as “Anti-GDI 17-isotype antibody” and “Anti-CD3-lsotype antibody” in Fig. 2.
- Figs. 3A to 3D graphically depict the results of an in vivo cell depletion assay that shows the bs-Ab-1 bispecific antibody selectively depletes human HSCs in humanized NSG mice.
- Fig, 3A shows the frequency (%) of CD34+ cells maintained after 21 days in mice treated with various concentrations of a single dose of (i) the bs-Ab-1 bispecific antibody, (ii) an anti-GDI 17-isotype antibody, (iii) an anti-CD3-lsotype antibody, (iv) a combination of an anti-CD117-Isotype antibody and an anti-CD3- Isotype antibody, and (v) a control (i.e., “PBS”).
- 3B shows the absolute number of CD34+ cells maintained after 21 days in mice treated with various concentrations of a single dose of (i) the bs-Ab-1 bispecific antibody, (ii) an anti-CD117-isotype antibody, (iii) an anti-CD3-lsotype antibody, (iv) a combination of an anti-CD117-lsotype antibody and an anti-CD3-!sotype antibody, and (v) a control (i.e., “PBS”).
- a control i.e., “PBS”.
- 3C shows the frequency (%) of CD34+CD117+ cells maintained after 21 days in mice treated with various concentrations of a single dose of (i) the bs-Ab-1 bispecific antibody, (ii) an anti-CD117-isotype antibody, (iii) an anti-CD3-lsotype antibody, (iv) a combination of an anti-CD117-Isotype antibody and an anti-CD3-isotype antibody, and (v) a control (i.e., “PBS”).
- a control i.e., “PBS”.
- 3D shows the absolute number of CD34+CD117+ cells maintained after 21 days in mice treated with various concentrations of a single dose of (i) a bs-Ab-1 bispecific antibody, (ii) an anti-CD117-lsotype antibody, (iii) an anti-CD3-lsotype antibody, (iv) a combination of an anti-CD117-Isotype antibody and an anti-CD3- Isotype antibody, and (v) a control (i.e., “PBS”).
- anti-CD3-isotype antibody and anti-CD117-Isotype antibody refer to control antibodies having either a CD3 or a CD117 targeting arm and a non-targeting arm.
- Fig. 4 graphically depicts the results of an in vitro ceil killing assay using primary human stem cells for the bs-Ab-2 bispecific antibody and bs-Ab-3 bispecific antibody in comparison to (i) a combination of an Ab85-isotype antibody (i.e., an antibody with a CD117 targeting arm of Ab85 (with the T366Y and H435A amino acid substitutions) and a non-targeting arm (with the Y407T and H435A amino acid substitutions); referred to as “Ab85-lso” in Fig.4) and an anti-CD3-!sotype antibody (i.e., an antibody with a CD3 targeting arm of Ab2 (with the Y407T and H435A amino acid substitutions) and a non-targeting arm (with the T366Y and H435A amino acid substitutions); referred to as “anti-CD3-iso” in Fig.4) and (ii) a combination of an Ab67-lsotype (i.e
- Fig. 5 provides a schematic of a T-ceil bispecific antibody which can be used to mediate immune-driven depletion of target cells.
- the bispecific antibody in Fig. 5 has a T cell binding arm (heavy and light chain) that binds to CD3 and a target ceil (e.g., HSC) binding arm (heavy and light chain) that binds to CD117.
- Described herein are bispecifics that can be used to mediate ceil depletion via T cells.
- the methods and compositions disclosed herein use T-cells bound by a T-cell specific bispecific protein to deplete target cells, where the target is defined by the second arm of the bispecific protein.
- a bispecific may target CD3 (T cell antigen) and CD117 (an HSC target antigen).
- CD3 T cell antigen
- CD117 an HSC target antigen
- HSC and CD3 targeting bispecific proteins disclosed herein e.g., anti-CD117 bispecific binding proteins or fragments thereof provided herein have many characteristics making them advantageous for therapy, including methods of conditioning human patients for stem ceil transplantation. . These features also make the anti-CD117 bispecific binding proteins or fragments thereof disclosed herein advantageous for use in methods of treating patients suffering from various pathologies, such as blood diseases, metabolic disorders, cancers, and autoimmune diseases, among others.
- the disclosure provides anti-CD117 bispecific binding proteins or fragments thereof that bind to the ectodomain of human CD117 and bind to human CD3 on the surface of a T cell.
- the binding regions of certain embodiments of the isolated anti-CD117 bispecific binding proteins or fragments thereof identified herein are described below.
- HSG and CD3 targeting bispecific proteins disclosed herein can be used in methods of treating a variety of disorders, such as diseases of a ceil type in the hematopoietic lineage, cancers, autoimmune diseases, metabolic disorders, and stem ceil disorders, among others.
- compositions and methods described herein may (i) directly deplete a population of cells that give rise to a pathology, such as a population of cancer cells (e.g., leukemia cells) and autoimmune cells (e.g., autoreactive T- cells), and/or (ii) deplete a population of endogenous hematopoietic stem cells so as to promote the engraftment of transplanted hematopoietic stem cells by providing a niche to which the transplanted cells may home.
- a pathology such as a population of cancer cells (e.g., leukemia cells) and autoimmune cells (e.g., autoreactive T- cells)
- autoimmune cells e.g., autoreactive T- cells
- the foregoing activities can be achieved by administration of, for example, anti- CD117 bispecific binding proteins or fragments thereof that are capable of binding an antigen expressed by a hematopoietic stem cell (or an endogenous disease-causing cell), i.e., CD117, and an antigen expressed by an immune cell, such as a T ceil, e.g., CD3.
- a hematopoietic stem cell or an endogenous disease-causing cell
- an immune cell such as a T ceil, e.g., CD3.
- this administration can cause a reduction in the quantity of the cells that give rise to the pathology of interest.
- this administration can cause the selective depletion of a population of endogenous hematopoiefic stem cells, thereby creating a vacancy in the hematopoietic tissue, such as the bone marrow, that can subsequently be filled by transplanted, exogenous hematopoietic stem cells.
- the invention is based in part on the discovery that anti-CD117 bispecific binding proteins or fragments thereof capable of binding CD117 (such as GNNK+ CD117) and CD3 can be administered to a patient to affect both of the above activities.
- Anti-CD117 bispecific binding proteins or fragments thereof, that bind CD117 and CD3 can be administered to a patient suffering from a cancer or autoimmune disease to directly deplete a population of cancerous cells or autoimmune cells, and can also be administered to a patient in need of hematopoietic stem cell transplant therapy in order to promote the survival and engraftment potential of transplanted hematopoietic stem cells.
- Engraftment of hematopoietic stem cell transplants due to the administration of a bispecitic binding protein that binds to CD3 and an anti-HSC antigen, e.g., anti-CD117 bispecific binding proteins or fragments thereof, can manifest in a variety of empirical measurements. For instance, engraftment of transplanted hematopoietic stem cells can be evaluated by assessing the quantity of competitive repopulating units (CRU) present within the bone marrow of a patient following administration of, e.g., an anti-CD117 bispecific binding proteins or fragments thereof capable of binding CD117 and CD3, and subsequent administration of a hematopoietic stem ceil transplant.
- CRU competitive repopulating units
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- compositions and methods disclosed herein can be used to treat a patient, such as a patient suffering from a cancer (such as acute myelogenous leukemia or mye!odysplastic syndrome) or autoimmune disease, or a patient in need of hematopoietic stern cell transplant therapy in order to promote engraftment of hematopoietic stem ceil grafts, as well as methods of administering such therapeutics to a patient (e.g., prior to hematopoietic stem ceil transplantation).
- the term “about” refers to a value that is within 5% above or below the value being described.
- the term “antibody” refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen.
- An antibody includes, but is not limited to, monoclonal antibodies, polyclonal antibodies, mulfispecific antibodies (e.g., bispecific antibodies), genetically engineered antibodies, and otherwise modified forms of antibodies, including but not limited to de-immunized antibodies, chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad-specific antibodies, diabodies, triabodies, and tetrabodies), and antibody fragments (i.e., antigen binding fragments of antibodies), including, for example, Fab', F(ab')2, Fab, Fv, rlgG, and scFv fragments, so long as they exhibit the desired antigen-binding activity.
- antibodies comprise heavy and light chains containing antigen binding regions (also referred to herein as antigen binding moieties).
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, GH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LGVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FRS, CDRS, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- antigen-binding fragment refers to one or more portions of an antibody that retain the ability to specifically bind to a target antigen.
- the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- the antibody fragments can be, for example, a Fab, F(ab’)2, scFv, diabody, a triabody, an affibody, a nanobody, an aptamer, or a domain antibody.
- binding fragments encompassed of the term “antigen-binding fragment” of an antibody include, but are not limited to: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL, and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb including VH and VL domains; (vi) a dAb fragment that consists of a VH domain (see, e.g., Ward et al., Nature 341 :544-546, 1989); (vii) a dAb which consists of a VH or a VL domain; (viii) an isolated complementarity determining region (CDR);
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al., Science 242:423-426, 1988 and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988).
- scFv single chain Fv
- These antibody fragments can be obtained using conventional techniques known to those of skill in the art, and the fragments can be screened for utility in the same manner as intact antibodies.
- Antigen-binding fragments can be produced by recombinant DNA techniques, enzymatic or chemical cleavage of intact immunoglobulins, or, in certain cases, by chemical peptide synthesis procedures known in the art.
- an antigen-binding fragment would be a bispecific fragment, ie., a bispecific antigen binding fragment (or portion).
- an “intact” or “full length” antibody refers to an antibody having two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds.
- a bispecific antibody can be an intact antibody, where the first arm of the bispeciiic antibody comprises a light chain and a heavy chain that bind to a first antigen (or epitope), and the second arm of the bispecific antibody comprises a heavy chain and a light chain that bind to a second antigen (or epitope).
- the term "specifically binds”, as used herein, refers to the ability of an antibody or bispecific binding protein to recognize and bind to a specific protein structure (epitope) rather than to proteins generally. If an antibody or bispecific binding protein is specific for epitope "A", the presence of a molecule containing epitope A (or free, unlabeied A), in a reaction containing labeled "A” and the antibody, will reduce the amount of labeled A bound to the antibody.
- an antibody "binds specifically" to a target if the antibody, when labeled, can be competed away from its target by the corresponding non-labeled antibody.
- an antibody or bispeciiic binding protein specifically binds to a target, e.g., an antigen expressed by hematopoietic stem cells, such as CD117; if the antibody has a K D for the target of at least about 10 -4 M, about 10 -5 M, about 10 -6 M, about 10 -7 M, about 10 -8 M, about 10 -9 M, about 10 _1 ° M, about 1 G -11 M, about 10 -12 M, or less (less meaning a number that is less than about 10 -12 , e.g. 10 -13 ), in one embodiment, K D is determined according to standard bio-layer interferometery (BLI).
- BBI bio-layer interferometery
- an antibody may be capable of specifically binding to two or more antigens which are related in sequence.
- an antibody can specifically bind to both human and a non-human (e.g., mouse or non-human primate) orthologs of an antigen, e.g., CD117.
- monoclonal antibody refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, by any means available or known in the art, and is not limited to antibodies produced through hybridoma technology.
- Monoclonal antibodies useful with the present disclosure can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
- immune cell is intended to include, but is not limited to, a ceil that is ot hematopoietic origin and that plays a role in the immune response
- immune cells include, but are not limited to, T cells and natural killer (NK) cells.
- Natural killer cells are well known in the art.
- natural killer cells include cell lines, such as NK-92 cells. Further examples of NK cell lines include NKG, YT, NK-YS, HANK-1 , YTS cells, and NKL cells.
- An immune cell can be allogeneic or autologous.
- anti-CD117 antibody or “an antibody that binds to CD117” refers to an antibody that is capable of binding CD117 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD117.
- anti-CD117 bispecific binding protein or "a bispecific binding protein that binds to CD117” refers to a bispecific binding protein that is capable of binding CD117 with sufficient affinity such that the bispecific binding protein is useful as a diagnostic and/or therapeutic agent in targeting CD117.
- bispecific binding proteins or “bispecific binding polypeptide” refers to a protein comprising antigen binding regions that bind to two antigens (or two epitopes on the same antigen).
- An example of a bispecific binding protein is a bispecific antibody or a BITE (see, e.g., Einsele et al. (2020) Cancer voi. 126(14): 3192-3201).
- bispecific antibody or “bispecific antibody construct” refers to to an antibody that displays dual binding specificity for two different antigens or two different epitopes, where each binding site differs and recognizes a different antigen or epitope.
- one of the binding specificities can be directed towards an epitope on a hematopoietic stem cell (HSG) surface antigen, e.g., CD117 (e.g., GNNK+ CD117), and the other can be directed towards an epitope on a different ceil, such as an immune cell (e.g., a T ceil) or an epitope on a different hematopoietic stem cell surface antigen or another cell surface protein, such as a receptor or receptor subunit involved in a signal transduction pathway that potentiates cell growth, among others.
- HSG hematopoietic stem cell
- a bispecific antibody is represented by the intact antibody described in Figure 5, where the bispecific antibody contains a T cell specific binding arm comprising an antibody heavy and a iight chain, and contains a second target specific binding arm (e.g., binds to an antigen expressed on an HSC) comprising an antibody heavy and a iight chain.
- a target specific binding arm e.g., binds to an antigen expressed on an HSC
- the “bispecific binding protein” or “bispecific antibody” or “bispecific antibody construct” has a first antigen binding domain (or binding moiety) that binds to CD117 and has a second antigen binding domain (or binding moiety) that binds to CD3.
- bispecific binding proteins e.g., anti-CD117 bispecific binding proteins or fragments thereof disclosed herein are (at least) bispecific, they do not occur naturally and they are markedly different from naturally occurring products.
- a “bispecific” binding protein or immunoglobulin is hence an artificial hybrid antibody or immunoglobulin having at least two distinct binding sites with different specificities.
- Bispecific binding proteins can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsiviiai & Lachmann, Clin. Exp. ImunoL 79:315-321 (1990).
- knob-in-hole refers to a certain type of bispecific antibody which contains a first arm containing a light and a heavy chain that binds to a first antigen (or epitope) and a second arm containing a second Iight and heavy chain that binds to a second antigen (or epitope).
- a knob-in-hole bispecific antibody involves engineering CH3 domains of each arm to create either a "knob” or a "hole” in each heavy chain to promote heterodimerization of the two heavy chains.
- a T- cell / HSC specific bispecific e.g., anti-CD3 /
- CD117 bispecific antibody is a “bispecific single chain binding protein”, more preferably a bispecific “single chain Fv” (scFv).
- scFv single chain Fv
- VL and VH the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form a monovalent molecule; see e.g., Huston et al. (1988) Proc. Natl. Acad. Sci USA 85:5879-5883).
- These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are evaluated for function in the same manner as are whole or full-length antibodies.
- a single-chain variable fragment is hence a fusion protein of the variable region of the heavy chain (VH) and of the iight chain (VL) of immunoglobulins, usually connected with a short linker peptide of about ten to about 25 amino acids, preferably about 15 to 20 amino acids.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and introduction of the linker.
- CDR complementarity determining region
- FRs framework regions
- the amino acid positions that delineate a hypervariable region of an antibody (or bispecific binding protein as described herein) can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria.
- variable domains of native heavy and light chains each contain four framework regions that primarily adopt a ⁇ -sheet configuration, connected by three CDRs, which form loops that connect, and in some cases form part of, the ⁇ -sheet structure.
- the CDRs in each chain are held together in close proximity by the framework regions in the order FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 and, with the CDRs from the other antibody chains, contribute to the formation of the target binding site of antibodies (see Kabat et a!., Sequences of Proteins of immunological Interest, National Institute of Health, Bethesda, MD., 1987).
- numbering of immunoglobulin amino acid residues is performed according to the immunoglobulin amino add residue numbering system of Kabat et a!., unless otherwise indicated (although any antibody numbering scheme, including, but not limited to IMGT and Chothia, can be utilized).
- Fc Fc region
- Fc domain Fc domain
- lgG Fc domain refers to the portion of an immunoglobulin, e.g., an lgG molecule, that correlates to a crystallizable fragment obtained by papain digestion of an IgG molecule.
- the Fc region comprises the C-terminal half of two heavy chains of an IgG molecule that are linked by disulfide bonds. It has no antigen binding activity but contains the carbohydrate moiety and binding sites for complement and Fc receptors, including the FcRn receptor (see below).
- an Fc domain contains the second constant domain CH2 (e.g., residues at EU positions 231-340 of human lgG1) and the third constant domain CH3 (e.g., residues at Eli positions 341-447 of human lgG1).
- the Fc domain includes the lower hinge region” (e.g., residues at EU positions 233-239 of human lgG1).
- Fc can refer to this region in isolation, or this region in the context of a bispecific binding protein, an antibody, antibody fragment, or Fc fusion protein. Polymorphisms have been observed at a number of positions in Fc domains, including but not limited to EU positions 270, 272, 312, 315, 356, and 358, and thus slight differences between the sequences presented in the instant application and sequences known in the art can exist. Thus, a "wild type IgG Fc domain" or "VVT IgG Fc domain” refers to any naturally occurring IgG Fc region (i.e., any allele).
- sequences of the heavy chains of human IgG 1 , lgG2, lgG3 and lgG4 can be found in a number of sequence databases, for example, at the Uniprot database (www.uniprot.org) under accession numbers P01857 (IGHG1_HUMAN),
- modified Fc region or "variant Fc region” as used herein refers to an IgG Fc domain comprising one or more amino acid substitutions, deletions, insertions or modifications introduced at any position within the Fc domain, in certain aspects a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an Fc gamma R and/or G1q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions. Further, Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- an antibody comprising a variant Fc domain can exhibit altered binding affinity for at least one or more Fc ligands (e.g., Fc gamma Rs) relative to a corresponding antibody otherwise having the same amino acid sequence but not comprising the one or more amino acid substitution, deletion, insertion or modifications such as, for example, an unmodified Fc region containing naturally occurring amino acid residues at the corresponding position in the Fc region.
- Fc ligands e.g., Fc gamma Rs
- Variant Fc domains are defined according to the amino acid modifications that compose them. For ail amino acid substitutions discussed herein in regard to the Fc region, numbering is always according to the EU index as in Kabat.
- D265C is an Fc variant with the aspartic acid (D) at EU position 265 substituted with cysteine (C) relative to the parent Fc domain. It is noted that the order in which substitutions are provided is arbitrary.
- D265C/L234A/L235A defines a variant Fc variant with substitutions at EU positions 265 (D to C), 234 (L to A), and 235 (L to A) relative to the parent Fc domain.
- a variant can also be designated according to its final amino acid composition in the mutated EU amino acid positions.
- the L234A/L235A mutant can be referred to as “LALA”
- the E233P.L234V.L235A,delG236 (deletion of 236) mutant can be referred to as “EPLVLAdelG”.
- the I253A.H310A.H435A mutant can be referred to as ⁇ HH”. It is noted that the order in which substitutions are provided is arbitrary.
- Fc gamma receptor or "Fc gamma R” as used herein refer to any member of the family of proteins that bind the IgG antibody Fc region and are encoded by the Fc gamma R genes. In humans this family includes but is not limited to Fc gamma Rl (CD64), including isoforms Fc gamma Rla, Fc gamma Rib, and Fc gamma Rlc; Fc gamma Rll (CD32), including isoforms Fc gamma Rlla (including allotypes H131 and R131), Fc gamma Rilb (including Fc gamma Rllb-1 and Fc gamma Ri lb-2), and Fc gamma Rile; and Fc gamma Rlll (CD16), including isoforms Fc gamma Rllla (including allotypes V158 and F158) and Fc gamma Rll ib (including allotype
- An Fc gamma R can be from any organism, including but not limited to humans, mice, rats, rabbits, and monkeys.
- Mouse Fc gamma Rs include but are not limited to Fc gamma RI (CD64), Fc gamma Rll (CD32), Fc gamma Rlll (CD16), and Fc gamma Rill-2 (GD16-2), as well as any undiscovered mouse Fc gamma Rs or Fc gamma R isoforms or allotypes.
- effector function refers to a biochemical event that results from the interaction of an Fc domain with an Fc receptor. Effector functions include but are not limited to ADCC, ADGP, and CDC.
- effector cell as used herein is meant a cell of the immune system that expresses or one or more Fc receptors and mediates one or more effector functions.
- Effector cells include but are not limited to monocytes, macrophages, neutrophils, dendritic cells, eosinophils, mast cells, platelets, B cells, large granular lymphocytes, Langerhans' cells, natural killer (NK) cells, and gamma delta T cells, and can be from any organism included but not limited to humans, mice, rats, rabbits, and monkeys.
- silicent refers to an antibody or bispecific binding protein having a modified Fc region described herein that has decreased binding to an Fc gamma receptor (FcyR) relative to binding of an identical antibody or bispecific binding protein comprising an unmodified Fc region to the FcyR (e.g., a decrease in binding to a FcyR by at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% relative to binding of the identical antibody comprising an unmodified Fc region to the FcyR as measured by, e.g., BLl).
- FcyR Fc gamma receptor
- the Fc silenced antibody or bispecific binding protein has no detectable binding to an FcyR. Binding of an antibody having a modified Fc region to an FcyR can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al.
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al.
- binding affinities and kinetics can be found in Paul, W. E,, ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of uniabeied antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis.
- Competition with a second antibody can also be determined using radioimmunoassays, in this case, the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an uniabeied second antibody.
- Identical antibody comprising an unmodified Fc region or “identical bispecific binding protein comprising an unmodified Fc region” refers to an antibody or bispecific binding protein that lacks the recited amino acid substitutions (e.g., D265C, H435A, L234A, and/or L235A), but otherwise has the same amino acid sequence as the Fc modified antibody or Fc modified bispecific binding protein to which it is being compared.
- antibody-dependent cell-mediated cytotoxicity refers to a form of cytotoxicity in which a polypeptide comprising an Fc domain, e.g., an antibody or bispecific binding protein, bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., primarily NK cells, neutrophils, and macrophages) and enables these cytotoxic effector cells to bind specifically to an antigen-bearing "target cell” and subsequently kill the target cell with cytotoxins.
- FcRs Fc receptors
- ADCC activity the cell-mediated cytotoxicity resulting from the activity of a polypeptide comprising an Fc domain.
- a polypeptide of interest e.g., an antibody
- immune effector cells e.g., an antibody
- Cytolysis is generally defected by the release of label (e.g., radioactive substrates, fluorescent dyes or natural intracellular proteins) from the lysed cells.
- label e.g., radioactive substrates, fluorescent dyes or natural intracellular proteins
- useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- ADCC activity of the antibody or bispecific binding protein of interest can be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et a!., Proc. Natl. Acad. Sci. USA 95:652 (1998).
- condition refers to processes by which a patient is prepared for receipt of a transplant containing hematopoietic stem cells. Such procedures promote the engraftment of a hematopoietic stem cell transplant (for instance, as inferred from a sustained increase in the quantity of viable hematopoietic stem cells within a blood sample isolated from a patient following a conditioning procedure and subsequent hematopoietic stern cell transplantation.
- a patient may be conditioned for hematopoietic stem ceil transplant therapy by administration to the patient of a T ceil mediated HSC ceil depleting bispecific antibody, (e.g., anti-CD117 bispecific binding proteins or fragments thereof, capable of binding an antigen expressed by hematopoietic stem cells, such as CD117 (e.g., GNNK+ CD117) and an antigen expressed by a T cell, such as CD3).
- a T ceil mediated HSC ceil depleting bispecific antibody e.g., anti-CD117 bispecific binding proteins or fragments thereof, capable of binding an antigen expressed by hematopoietic stem cells, such as CD117 (e.g., GNNK+ CD117) and an antigen expressed by a T cell, such as CD3
- administration of bispecific binding proteins or fragments thereof, capable of binding an antigen on an HSC (e.g., CD117) and a T ceil (e.g., CD3)to a patient in need of hematopoietic stem cell transplant therapy can promote the engraftment of a hematopoietic stem cell graft, for example, by selectively depleting endogenous hematopoietic stem cells, thereby creating a vacancy filled by an exogenous hematopoietic stem ceil transplant.
- conservative sequence modifications of the sequences set forth in SEQ ID NOs described herein, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the antibody or bispecific binding protein encoded by the nucleotide sequence or containing the amino acid sequence, to the antigen.
- conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions.
- modifications can be introduced into SEQ ID NOs described herein by standard techniques known in the arf, such as site-directed mutagenesis and PGR- mediated mutagenesis.
- Conservative sequence modifications include conservative amino acid substitutions, in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- tamiiies include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoieucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoieucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- a predicted nonessentiai amino acid residue in a bispecific antibody e.g., an anti- CD117 antibody or anti-CD117 bispecific binding protein
- a bispecific antibody e.g., an anti- CD117 antibody or anti-CD117 bispecific binding protein
- another amino acid residue from the same side chain family.
- Methods of identifying nucleotide and amino acid conservative substitutions that do not eliminate antigen binding are well-known in the art (see, e.g., Brummeli et al., Biochem. 32:1180-1137 (1993); Kobayashi et a!. Protein Eng. 12(10)i879-834 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
- the term “donor” refers to a human or animal from which one or more cells are isolated prior to administration of the cells, or progeny thereof, into a recipient.
- the one or more cells may be, for example, a population of hematopoietic stem cells.
- the term “diabody” refers to a bivalent antibody containing two polypeptide chains, in which each polypeptide chain includes V H and V L domains joined by a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V l. domains on the same peptide chain. This configuration forces each domain to pair with a complementary domain on another polypeptide chain so as to form a homodimeric structure.
- a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V l. domains on the same peptide chain. This configuration forces each domain to pair with a complementary domain on another polypeptide chain so as to form a homodimeric structure.
- the term “triabody” refers to triva!ent antibodies containing three peptide chains, each of which contains one V H domain and one V L domain joined by a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of V H and V L domains within the same peptide chain.
- a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of V H and V L domains within the same peptide chain.
- peptides configured in this way typically trimerize so as to position the V H and V L domains of neighboring peptide chains spatially proximal to one another (see, for example, Holliger et al Proc. Natl. Acad. Sci. USA 90:6444-48, 1993).
- the term “endogenous” describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a ceil of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast ceil, myeoblast, basophil, neutrophil, eosinophil, microglial ceil, granulocyte, monocyte, osteoclast, antigen-presenting ceil, macrophage, dendritic ceil, natural killer cell, T-lymphocyte, or B-lymphocyte) that is found naturally in a particular organism, such as a human patient.
- a hematopoietic stem cell or a ceil of hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast ceil, myeoblast, basophil, neutrophil, eosinophil, microglial ceil,
- the term “engraftment potential” is used to refer to the ability of hematopoietic stem and progenitor cells to repopuiate a tissue, whether such cells are naturally circulating or are provided by transplantation.
- the term encompasses all events surrounding or leading up to engraftment, such as tissue homing of cells and colonization of cells within the tissue of interest.
- the engraftment efficiency or rate of engraftment can be evaluated or quantified using any clinically acceptable parameter as known to those of skill in the art and can include, for example, assessment of competitive repopulating units (CRU); incorporation or expression of a marker in tissue(s) into which stem cells have homed, colonized, or become engrafted; or by evaluation of the progress of a subject through disease progression, survival of hematopoietic stem and progenitor cells, or survival of a recipient.
- Engraftment can also be determined by measuring white blood cell counts in peripheral blood during a post-transplant period. Engraftment can also be assessed by measuring recovery of marrow cells by donor cells in a bone marrow aspirate sample.
- exogenous describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a ceil of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast ceil, myeoblast, basophil, neutrophil, eosinophil, microglial ceil, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic ceil, natural killer ceil, T-lymphocyte, or B-lymphocyte) that is not found naturally in a particular organism, such as a human patient.
- Exogenous substances include those that are provided from an external source to an organism or to cultured matter extracted therefrom.
- frame region includes amino acid residues that are adjacent to the CDRs of an antibody or antigen-binding fragment thereof.
- FW region residues may be present in, for example, human antibodies, humanized antibodies, monoclonal antibodies, antibody fragments, Fab fragments, single chain antibody fragments, scFv fragments, antibody- domains, and bispecific binding proteins or fragments thereof, among others.
- HSCs hematopoietic stem cells
- granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
- erythrocytes e.g., reticulocytes, erythrocytes
- thrombocytes e.g., megakaryoblasts, platelet producing megakaryocytes, platelets
- monocytes e.g., monocytes, macrophages
- dendritic cells e.g., NK cells, B-cells and T-cells.
- Such cells may include CD34 + cells.
- CD34 ⁇ cells are immature cells that express the CD34 ceil surface marker.
- CD34+ cells are believed to include a subpopuiation of cells with the stem cell properties defined above, whereas in mice, HSCs are CD34-.
- HSCs also refer to long term repopuiating HSCs (LT-HSC) and short term repopulating HSCs (ST-HSC).
- LT-HSCs and ST-HSCs are differentiated, based on functional potential and on ceil surface marker expression.
- human HSCs are CD34+, CD38-, CD45RA-, CD90+, CD49F+, and lin- (negafive for mature lineage markers including CD2, CD3, CD4, CD7, CD3, CD10, CD11 B, CD19, CD20, CD56, CD235A).
- bone marrow LT-HSCs are CD34-, SCA-1 +, C-kit+, CD135-, Slamfl/CD150+, CD48-, and lin- (negative for mature lineage markers including Ter119, CD11b, Gr1 , CD3, CD4, CD8, B220, IL7ra), whereas ST-HSCs are CD34+, SCA-1+, C-klt+, CD135-, Slamfl/GD15Q+, and lin- (negative for mature lineage markers including Terf 19, GDI 1 b, Gr1 , CD3, CD4, CD3, B220, !L7ra).
- ST-HSCs are less quiescent and more proliferative than LT-HSCs under homeostatic conditions.
- LT- HSC have greater self renewal potential (i.e., they survive throughout adulthood, and can be serially transplanted through successive recipients), whereas ST-HSCs have limited self renewal (i.e., they survive for only a limited period of time, and do not possess serial transplantation potential). Any of these HSCs can be used In the methods described herein.
- ST-HSCs are particularly useful because they are highly proliferative and thus, can more quickly give rise to differentiated progeny.
- hematopoietic stem celt functional potential refers to the functional properties of hematopoietic stern cells which include 1 ) multi-potency (which refers fo the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B- cells and T-cells), 2) self-renewal (which refers to the ability of hematopoietic stem cells to give rise to daughter cells that have equivalent potential as the mother cell, and further that
- multi-potency which
- human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- a human antibody may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or during gene rearrangement or by somatic mutation in vivo).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- a human antibody can be produced in a human ceil (tor example, by recombinant expression) or by a non-human animal or a prokaryotic or eukaryotic ceil that is capable of expressing functionally rearranged human immunoglobulin (such as heavy chain and/or light chain) genes.
- a human antibody when a human antibody is a single chain antibody, it can include a linker peptide that is not found in native human antibodies.
- an Fv can contain a linker peptide, such as two to about eight glycine or other amino add residues, which connects the variable region of the heavy chain and the variable region of the light chain. Such linker peptides are considered to be of human origin.
- Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences. Human antibodies can also be produced using transgenic mice that are incapable of expressing functional endogenous Immunoglobulins, but which can express human immunoglobulin genes (see, for example, PCT Publication Nos. WO 1998/24893; WO 1992/01047; WO 1996/34096; WO 1996/33735; U.S. Patent Nos. 5,413,923; 5,625,126; 5,633,425; 5,569,825; 5,661 ,016; 5,545,806; 5,814,318; 5,885,793; 5,916,771 ; and 5,939,598).
- patients that are “in need of a hematopoietic stem cell transplant include patients that exhibit a defect or deficiency in one or more blood cell types, as well as patients having a stem cell disorder, autoimmune disease, cancer, or other pathology described herein.
- Hematopoietic stem cells generally exhibit 1) multi-potency, and can thus differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells), 2) self-renewal, and can thus give rise to daughter cells that have equivalent potential as the mother cell, and 3) the ability to be reintroduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and re-establish productive and sustained hematop
- Hematopoietic stem cells can thus be administered to a patient defective or deficient in one or more ceil types of the hematopoietic lineage in order to re-constitute the defective or deficient population of cells in vivo.
- the patient may be suffering from cancer, and the deficiency may be caused by administration of a chemotherapeutic agent or other medicament that depletes, either selectively or non-specificaliy, the cancerous cell population.
- the patient may be suffering from a hemoglobinopathy (e.g., a non-malignant hemoglobinopathy), such as sickle ceil anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- a hemoglobinopathy e.g., a non-malignant hemoglobinopathy
- the subject may be one that is suffering from adenosine deaminase severe combined immunodeficiency (ADA SCID), HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- ADA SCID adenosine deaminase severe combined immunodeficiency
- the subject may have or be atfected by an inherited blood disorder (e.g., sickle cell anemia) or an autoimmune disorder.
- the subject may have or be affected by a malignancy, such as neuroblastoma or a hematologic cancer.
- the subject may have a leukemia, lymphoma, or myeloma.
- the subject has acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the subject has myeiodyspiastic syndrome.
- the subject has an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn's disease, Type 1 diabetes, or another autoimmune pathology described herein.
- the subject is in need of chimeric antigen receptor T-ceii (CART) therapy.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-A!drich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary !ymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Mallgnant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by
- a patient “in need of’ a hematopoietic stem cell transplant may one that is or is not suffering from one of the foregoing pathologies, but nonetheless exhibits a reduced level (e.g., as compared to that of an otherwise healthy subject) of one or more endogenous cell types within the hematopoietic lineage, such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen-presenting cells, macrophages, dendritic cells, natural killer cells, T- lymphocytes, and B-lymphocytes.
- endogenous cell types within the hematopoietic lineage such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosin
- FACS fluorescence activated cell sorting
- the term “recipient” refers to a patient that receives a transplant, such as a transplant containing a population of hematopoietic stem cells.
- the transplanted cells administered to a recipient may be, e.g., autologous, syngeneic, or allogeneic cells.
- sample refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) taken from a subject.
- a specimen e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells
- scFv refers to a single chain Fv antibody in which the variable domains of the heavy chain and the light chain from an antibody have been joined to form one chain.
- scFv fragments contain a single polypeptide chain that includes the variable region of an antibody (or bispecific binding protein as described herein) light chain (VL) (e.g., CDR-L1 , GDR-L2, and/or GDR- L3) and the variable region of an antibody (or bispecific binding protein as described herein) heavy chain (V H ) (e.g., CDR-H1 , CDR-H2, and/or CDR-H3) separated by a linker.
- VL light chain
- V H variable region of an antibody (or bispecific binding protein as described herein) heavy chain
- the linker that joins the V L and V H regions of a scFv fragment can be a peptide linker composed of proteinogenic amino acids.
- Alternative linkers can be used to so as to increase the resistance of the scFv fragment to proteolytic degradation (for example, linkers containing D-amino acids), in order to enhance the solubility of the scFv fragment (for example, hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues), to improve the biophysical stability of the molecule (for example, a linker containing cysteine residues that form intramolecular or intermolecular disulfide bonds), or to attenuate the immunogenicity of the scFv fragment (for example, linkers containing glycosyiation sites), it will also be understood by one of ordinary skill in the art that the variable regions of the scFv molecules described herein can be modified such that they vary in amino acid sequence from the antibody molecule
- nucleotide or amino acid substitutions leading to conservative substitutions or changes at amino acid residues can be made ⁇ e.g., in CDR and/or framework residues) so as to preserve or enhance the ability of the scFv to bind to the antigen recognized by the corresponding antibody or bispecific binding protein.
- the terms “subject” and “patient” refer to an organism, such as a human, that receives treatment for a particular disease or condition as described herein.
- a patient such as a human patient, may receive treatment prior to hematopoietic stem cell transplant therapy in order to promote the engraftment of exogenous hematopoietic stem cells.
- the phrase “substantially cleared from the blood” refers to a point in time following administration of a therapeutic agent (such as an anti-CD117 bispecific antibody, or antigen- binding fragment thereof) to a patient when the concentration of the therapeutic agent in a blood sample isolated from the patient is such that the therapeutic agent is not detectable by conventional means (for instance, such that the therapeutic agent is not detectable above the noise threshold of the device or assay used to detect the therapeutic agent).
- a therapeutic agent such as an anti-CD117 bispecific antibody, or antigen- binding fragment thereof
- a variety of techniques known in the art can be used to detect antibodies, antibody fragments, bispecific anitbodies and antigen-binding fragments thereof, such as EUSA-based detection assays known in the art or described herein. Additional assays that can be used to detect antibodies, or antibody fragments, bispecific anitbodies and antigen-binding fragments thereof, include immunoprecipitation fechniques and immunoblot assays, among others known in the art.
- stem cell disorder broadly refers to any disease, disorder, or condition that may be treated or cured by conditioning a subject's target tissues, and/or by ablating an endogenous stem cell population in a target tissue (e.g., ablating an endogenous hematopoietic stern or progenitor cell population from a subject's bone marrow tissue) and/or by engrafting or transplanting stem cells in a subject's target tissues.
- a target tissue e.g., ablating an endogenous hematopoietic stern or progenitor cell population from a subject's bone marrow tissue
- stem cells in a subject's target tissues e.g., ablating an endogenous hematopoietic stern or progenitor cell population from a subject's bone marrow tissue
- Type I diabetes has been shown to be cured by hematopoietic stem ceil transplant and may benefit from conditioning in accordance with the compositions and methods described herein.
- Additional disorders that can be treated using the compositions and methods described herein include, without limitation, sickle cell anemia, thalassemias, Fanconi anemia, aplastic anemia, Wiskott-Aldrich syndrome, ADA SCiD, HiV/AIDS, metachromatic leukodystrophy, Diamond- Biackfan anemia, and Schwachman- Diamond syndrome.
- Additional diseases that may be treated using the patient conditioning and/or hematopoietic stem ceil transplant methods described herein include inherited blood disorders (e.g., sickle cell anemia) and autoimmune disorders, such as scleroderma, multiple sclerosis, ulcerative colitis, and Crohn's disease.
- Additional diseases that may be treated using the conditioning and/or transplantation methods described herein include a malignancy, such as a neuroblastoma or a hematologic cancer, such as leukemia, lymphoma, and myeloma.
- the cancer may be acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- Additional diseases treatable using the conditioning and/or transplantation methods described herein include myelodysplastic syndrome.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingoiipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference
- transfection refers to any of a wide variety of techniques commonly- used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host ceil, such as electroporation, lipofection, calcium- phosphate precipitation, DEAE- dextran transfection and the like.
- treat refers to reducing the severity and/or frequency of disease symptoms, eliminating disease symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of disease symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by disease.
- beneficial or desired clinical results include, but are not limited to, promoting the engraftment of exogenous hematopoietic cells in a patient following antibody conditioning therapy as described herein and subsequent hematopoietic stem ceil transplant therapy.
- Additional beneficial results include an increase in the cell count or relative concentration of hematopoietic stem cells in a patient in need of a hematopoietic stem cell transplant following conditioning therapy and subsequent administration of an exogenous hematopoietic stem ceil graft to the patient.
- Beneficial results of therapy described herein may also Include an increase in the cell count or relative concentration of one or more cells of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting ceil, macrophage, dendritic cell, natural killer cell, T-lymphocyte, or B- lymphocyte, following conditioning therapy and subsequent hematopoietic stem ceil transplant therapy.
- hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting ceil, macrophage, dendritic cell, natural killer cell, T-lymphocyte, or B- lymphocyte
- Additional beneficial results may include the reduction in quantity of a disease-causing ceil population, such as a population of cancer cells (e.g., CD117+ leukemic cells) or autoimmune cells ⁇ e.g., CD117+ autoimmune lymphocytes, such as a CD117+ T-cell that expresses a T-cell receptor that cross-reacts with a self antigen).
- a disease-causing ceil population such as a population of cancer cells (e.g., CD117+ leukemic cells) or autoimmune cells ⁇ e.g., CD117+ autoimmune lymphocytes, such as a CD117+ T-cell that expresses a T-cell receptor that cross-reacts with a self antigen).
- the term "prevent” does not require that the disease state be completely thwarted. Rather, as used herein, the term preventing refers to the ability of the skilled artisan to identify a population that is susceptible to disorders, such that administration of the compounds of the present invention may occur prior to onset of a disease. The term does not imply that the disease state is completely avoided.
- variants and “derivative” are used interchangeably and refer to naturally-occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein.
- a variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
- vector includes a nucleic acid vector, such as a plasmid, a DNA vector, a plasmid, a RNA vector, virus, or other suitable repiicon.
- Expression vectors described herein may contain a polynucleotide sequence as well as, for example, additional sequence elements used for the expression of proteins and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
- Certain vectors that can be used for the expression of bispecific antibodies and bispecific antibody fragments of the invention include plasmids that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
- kits for expression of bispecific antibodies and bispecific antibody fragments contain polynucleotide sequences that enhance the rate of translation of these genes or improve the stability or nuclear export of the mRNA that results from gene transcription. These sequence elements may Include, for example, 5’ and 3’ untranslated regions and a polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- the expression vectors described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker include genes that encode resistance to antibiotics, such as arnpicillin, chloramphenicol, kanamycin, and nourseothricin.
- compositions and methods described herein are based on T cell mediated depletion of target cells, particularly HSCs as target cells which are depleted for conditioning.
- One advantage to the disclosure herein is the ability of the bispecific binding proteins, e.a.. an anti-CD3 / anti-HSC bispecific antibody, to deplete HSCs using immune-mediated cytotoxicity and without the need, or a reduced need, for cytotoxic agents or therapies that cause general ceil depletion, e.g., chemotherapy or irradiation.
- This targeted approach focuses on cells expressing antigens associated with the target cell population, e.g., HSCs, and minimizes the impact on cells that are not being targeted.
- ceil depletion is accomplished by directing T cells to the target cells using the bispecific proteins disclosed herein.
- anti-hematopoietic cell antibody or “anti-HC antibody” refers to an antibody that specifically binds an antigen expressed by hematopoietic stem cells, such as CD117 ⁇ e.g., GNNK+ CD117).
- a bispecific antibody, or a bispecific antigen-binding region thereof, may comprise a first binding moiety that is derived from an anti-HC antibody, e.g., a heavy and light chain combination specific for CD117.
- compositions and methods, including bispecifics, disclosed herein can be used to target cells expressing any target-specific antigen.
- compositions and methods disclosed herein are specific for antigens expressed on human HSCs, antigens such as CD7, CDw12, CD13, CD15, CD19, CD21 , CD22, CD29, CD30, CD33, CD34, CD36, CD38, CD40, CD41 , CD42a, CD42b, CD42C, CD42d, CD43, CD48, CD49b, CD49d, CD49e, CD49f, CD50, CD53, CD55, CD64a, CD68, CD71 , CD72, CD73, CD81 , CD82, CD85A, CD85K, CD90, CD99, CD104, CD105, CD109, CD110, GD111 , GD112, GD114, GD115, CD117, GD123, GD124, GD126, CD127, GD130, CD131 , CD133, GD135,
- the targeted cells comprise human hematopoietic stem cells expressing one or more markers that may be targeted, such antigens include CD11a, CD18, CD37, GD47, CD52, CD58, CD62L, CD69, CD74, CD97, GD103, GD132,
- the targeted cells are human hematopoietic stem cells expressing one or more markers that may be targeted by the anti-CD3 bispecific antibody disclosed herein, wherein the marker is CD7, GDw12, GD13, CD15, CD19, CD21 , CD22, CD29, CD30, CD33, CD34, CD36, CD38, CD40, CD41 , CD42a, CD42b, CD42c, CD42d, CD43, CD48, CD49b, CD49d, CD49e, CD49f, CD50, CD53, CD55, CD64a, CD68, GD71 , GD72, CD73, CD81 , CD82, CD85A, CD85K, CD90, CD99, CD104, CD105, CD109, CD110, CD111 , CD112, CD114, CD115, CD117, CD123
- the present disclosure provides bispecific antibodies comprising a first binding domain which binds to an antigen expressed on the surface of a hematopoietic stem ceil, and a second binding domain which binds to human CD3 on the surface of a T cell.
- the bispecific antibody binds to human CD3 epsilon.
- the anti-CD3 binding domain comprises antigen binding regions (variable regions or CDRs) from anti-CD3 antibodies described in US 10,851 ,170, US 10,933,132, US 10,781 ,264, US 10,738,130, and WO 2008/119567, each of which are hereby incorporated herein by reference in their entirety.
- the anti-CD3 binding domain of the bispecific antibody comprises heavy chain and a light chain variable regions as described in Table 4.
- the anti- CD3 binding domain of the bispecific antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3, and a light chain variable region comprising a GDR1 , GDR2 and GDR3 as described in Table 4.
- an anti-CD3 / anti-HC bispecific antibody, or bispecific antigen-binding fragment thereof comprises an anti-CD3 binding moiety comprising a light and/or heavy chain variable region that comprises an amino acid sequence having at least 95% identity to an anti-CD3 light and/or heavy chain variable region sequence described in Table 4, e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity
- an anti-CD3 / anti-HC bispecific antibody, or bispecific antigen-binding fragment thereof comprises a modified light or heavy chain variable region comprising a light and/or heavy chain variable domain of an anti-CD3 antibody described in Table 4, or a variant thereof, which variant (i) differs from the anti-CD3 antigen binding region in 1 , 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from the anti-CD3 antigen binding region in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii
- the anti-CD3 antigen binding region of the bispecific disclosed herein comprises a variabie iight chain (VL) region comprising CDR-L1 , CDR-L2 and CDR-L3 selected from the following sequences described in Table 4: (a) CDR-L1 as depicted in SEQ ID NO: 60, CDR-L2 as depicted in SEQ ID NO: 61 , and CDR-L3 as depicted in SEQ ID NO: 62; (b) CDR-L1 as depicted in SEQ ID NO: 108, CDR-L2 as depicted in SEQ ID NO: 109, and CDR-L3 as depicted in SEQ ID NO: 110; and (c) CDR-L1 as depicted in SEQ ID NO: 129, CDR-L2 as depicted in SEQ ID NO: 130, and CDR-L3 as depicted in SEQ ID NO: 131 .
- VL variabie iight chain
- the anti-CD3 antigen binding region of the bispecific disclosed herein comprises a variable heavy chain (VH) region comprising CDR-H1 , CDR-H2 and CDR-H3 selected from the following sequences described in Table 4: (a) CDR--H1 as depicted in SEQ ID NO: 51 , GDR- H2 as depicted in SEQ ID NO: 52, and CDR-H3 as depicted In SEQ ID NO: 53; (b) CDR-H1 as depicted in SEQ ID NO: 63, CDR-H2 as depicted in SEQ ID NO: 64, and CDR-H3 as depicted in SEQ ID NO: 65; (c) CDR-H1 as depicted in SEQ ID NO: 72, CDR-H2 as depicted in SEQ ID NO: 73, and CDR-H3 as depicted in SEQ ID NO: 74; (d) CDR-H1 as depicted in SEQ ID NO: 81 ,
- the anti-CD3 antigen binding region of the bispecifie disclosed herein comprises a VL region selected from the group consisting of a VL region as depicted in SEQ ID NQs: 67, 69, 115, 117, 136 or 138 of Table 4.
- the anti-CD3 antigen binding region of the bispecific disclosed herein comprises a VH region selected from the group consisting of a VH region as depicted in SEQ ID NOs: 54, 56, 66, 68, 75, 77, 84, 86, 93, 95, 102, 104, 114, 116, 123, 125, 135, 137, 144 or 146 of Table 4.
- the anti-CD3 antigen binding region of the bispecific disclosed herein comprises a VL region and a VH region selected from the group consisting of the following sequences described in Table 4: (a) a VL region as depicted in SEQ ID NO: 55 or 57, and a VH region as depicted in SEQ ID NO: 54 or 56; (b) a VL region as depicted in SEQ ID NO: 67 or 69, and a VH region as depicted in SEQ ID NO: 66 or 68; (c) a VL region as depicted In SEQ ID NO: 76 or 78, and a VH region as depicted in SEQ ID NO: 75 or 77; (d) a VL region as depicted in SEQ ID NO: 85 or 87, and a VH region as depicted in SEQ ID NO: 84 or 86; (e) a VL region as depicted in SEQ ID NO: 94 or 96, and
- the anti-CD3 binding domain comprises a pair of VH regions and VL regions disclosed herein (or variable regions having CDRs disclosed herein) in the format of a single chain antibody (scFv).
- the VH and VL regions are arranged in the order VH-VL or VL-VH.
- the VH-region Is positioned N-terminally of a linker sequence, and the VL-region Is positioned C-terminaily of the linker sequence.
- the anti-CD3 antigen binding region of the bispecific disclosed herein comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 58, 59, 70, 71 , 79, 80, 88, 89, 97, 98, 106, 107, 118, 1 19, 127, 128, 139, 140, 148 or 149 of Table 4.
- Anti-CD 117 / Anti-CD3 Bispecific Binding Proteins are amino acid sequence selected from the group consisting of SEQ ID NOs: 58, 59, 70, 71 , 79, 80, 88, 89, 97, 98, 106, 107, 118, 1 19, 127, 128, 139, 140, 148 or 149 of Table 4.
- bispecific binding proteins, or antigen-binding fragments thereof capable of binding a T cell specific antigen (e.g., CD3) and CD117, such as GNNK+ CD117, can be used as therapeutic agents to (i) treat cancers (such as acute myelogenous leukemia or myelodysplastic syndrome) and autoimmune diseases characterized by CD117+ cells and (ii) promote the engraftment of transplanted hematopoietic stem cells In a patient in need of transplant therapy.
- cancers such as acute myelogenous leukemia or myelodysplastic syndrome
- autoimmune diseases characterized by CD117+ cells characterized by CD117+ cells
- These therapeutic activities can be caused, for instance, by the binding of anti-CD117 bispecific antibodies, or antigen-binding fragments thereof, to CD117 (e.g., GNNK+
- CD117 expressed on the surface of a cell, such as a cancer cell, autoimmune cell, or hematopoietic stem cell and subsequently inducing cell death.
- a cell such as a cancer cell, autoimmune cell, or hematopoietic stem cell and subsequently inducing cell death.
- the depletion of endogenous hematopoietic stem cells can provide a niche toward which transplanted hematopoietic stern cells can home, and subsequently establish productive hematopoiesis.
- transplanted hematopoietic stem cells may successfully engraft in a patient, such as human patient suffering from a stem cell disorder described herein.
- bispecific binding polypeptides or fragments thereof, that bind to both CD117 and CD3.
- isolated nucleic acids polynucleotides
- cDNA complementary DNA
- vectors e.g., expression vectors
- methods of making such bispecific binding molecules, cells, and vectors are also provided herein.
- provided herein are methods and uses for treating various blood diseases, metabolic disorders, cancers, and autoimmune diseases, among others, using the bispecific binding polypeptides, nucleic adds, and/or vectors, described herein. Additionally, related compositions (e.g., pharmaceutical compositions), kits, and diagnostic methods are also provided herein.
- TCR T cell receptor
- Bispecific binding polypeptides, or fragments thereof capable of binding human CD117 can be used in conjunction with the compositions and methods described herein in order to condition a patient for hematopoietic stem ceil transplant therapy.
- Polymorphisms affecting the coding region or extracellular domain of CD117 in a significant percentage of the population are not currently well- known in non-oncology indications. There are at least four isoforms of CD117 that have been identified, with the potential of additional isoforms expressed in tumor cells.
- GNNK+ and GNNK- Two of the CD117 isoforms are located on the intracellular domain of the protein, and two are present in the external juxtamembrane region.
- the two extracellular isoforms, GNNK+ and GNNK- differ in the presence (GNNK+) or absence (GNNK-) of a 4 amino acid sequence. These isoforms are reported to have the same affinity for the ligand (SCF), but ligand binding to the GNNK- isoform was reported to Increase internalization and degradation.
- SCF ligand
- the GNNK+ isoform can be used as an immunogen in order to generate antibodies capable of binding CD117, as antibodies generated against this isoform will be inclusive of the GNNK+ and GNNK- proteins.
- CD3 is a T cell co-receptor comprised of a gamma chain, a delta chain, and two epsilon chains.
- CD3 is a human CD3.
- GenBankTM accession number NM_000073.2 (SEQ ID NO:31) provides an exemplary human CD3 gamma nucleic acid sequence
- GenBankTM accession number NP_000064.1 (SEQ ID NO: 32) provides an exemplary human CD3 gamma amino acid sequence.
- GenBankTM accession number NM 000732.4 (SEQ ID NO: 33) provides an exemplary human CD3 delta nucleic acid sequence.
- GenBankTM accession number NP__000723.1 provides an exemplary human CD3 delta amino acid sequence.
- GenBankTM accession number NM__000733.3 (SEQ ID NO: 35) provides an exemplary human CD3 epsilon nucleic acid sequence.
- GenBankTM accession number NP__000724.1 (SEQ ID NO: 38) provides an exemplary human CD3 epsilon amino acid sequence.
- a second binding domain which binds to human CD3 on the surface of a T cell comprising a VL region as depicted in SEQ ID NO: 38 and a VH region as depicted in SEQ ID NO: 37.
- the immunoglobulin in the bispeciflc binding molecules of the invention can be, as non-limiting examples, a monoclonal antibody, a naked antibody, a chimeric antibody, a humanized antibody, or a human antibody.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 13, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 14.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises the three CDR sequences of the heavy chain variable region (VH) amino acid sequence and the three CDR sequences of the light chain variable region (LH) amino acid sequence of Ab85.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises the heavy chain variable region (VH) amino acid sequence and the light chain variable region (LH) amino acid sequence of Ab85.
- VH variable region amino acid sequence
- VH CDR amino acid sequences of Ab85 are underlined below and are as follows: NYWIG (VH CDR1 ; SEQ ID NO: 7); llNPRDSDTRYRPSFQG (VH CDR2; SEQ ID NO: 8); and HGRGYEGYEGAFDI (VH CDR3: SEQ ID NO: 9).
- VL light chain variable region amino acid sequence of Ab85 is provided below as SEQ ID NO 14.
- the VL CDR amino add sequences of Ab85 are underlined below and are as follows: RSSQGIRSDLG (VL CDR1 ; SEQ ID NO: 10): DASNLET (VL CDR2; SEQ ID NO: 11 ; and QQANGFPLT (VL CDR3; SEQ ID NO: 12).
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises a heavy chain comprising a CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 7, 8, and 9, and a light chain comprising a CDR set as set forth in SEQ ID Nos: 10, 11 , and 12.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises the heavy chain variable region (VH) amino acid sequence and the light chain variable region (LH) amino add sequence of Ab67.
- VH variable region amino acid sequence of Ab67 is described in SEQ ID NO: 27.
- VH CDR amino acid sequences of Ab67 are as follows: FTFSDADMD (VH CDR1 : SEQ ID NO: 21); RTRNKAGSYTTEYAASVKG (VH CDR2; SEQ ID NO: 22): and AREPKYWIDFDL (VH CDR3; SEQ ID NO: 23).
- VL variable region amino acid sequence of Ab67 is provided below as SEQ ID NO 28.
- VL CDR amino acid sequences of Ab67 are underlined below' and are as follows: RASQSISSYLN (VL CDR1 ; SEQ ID NO: 24); AASSLQS (VL CDR2: SEQ ID NO: 25); and QQSYIAPYT (VL CDR3; SEQ ID NO: 26).
- the anti-CD117 bispecific antibody, or fragment thereof, as disclosed herein is capable of binding to a CD117 epitope, such as the epitope(s) described in WO 2020/219770, which is hereby incorporated herein by reference in its entirety.
- the anti-CD117 bispecific antibody, or fragment thereof, as disclosed herein is capable of binding to a CD117 epitope, such as the epitope(s) described in WO 2020/219748, which is hereby incorporated herein by reference in Its entirety.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof, as disclosed herein comprises a scFv that binds to CD3, which comprises the VH and the VL of a CD3-specific antibody known in the art, such as, for example, huQKT3 (see, for example, Adair et a!., 1994, Hum Antibodies Hybridomas 5:41 -47), YTH12.5 (see, for example Roufiedge et al. 1991 , Eur J Immunol, 21 : 2717-2725), HUM291 (see, for example, Norman et al.
- the scFv in an anti-CD117 bispecific binding polypeptide, or fragments thereof binds to the same epitope as a CD3-specific antibody known in the art.
- the scFv in a bispecific binding molecule of the invention binds to the same epitope as the CD3-specific antibody huOKTS. Binding to the same epitope can be determined by assays known to one skilled in the art, such as, for example, mutational analyses or crystallographic studies.
- the scFv competes for binding to CD3 with an antibody known in the art.
- the scFv in a bispecific binding molecule of the invention competes for binding to CD3 with the CD3-specific antibody huGKT3. Competition tor binding to CD3 can be determined by assays known to one skilled in the art, such as, for example, flow cytometry.
- the scFv comprises a VH with at least 85%, 90%, 95%, 98%, or at least 99% similarity to the VH of a CD3-specific antibody known in the art.
- the scFv comprises the VH of a CD3-specific antibody known in the art, comprising between 1 and 5 conservative amino acid substitutions.
- the scFv comprises a VL with at least 85%, 90%, 95%, 98%, or at least 99% similarity to the VL of a CD3-specific antibody known in the art. In certain embodiments, the scFv comprises the VL of a CD3-speeiiie antibody known in the art, comprising between 1 and 5 conservative amino add substitutions.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof, described herein may also include modifications and/or mutations that alter the properties of the antibodies and/or fragments, such as those that increase half-life, increase or decrease ADCC, etc., as is known in the art.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises a variant Fc region, wherein said variant Fc region comprises at least one amino add modification relative to a wiid-type Fc region, such that said molecule has an altered affinity for an Fc gammaR. Certain amino acid positions within the Fc region are known through crystallography studies to make a direct contact with FcyR.
- amino acids 234-239 (hinge region), amino acids 265-269 (B/G loop), amino acids 297-299 (C7E loop), and amino acids 327-332 (F/G) loop, (see Sondermann et al., 2000 Nature, 406: 267-273).
- amino add substitutions at amino acid positions 234 and 235 of the Fc region have been identified as decreasing affinity of an lgG antibody for binding to an Fc receptor, particularly an Fc gamma receptor (FcyR).
- an anti- CD117 antibody described herein comprises an Fc region comprising an amino acid substitution at L234 and/or L235, e.g., L234A and L235A (Eli index).
- the anti-CD117 bispecific binding polypeptides, or fragments thereof described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an FcyR based on structural and crystallographic analysis.
- the Fc region ot the anti-CD117 bispecific binding polypeptides, or fragments thereof (or Fc containing fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et a!., Sequences of Proteins of immunological Interest, 5th Ed. Public Health Service, NH1 , MD (1991), expressly incorporated herein by references.
- the "EU index as in Kabat” or “EU index” refers to the numbering of the human lgG1 EU antibody and is used herein in reference to Fc amino acid positions unless otherwise indicated.
- the Fc region comprises a D265A mutation. In one embodiment, the Fc region comprises a D265C mutation.
- the Fc region of the anti-CD117 bispecific binding polypeptides, or fragments thereof (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat. in one embodiment, the Fc region comprises a L234A mutation. In some embodiments, the Fc region of the anti-CD117 bispecific binding polypeptides, or fragments thereof (or fragment thereof) comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat. in one embodiment, the Fc region comprises a L235A mutation, in yet another embodiment, the Fc region comprises a L234A and L235A mutation, in a further embodiment, the Fc region comprises a D265C, L234A, and L235A mutation.
- a variant lgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an Fc gammaR and/or C1q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
- Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- a bispecific binding polypeptides, or fragments thereof comprising a modified Fc region e.g., comprising a L234A, L235A, and a D265C mutation
- Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al.
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al.
- binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from fhe data by scatchard plot analysis.
- an anti-CD117 bispecific binding polypeptides, or fragments thereof described herein comprises an Fc region comprising L235A, L235A, and D265C (Eli index).
- the bispecific binding polypeptides, or fragments thereof of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dail'Acqua et al. (2006) J Biol Chem 281 : 23514-24), (Zalevsky et al.
- the Fc region comprises a mutation resulting in a decrease in half life.
- a bispecific binding polypeptides, or fragments thereof, having a short half life may be advantageous in certain instances where the bispecific binding polypeptides, or fragments thereof, is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the bispecific binding polypeptides, or fragments thereof, is administered followed by HSCs.
- the bispecific binding polypeptides, or fragments thereof would be substantially cleared prior to delivery of the HSCs, which also generally express CD117 but are not the target of the anti-CD1 17 bispecific binding polypeptides, or fragments thereof, unlike the endogenous stem cells
- the Fc region comprises a mutation at position 435 (EU index according to Kabat).
- the mutation is an H435A mutation
- the mutation is a D265C mutation.
- the mutations are an H435A mutation and a D265C mutation.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof described herein have a half life of equal to or less than 24 hours, equal to or less than 22 hours, equal to or less than 20 hours, equal to or less than 18 hours, equal to or less than 16 hours, equal to or less than 14 hours, equal to or less than 13 hours, equal to or less than 12 hours, equal to or less than 11 hours, equal to or less than 10 hours, equal to or less than 9 hours, equal to or less than 8 hours, equal to or less than 7 hours, equal to or less than 6 hours, or equal to or less than 5 hours, in one embodiment, the half life of the antibody is 5 hours to 7 hours; is 5 hours to 9 hours; is 15 hours to 11 hours; is 5 hours to 13 hours; is 5 hours to 15 hours; is 5 hours to 20 hours; is 5 hours to 24 hours; Is 7 hours to 24 hours; is 9 hours to 24 hours: is 11 hours to 24 hours; 12 hours to 22 hours; 10 hours to 20 hours; 8 hours to 18 hours; or 14 hours to 24 hours, equal
- Anti-CD117 bispecific binding polypeptides, or fragments thereof, that can be used in conjunction with the patient conditioning methods described herein include, for Instance, antibody portions produced and released from ATCC Accession No. 10716 (deposited as BA7.3C.9), such as the SR-1 antibody, which is described, for example, in US Patent No. 5,489,516, the disclosure of which is incorporated herein by reference as it pertains to anti-CD117 antibodies.
- an anti-CD117 bispecific binding polypeptides, or fragments thereof described herein comprises an Fc region comprising L235A, L235A, D265G, and H435A (EU index).
- Additional anti-CD117 bispecific binding polypeptides, or fragments thereof that can be used in conjunction with the patient conditioning methods described herein include those described in US Patent No. 7,915,391 , which describes, e.g., humanized SR-1 antibodies; US Patent No.
- 5,808,002 which describes, e.g., the anti-CD117 A3G6E2 antibody, as well as those described in, for example, WO 2015/050959, which describes anti-CD117 antibodies that bind epitopes containing Pro317, Asn320, Glu329, Val331 , Asp332, Lus358, Giue360, Glue378, His378, and/or Thr380 of human CD117; and US 2012/0288506 (also published as US Patent No.
- the anti-CD117 antibody CK6 having the CDR sequences of: a CDR-H1 having the amino acid sequence SYWIG (SEQ ID NO: 1); a CDR-H2 having the amino acid sequence IIYPCD3 DTRYSPSFQG (SEQ ID NO: 2); a CDR-H3 having the amino acid sequence HGRGYNGYEGAFDI (SEQ ID NO: 3); a CDR-L1 having the amino acid sequence RASQGISSALA (SEQ ID NO: 4); a CDR-L2 having the amino acid sequence DASSLES (SEQ ID NO: 5); and a GDR-L3 having the amino acid sequence GQQFNSYPLT (SEQ ID NO: 6)
- the heavy chain variable region amino acid sequence of CK6 is provided in SEQ ID NO: 27): QVQLVQSGAAVKKPGESLKISCKGSGYRFTSYWIGWVRQMPGKGLEWMGIIYFGDSDTRYSPSFQG QVTl SAGKSISTAYLQWSSLKASDTAMYYCARHGRGYNGYEGAFDIWGQGTMVTVSS (SEQ ID NO: 29; GDRs are underlined are in bold).
- the light chain amino acid variable sequence of CK6 is provided in SEQ ID NO: 28:
- Additional anti-CD117 bispecific binding polypeptides, or fragments thereof that may be used in conjunction with the compositions and methods described herein include those described in US 2015/0320880, such as the clones 9P3, NEG024, NEG027, NEG085, NEG086, and 20376.
- Anti-CD117 bispecific binding polypeptides, or fragments thereof that may be used in conjunction with the compositions and methods described herein include the above-described antibodies and antigen-binding fragments thereof, as well as humanized variants of those non-human antibodies and antigen-binding fragments described above and antibodies or antigen-binding fragments that bind the same epitope as those described above, as assessed, for instance, by way of a competitive CD117 binding assay.
- Exemplary antigen-binding fragments of the foregoing antibodies include a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab’)2 molecule, and a tandem di- scFv, among others.
- scFv single-chain Fv molecule
- Anti-CD117 bispecific binding polypeptides, or fragments thereof may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567.
- isolated nucleic acid encoding an anti-CD117 bispecific binding polypeptides, or fragments thereof described herein is provided.
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody ⁇ e.g., the light and/or heavy chains of the antibody).
- one or more vectors e.g., expression vectors
- a host cell comprising such nucleic acid is provided.
- a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic add that encodes an amino acid sequence comprising the VH of the antibody, in one embodiment, the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, 8p20 cell).
- CHO Chinese Hamster Ovary
- a method of making an anti-CLL-1 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host ceil culture medium).
- nucleic add encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host ceil.
- nucleic add may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosy!ation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Voi. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coll.)
- the antibody may be isolated from the bacterial ceil paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et a!., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoii cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1); African green monkey kidney cells (VERG-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells ⁇ Ur!aub et al., Proc. Natl. Acad. Sci.
- myeloma cell lines such as Y0, NS0 and Sp2/0.
- myeloma cell lines such as Y0, NS0 and Sp2/0.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEG ID Nos disclosed herein.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises a heavy chain variable region and a heavy chain constant region having an amino acid sequence that is disclosed herein.
- the anti-CD117 bispecific binding polypeptides, or fragments thereof comprises a light chain variable region and a light chain constant region having an amino acid sequence that is disclosed herein
- the anti- GDI 17 bispecific binding polypeptides, or fragments thereof comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region and a light chain constant region having an amino acid sequence that is disclosed herein.
- Bispecific antibodies can be prepared according to standard methods known in the art, including, in some embodiments, as either full length antibodies or as antibody fragments (e.g. F(ab)2 bispecific antibodies, etc.).
- Traditional production of full length bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities. Due to the random pairing of immunoglobulin heavy and light chains, a potential mixture of different antibody molecules may be produced, with generally one correct pairing of the bispecific heterodimer. Purification of the correct heterodimer molecule is usually done by affinity chromatography.
- Bispecific antibodies may also be produced using heavy chain heterodimerization methods.
- Such methods include the “knob-in-hole” method, which is described in e.g., U.S. Pat. No. 7,695,936, U.S. Pat. No. 5,807,706 and U.S. Patent Application Publication 2003/0078385, which are hereby incorporated herein by reference in their entirety, in the “knob-in-hole” method, a “protrusion” is generated by replacing one or more small amino acid side chains (e.g. alanine or threonine) from the interface of a first antibody molecule with larger side chains (e.g. tyrosine or tryptophan).
- small amino acid side chains e.g. alanine or threonine
- Compensatory “cavities” of identical or similar size to the large side chain(s) are created on the interface of a second antibody molecule by replacing amino acid having large side chains with amino acids having smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- an Fc region contains one pair of knobs and holes substitutions.
- the Fc region of a first heavy chain i.e., chain A
- the Fc region of a second heavy chain i.e., chain B
- chain A contains one or more amino acid substitutions
- chain B contains one or more amino acid substitutions
- knobs and holes substitutions in chain A and chain B of an lgG1 Fc region have been found to increase heterodimer formation as compared with fhaf found with unmodified chain A and chain B: 1) Y407T in chain A and T366Y in chain B; 2) Y407A in chain A and T366W in chain B; 3) F405A in chain A and T394W in chain B; 4) F405W in chain A and T394S in chain B; 5) Y407T in chain A and T366Y in chain B; 6) T366Y and F405A in chain A and T394W and Y407T in chain B; 7) T366W and F405W in chain A and T394S and Y407A in chain B; 8) F4Q5W and Y407A in chain A and T366W and T394S in chain B; and 9) T366W in chain A and T366S, L368A
- substitutions changing the charge of one or more amino acid residue can enhance heterodimer formation as described in WO 2009/089004, which is hereby incorporated herein by reference in its entirety.
- Such substitutions are referred to herein as “charge pair substitutions,” and thus, an Fc region containing one or more charge pair substitutions in the A chain may contain different substitufion(s) in the B chain.
- charge pair substitutions include the following: 1) K409D or K409E in chain A and D399K or D399R in chain B; 2) K392D or K392E in chain A and D399K or D399R in chain B; 3) K439D or K439E in chain A and E356K or E356R in chain B; and 4) K370D or K370E in chain A and E357K or E357R in chain B.
- the bispecific antibodies, or portions thereof may aiso be produced using a common light chain, Use of a common light chain can decrease the number of possible mispairings, as described in WO 98/50431 , the contents of which are incorporated by reference in its entirety.
- the method of producing a bispecific antibody using the “knob-in-hoie” method includes incubating a first protein molecule comprising a heavy chain wifh the “knob” mutation together with a second protein molecule comprising a heavy chain wifh the “hole” mutation under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide-bond isomerization. Examples of suitable conditions are described in U.S.
- the minimal requirements for the cysteines in the hinge region for undergoing disulfide-bond isomerization may differ depending on the homodimeric starting proteins, in particular depending on the exact sequence in the hinge region, in some embodiments, the respective homodimeric interactions of the first and the second heavy chain CHS regions with the “knob” and “hole” mutations are sufficiently weak to allow cysteines in the hinge region to undergo disulfide-bond isomerization under the given conditions, in some embodiments, the reducing conditions include the addition of a reducing agent, e.g.
- a reducing agent selected from the group consisting ot: tripeptide glutathione (GSH), 2-mercaptoethylamine (2- MBA), dithiothreitoi (DTT), dithioerythritol (DTE), glutathione, tris(2- carboxyethyl)phosphine (TCEP), L-cysteine and beta-mercapto-ethanol.
- GSH tripeptide glutathione
- 2- MBA 2-mercaptoethylamine
- DTT dithiothreitoi
- DTE dithioerythritol
- glutathione glutathione
- TCEP tris(2- carboxyethyl)phosphine
- L-cysteine beta-mercapto-ethanol
- the reaction is performed under reducing conditions with a redox potential ranging below -50 mV, such as below -150 mV, between -150 and -600 mV, such as between -200 and -500 mV, between -250 and -450 mV, such as between -250 and -400 mV, between -260 and -300 mV.
- a redox potential ranging below -50 mV, such as below -150 mV, between -150 and -600 mV, such as between -200 and -500 mV, between -250 and -450 mV, such as between -250 and -400 mV, between -260 and -300 mV.
- a redox potential ranging below -50 mV, such as below -150 mV, between -150 and -600 mV, such as between -200 and -500 mV, between -250 and -450 mV,
- variant heavy chain molecules provided herein produced using the “knob-in-hoie” method may be useful for the generation of bispecitic antibodies and overcome the limitations and technical difficulties (e.g., improper pairing) noted above,
- one heavy chain and one light chain within an antibody are modified whereby a native cysteine is substituted by a non-cysteine amino acid, and a native non-cysteine amino acid is substituted by a cysteine amino acid.
- modifications provided herein are generated in the heavy chain (HC) and light chain (LC) domains and result in the relocation of an HG--LC interchain disulfide bridge.
- the four polypeptides when generating a bispecific antibody from four separate polypeptides, for example, where the modified arm has a binding specificity for one target and the unmodified arm has a binding specificity for a different target, the four polypeptides will assemble such that the modified heavy chain polypeptide properly hybridizes with the modified light chain and the unmodified heavy chain properly hybridizes with the unmodified light chain.
- the term “unmodified” refers to heavy and light chains that do not contain the HC-LC modifications (e.g., “knob-in-hole” or the cysteine modifications) as described herein in the CH2 and/or CHS regions described herein and/or known in the art.
- the HC-LC modifications provided herein can be combined with further modifications of the heavy chain, particularly in the CH2 and/or GH3 regions to ensure proper heavy chain heterodimerization and/or to enhance purification of the heavy chain heterodimer.
- Methods for high throughput screening ot blspecitic binding proteins, or fragments thereof, libraries for molecules capable of binding CD117 can be used to identify and affinity mature antibodies useful for treating cancers, autoimmune diseases, and conditioning a patient (e.g., a human patient) in need of hematopoietic stem cell therapy as described herein.
- Such methods include in vitro display techniques known in the art, such as phage display, bacterial display, yeast display, mammalian ceil display, ribosome display, mRNA display, and cDNA display, among others.
- phage display to isolate ligands that bind biologically relevant molecules has been reviewed, for example, in Felici et a!., Biotechnol. Annual Rev. 1 :149-183, 1995; Katz, Annual Rev. Biophys. Biomol. Struct. 28:27-45, 1997; and Hoogenboom et a!., Immunotechnoiogy 4:1-20, 1998, the disclosures of each of which are incorporated herein by- reference as they pertain to in vitro display techniques. Randomized combinatorial peptide libraries have been constructed to select for polypeptides that bind cell surface antigens as described in Kay, Perspect. Drug Discovery Des. 2:251-268, 1995 and Kay et a!., Moi. Divers.
- Proteins such as multimeric proteins, have been successfully phage- displayed as functional molecules (see, for example, EP 0349578; EP 4527839; and EP 0589877, as well as Chiswe!i and McCafferty, Trends BiotechnoL 10:80-84 1992, the disclosures of each of which are incorporated herein by reference as they pertain to the use of in vitro display techniques for the discovery of antigen-binding molecules).
- CD117 e.g., GNNK+ CD117
- CD3 bind CD117
- computational modeling techniques can be used to design and identify bispecific binding proteins, or fragments thereof, in silico that bind CD117 (e.g., GNNK+ CD117) (and/or CD3).
- bispecific binding proteins, antibodies, or antibody fragments can be screen libraries of bispecific binding proteins, antibodies, or antibody fragments, in silico for molecules capable of binding specific epitopes, such as extracellular epitopes of this antigen.
- the bispecific binding proteins, antibodies, or antigen-binding fragments thereof, identified by these computational techniques can be used in conjunction with the therapeutic methods described herein, such as the cancer and autoimmune disease treatment methods described herein and the patient conditioning procedures described herein.
- Additional techniques can be used to identify bispecific binding proteins, antibodies, or antigen-binding fragments thereof, that bind CD117 (e.g., GNNK+ CD117) (and/or CD3) on the surface of a cell (e.g., a cancer ceil, autoimmune ceil, or hematopoietic stem cell) and that are internalized by the cell, for instance, by receptor-mediated endocytosis.
- CD117 e.g., GNNK+ CD117
- CD3 e.g., a cancer ceil, autoimmune ceil, or hematopoietic stem cell
- the in vitro display techniques described above can be adapted to screen for bispecific binding proteins, antibodies, or antigen-binding fragments thereof, that bind CD117 (e.g., GNNK+ CD117) (and/or CD3) on the surface of a cancer ceil, autoimmune cell, or hematopoietic stem ceil and that are subsequently internalized.
- Phage display represents one such technique that can be used in conjunction with this screening paradigm.
- antibodies, or fragments thereof, that bind CD117 e.g., GNNK+ CD117
- CD117 e.g., GNNK+ CD117
- CD3 e.g., GNNK+ CD117
- recombinant phage libraries can be produced that encode bispecific binding proteins, antibodies, antibody fragments, such as scFv fragments, Fab fragments, diabodies, triabodies, and 10 Fn3 domains, among others, that contain randomized amino acid cassettes (e.g., in one or more, or ail, of the CDRs or equivalent regions thereof or a bispecific binding proteins, antibody or antibody fragment).
- the framework regions, hinge, Fc domain, and other regions of the bispecific binding proteins, antibodies or antibody fragments may be designed such that they are non- immunogenic in humans, for instance, by virtue of having human germiine antibody sequences or sequences that exhibit only minor variations relative to human germiine antibodies.
- phage libraries containing randomized bispecific binding proteins, antibodies, or antibody fragments, covalently bound to the phage particles can be incubated with CD117 (e.g., GNNK+ CD117) (and/or CD3) antigen, for instance, by first incubating the phage library with blocking agents (such as, for instance, milk protein, bovine serum albumin, and/or IgG so as to remove phage encoding bispecific binding proteins, antibodies, or fragments thereof, that exhibit non-specific protein binding and phage that encode bispecific binding proteins, antibodies or fragments thereof that bind Fc domains, and then incubating the phage library with a population of hematopoietic stem cells.
- CD117 e.g., GNNK+ CD117
- CD3 antigen for instance, by first incubating the phage library with blocking agents (such as, for instance, milk protein, bovine serum albumin, and/or IgG so as to remove phage encoding bispecific binding proteins, antibodies, or
- the phage library can be incubated with the target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to allow anti-CD117-specific bispecific binding proteins, antibodies, or antigen- binding fragments thereof, (e.g., GNNK ⁇ CD117-specific antibodies, or antigen-binding fragments thereof) to bind cell-surface CD117 (e.g., sell-surface GNNK+ CD117) (and/or CD3) antigen and to subsequently be internalized by the cancer cells, autoimmune cells, or hematopoietic stem cells (e.g., from 30 minutes to 8 hours at 4° C, such as 1 hour at 4° C).
- the target cells such as cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to allow anti-CD117-specific bispecific binding proteins, antibodies, or antigen- binding fragments thereof, (e.g., GNNK ⁇ CD117-specific antibodies, or antigen-binding fragments thereof) to
- Phage containing bispeclfic binding proteins, antibodies, or fragments thereof, that do not exhibit sufficient affinity for one or more of these antigens so as to permit binding to, and internalization by, cancer cells, autoimmune cells, or hematopoietic stem cells can subsequently be removed by washing the cells, for instance, with cold (4° C) 0.1 M glycine buffer at pH 2.8.
- Phage bound to bispeclfic binding proteins, antibodies, or fragments thereof, or that have been internalized by the cancer cells, autoimmune cells, or hematopoietic stern cells can be identified, for instance, by lysing the cells and recovering internalized phage from the cell culture medium.
- the phage can then be amplified in bacterial cells, for example, by incubating bacterial cells with recovered phage in 2xYT medium using methods known in the art. Phage recovered from this medium can then be characterized, for instance, by determining the nucleic acid sequence of the gene(s) encoding the bispecific binding proteins, antibodies, or fragments thereof, inserted within the phage genome.
- the encoded bispecific binding proteins, antibodies, or fragments thereof, or can subsequently be prepared de novo by chemical synthesis (for instance, of antibody fragments, such as scFv fragments) or by recombinant expression ⁇ for instance, of full-length antibodies).
- bispecific binding proteins, antibodies, or fragments thereof can be assessed, for instance, using radionuclide internalization assays known in the art.
- bispecific binding proteins, antibodies, or fragments thereof, identified using in vitro display techniques described herein or known in the art can be functionalized by incorporation of a radioactive isotope, such as
- radioactive halogens such as 18 F, 75 Br
- beads such as polystyrene beads, containing electrophilic halogen reagents (e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA).
- Radiolabeled bispecific binding proteins, antibodies, or fragments thereof can be incubated with cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to permit internalization (e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C). The cells can then be washed to remove non- internalized antibodies, or fragments thereof, (e.g., using cold (4° C) 0.1 M glycine buffer at pH 2.8).
- internalized bispecific binding proteins, antibodies, or fragments thereof can be identified by detecting the emitted radiation (e.g., g- radiation) of the resulting cancer cells, autoimmune cells, or hematopoietic stem cells in comparison with the emitted radiation (e.g., y-radiation) of the recovered wash buffer.
- emitted radiation e.g., g- radiation
- autoimmune cells e.g., IL-12
- hematopoietic stem cells e.g., y-radiation
- hematopoietic stem ceil transplant therapy can be administered to a subject in need of treatment so as to populate or re-populate one or more blood cell types.
- Hematopoietic stem cells generally exhibit multi-potency, and can thus differentiate into multiple different blood lineages Including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryobiasfs, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T- cells).
- granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
- erythrocytes e.g., reticulocytes, erythrocytes
- thrombocytes e.
- Hematopoietic stem cells are additionally capable of self-renewal, and can thus give rise to daughter cells that have equivalent potential as the mother cell, and also feature the capacity to be reintroduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and re-establish productive and sustained hematopoiesis.
- Hematopoietic stem cells can thus be administered to a patient defective or deficient in one or more cell types of the hematopoietic lineage in order to re-constitute the defective or deficient population of cells in vivo, thereby treating the pathology associated with the defect or depletion in the endogenous blood ceil population.
- the compositions and methods described herein can thus be used to treat a non-malignant hemoglobinopathy (e.g., a hemoglobinopathy selected from the group consisting of sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome).
- compositions and methods described herein can be used to treat an immunodeficiency, such as a congenital immunodeficiency. Additionally or alternatively, the compositions and methods described herein can be used to treat an acquired immunodeficiency (e.g., an acquired immunodeficiency selected from the group consisting of HIV and AIDS). The compositions and methods described herein can be used to treat a metabolic disorder (e.g., a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy).
- a metabolic disorder e.g., a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy.
- compositions and methods described herein can be used to treat a malignancy or proliferative disorder, such as a hematologic cancer, myeloproliferative disease.
- a malignancy or proliferative disorder such as a hematologic cancer, myeloproliferative disease.
- the compositions and methods described herein may be administered to a patient so as to deplete a population of endogenous hematopoietic stem cells prior to hematopoietic stem cell transplantation therapy, in which case the transplanted cells can home to a niche created by the endogenous ceil depletion step and establish productive hematopoiesis. This, In turn, can re-constitute a population of cells depleted during cancer cell eradication, such as during systemic chemotherapy.
- Exemplary hematological cancers that can be treated using the compositions and methods described herein include, without limitation, acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, and non-Hodgkin's lymphoma, as well as other cancerous conditions, including neuroblastoma.
- Additional diseases that can be treated with the compositions and methods described herein include, without limitation, adenosine deaminase deficiency and severe combined immunodeficiency, hyper immunoglobulin M syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, and juvenile rheumatoid arthritis.
- the anti-CD3 / anti-HC bispecific binding proteins, antibodies, antigen-binding fragments thereof, and conjugates described herein may be used to induce solid organ transplant tolerance.
- the compositions and methods described herein may be used to deplete or ablate a population of cells from a target tissue (e.g,, to deplete hematopoietic stem cells from the bone marrow stem cell niche).
- a population of stem or progenitor cells from an organ donor may be administered to the transplant recipient, and following the engraftment of such stem or progenitor cells, a temporary or stable mixed chimerism may be achieved, thereby enabling long-term transplant organ tolerance without the need for further immunosuppressive agents.
- the compositions and methods described herein may be used to induce transplant tolerance in a solid organ transplant recipient (e.g., a kidney transplant, lung transplant, liver transplant, and heart transplant, among others).
- the compositions and methods described herein are well-suited for use in connection the induction of solid organ transplant tolerance, for instance, because a low percentage temporary or stable donor engraftment is sufficient to induce long-term tolerance of the transplanted organ.
- compositions and methods described herein can be used to treat cancers directly, such as cancers characterized by cells that are CD117+.
- cancers characterized by cells that are CD117+.
- the compositions and methods described herein can be used to treat leukemia, particularly in patients that exhibit CD117+ leukemic cells.
- the compositions and methods described herein can be used to treat various cancers directly.
- Exemplary cancers that may be treated in this fashion include hematological cancers, such as acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, and non-Hodgkin's lymphoma.
- Acute myeloid leukemia is a cancer of the myeloid line of blood cells, characterized by the rapid growth of abnormal white blood cells that build up in the bone marrow and interfere with the production of normal blood cells.
- AML is the most common acute leukemia affecting adults, and Its incidence increases with age.
- the symptoms of AML are caused by replacement of normal bone marrow with leukemic cells, which causes a drop in red blood cells, platelets, and normal white blood cells.
- AML progresses rapidly and may be fatal within weeks or months if left untreated.
- the anti-CD117 bispecific binding proteins described herein are used to treat AML in a human patient in need thereof, in certain embodiments the anti-CD117 bispecific binding proteins treatment depletes AML cells in the treated subjects. In some embodiments 50% or more of the AML ce!is are depleted, in other embodiments, 60% or more of the AML cells are depleted, or 70% or more of the AML cells are depleted, or 80% of more or 90% or more, or 95% or more of the AML cells are depleted. In certain embodiments the anti-CD117 bispecific binding proteins treatments are a single dose treatment, in certain embodiments the single dose anti-CD117 bispecific binding proteins treatment depletes 60%, 70%, 80%, 90% or 95% or more of the AML cells.
- compositions and methods described herein can be used to treat autoimmune disorders.
- an anti-CD3 / CD117 bispecific antibody, or antigen-binding fragment thereof can be administered to a subject, such as a human patient suffering from an autoimmune disorder, so as to kill a CD117+ immune cell.
- the CD117+ immune cell may be an autoreactive lymphocyte, such as a T- cell that expresses a T-cell receptor that specifically binds, and mounts an immune response against, a self antigen.
- the compositions and methods described herein can be used to treat autoimmune pathologies, such as those described below.
- compositions and methods described herein can be used to treat an autoimmune disease by depleting a population of endogenous hematopoietic stem cells prior to hematopoietic stem cell transplantation therapy, In which case the transplanted cells can home to a niche created by the endogenous ceil depletion step and establish productive hematopoiesis. This, in turn, can re-constitute a population of cells depleted during autoimmune cell eradication.
- Autoimmune diseases that can be treated using the compositions and methods described herein include, without limitation, psoriasis, psoriatic arthritis, Type 1 diabetes mellitus (Type 1 diabetes), rheumatoid arthritis (RA), human systemic lupus (SLE), multiple sclerosis (MS), inflammatory bowel disease (IBD), lymphocytic colitis, acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune iymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas’ disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demye!inating polyneur
- the anti-CD117 / CD3 bispecific binding proteins, antibodies, or antigen-binding fragments thereof, or described herein can be administered to a patient (e.g., a human patient suffering from cancer, an autoimmune disease, or in need of hematopoietic stem cell transplant therapy) in a variety of dosage forms.
- a patient e.g., a human patient suffering from cancer, an autoimmune disease, or in need of hematopoietic stem cell transplant therapy
- bispecific antibody binding proteins, or antigen-binding fragments thereof, described herein can be administered to a patient suffering from cancer, an autoimmune disease, or in need of hematopoietic stem cell transplant therapy in the form of an aqueous solution, such as an aqueous solution containing one or more pharmaceutically acceptable excipients.
- Pharmaceutically acceptable excipients for use with the compositions and methods described herein include viscosity-modifying agents.
- the aqueous solution may be sterilized using techniques known in the art.
- compositions comprising the anti-CD117 / CD3 bispecific binding proteins as described herein are prepared by mixing anti-CD117 / CD3 bispecific binding proteins with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of iyophiiized formulations or aqueous solutions.
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyciohexanol; 3-pentanoi; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
- the anti-CD117/ CD3 bispecific binding proteins or antigen-binding fragments, described herein may be administered by a variety of routes, such as orally, transdermaily, subcutaneously, intranasally, intravenously, intramuscularly, intraoculariy, or parenterally.
- routes such as orally, transdermaily, subcutaneously, intranasally, intravenously, intramuscularly, intraoculariy, or parenterally.
- the most suitable route for administration in any given case will depend on the particular anti-CD117 bispecific binding proteins, or antigen-binding fragment, administered, the patient, pharmaceutical formulation methods, administration methods (e.g., administration time and administration route), the patient's age, body weight, sex, severity of the diseases being treated, the patient's diet, and the patient's excretion rate.
- the effective dose of an anti-CD117/ CD3 bispecific binding proteins, or antigen-binding fragment thereof, described herein can range, for example from about 0.001 to about 100 mg/kg of body weight per single (e.g., bolus) administration, multiple administrations, or continuous administration, or to achieve an optimal serum concentration (e.g., a serum concentration of 0.0001- 5000 ⁇ g/mL) of the antibody, antigen-binding fragment thereof.
- the dose of the anti-CD117 / CD3 bispecific binding proteins administered to the human patient is about 0.1 mg/kg to about 0.3 mg/kg. in one embodiment, the dose of the anti-CD117/ CD3 bispecific binding proteins administered to the human patient is about 0.15 mg/kg to about 0.3 mg/kg. in one embodiment, the dose of the anti-CD117/ CD3 bispecific binding proteins administered to the human patient Is about 0.15 mg/kg to about 0.25 mg/kg.
- the dose of the anfi-CD117/ CD3 bispecific binding proteins administered to the human patient is about 0.2 mg/kg to about 0.3 mg/kg.
- the dose of the anti-CD117/ CD3 bispecific binding proteins administered to the human patient is about 0.25 mg/kg to about 0.3 mg/kg.
- the dose of the anti-CD117/ CD3 bispecific binding proteins administered to the human patient is about 0.1 mg/kg. in one embodiment, the dose of the anti-CD117/ CD3 bispecific binding proteins administered to the human patient is about 0.2 mg/kg.
- the dose of the anti-CD117/ CD3 bispecific binding proteins administered to the human patient is about 0.3 mg/kg.
- the dose may be administered one or more times (e.g., about 2-10 times) per day, week, or month to a subject (e.g., a human) suffering from cancer, an autoimmune disease, or undergoing conditioning therapy in preparation for receipt of a hematopoietic stem cell transplant.
- anti-CD117 bispecific binding proteins, or antigen-binding fragment thereof can be administered to the patient at a time that optimally promotes engraftment of the exogenous hematopoietic stem cells, for instance, from about 1 hour to 1 week (e.g., 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days) or more prior to administration of the exogenous hematopoietic stem cell transplant.
- 1 hour to 1 week e.g., 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21
- each bispecific antibody also comprises a LALA mutation in its Fc regions. Amino acid sequences of the binding regions of these bispecific anitbodies are described in Table 4.
- Bispecific antibody bs-Ab-1 having a CD117-antigen binding arm and a CD3-antigen binding arm was prepared using the “knob-in-hole” heterodimerization technology using antigen binding regions from anti-CD117 antibody Ab85 and antigen binding regions from an an ⁇ i-CD3 antibody Ab2 as described below.
- bs-Ab-1 comprises the anti-CD117 heavy chain variable region sequence as set forth in SEQ ID NO: 13 and the light chain variable region sequence set forth in SEQ ID NO: 14, and was engineered to introduce the following Fc substitution, T366W.
- the Fc region of the heavy chain sequence of anti-CD117 antibody Ab85 (i.e., SEQ ID NO: 150 as described in US 2019/0153114 A1 , the content of which is hereby expressly incorporated by reference in its entirety) was engineered to introduce the following substitution, T366W (according to the EU index).
- the anti-CD117 Ab85 antibody variant i.e., "Ab85 T366W,” was subsequently expressed.
- the CD3-binding arm of bs-Ab-1 comprises the heavy chain variable region sequence as set forth in SEQ ID NO: 41 and the light chain variable region sequence as set forth in SEQ ID NO: 45.
- the anti-CD3 heavy chain and was engineered to introduce the following Fc substitutions, T366S, L368A and Y407V.
- the Fc region of the Ab2 (anti-CD3) antibody heavy chain sequence set forth SEQ ID NO: 49 was engineered to introduce the following substitutions, T366S, L368A and Y407V (amino acid positions refer to the Fc region according to the EU index).
- the Ab2 (anti-CD3) antibody variant, “anti-CD3 T366S L368A Y407V,” was subsequently expressed.
- the Ab85 T366VV parental antibody and anti-CD3 T366S L368A Y407V parental antibody were then assembled using standard knob-in-hole techniques to produce the bispecific heterodimer, bs-Ab-1 .
- bs-Ab-1 The stability of bs-Ab-1 was evaluated after two rounds of freeze-thaw cycles, followed by analysis using size exclusion chromatography (SEC). To assess the level of aggregation, 20 ⁇ g of bs- Ab-1 was injected into a AdvanceBio SEC 300 ⁇ column (Agilent Technologies). The eluted protein was detected using UV absorbance at 280 nm and and displayed no observable aggregation following two rounds of freeze-thaw cycles (data not shown). Further tests were performed using non-reduced capillary SDS PAGE (non-reduced CE-SDS). which determined that the level of partially reduced bispecific antibodies, was minimal, (the predominant species (>95%) in the population was bs-Ab-1 ).
- bs-Ab-1 was also evaluated for its ability to bind to human CD117 (hCD117) using bio-layer interferometry on an OCTET ⁇ platform to confirm that the bispecific format did not interfere with the anti-CD117 arm of the bispecific antibody.
- Methods for determining binding were in accordance with those known in the art, for instance as set forth in Tobias et a!., “Biomolecular Binding Kinetics Assays on the Octet Platform,” Application Note 14, 22 pages (2013). The binding assays were performed at 25°C in phosphate buffered saline (0.1% BSA) using Bio-Layer Interferometry Device (ForteBio).
- Bs- Ab-1 was loaded on an OCTET ⁇ Anti-human IgG Fc Capture (AHC) biosensor, at a concentration of 66.7 nM. Then associated with 33 nM hCD117 antigen and dissociated with 33 nM hCD3 antigen, allowing bs-Ab-1 to bind to both antigens ( CD3 and CD117). The binding response of bs-Ab 1 to hCD117 was confirmed, and the binding to hCD3 antigen was not detectable using this method (data not shown). Further, a baculovirus particle assay demonstrated that bs-Ab-1 did not exhibit non- specific binding. These results demonstrated the ability of bs-Ab-1 to bind hCD117 was maintained.
- AHC Anti-human IgG Fc Capture
- thermostability of bs-Ab-1 was evaluated using differential scanning fiuorimetry (D8F). 2 micrograms of bs-Ab-1 was combined with a protein thermal shift buffer and dye according to the protein thermal shift kit specifications (Applied Biosystems, Protein Thermal Shift Dye kit (Part # 4461146) and was analyzed using Applied Biosystems Quant Studio 7 Flex instrument by Life Technologies and the melting temperature (Tm) of each antibody was determined. The data indicated that the bs-Ab-1 bispecific antibody showed high intrinsic thermal stability.
- Example 2 Analysis of an in vitro cell killing assay using an anti-CD117 / anti-CD3 bispecific antibody bs-1-Ab CD117 expressing target cells (Kasumi-1 cells) were cultured in the presence of the bs-Ab-1 from Example 1 for six days after which the number of viable CD117 expressing target cells were determined.
- bs-Ab-1 was highly effective at killing CD117 expressing target cells.
- Example 3 Analysis of an in vitro cell killing assay using bs-Ab-1
- human bone marrow- derived CD34+ cells were cultured for seven days in the presence of either bs-Ab-1 from Example 1 , an anti-CD3-lsotype antibody (i.e., an antibody having one CD3 binding arm and one non-binding (isotype) arm), or an anti-CD117-Isotype antibody (i.e., an antibody having one CD117 binding arm and one non-binding (isotype) arm).
- Cell viability was measured using flow cytometry.
- IC 50 15.1 pM
- bs-Ab-1 from Example 1 was effective at killing CD117 expressing ceil lines (see Example 2) and primary human CD34+ cells (this Exampie).
- An in vivo depletion assay was performed to compare the ability of bs-Ab-1 from Example 1 to deplete cells compared to an anti-CD3-lsotype antibody, an anti-CD117-isotype antibody and various controls (e.g., PBS (negative control)).
- the in vivo HSC depletion assay was conducted using humanized NSG mice (purchased from Jackson Laboratories).
- the bs-Ab-1 bispecific antibody from Example 1 was administered as a single injection of 0.3 mg/kg bs-Ab-1 bispecific antibody, 1.0 mg/kg bs-Ab-1 bispecific antibody, or 6.0 mg/kg bs-Ab-1 bispecific antibody to the humanized mouse model.
- an anti-CD117-isotype antibody i.e., having one CD117 binding arm and one non- targeting arm
- an anti-CD3-isotype antibody i.e., having one CD3 binding arm and one non-targeting arm
- a combination of both an anti-CD117-isotype antibody and an anti-CD3-isotype antibody were similarly administered as a single injection of 6 mg/kg to the humanized mice on day 0. Bone marrow was collected on day 21 and examined by flow cytometry. The frequency (% cells maintained) and absolute number of CD34+ cells ⁇ Figs, 3A and B) and CD34+CD117+ cells (Figs. 3C and D), in the treated or control mice 21 days after a single administration are shown in Figs. 3A-D.
- the results indicate that the bs-Ab 1 bispecific antibody from Example 1 showed significant depletion of human CD34+CD117+ cells in the bone marrow (Figs. 3C and 3D, Fig. 3C shown as % cells maintained and Fig. 3D shown as absolute cell count per femur) 21 days following a single administration of the treatment regimen.
- Example 5 Production of the CD117 / CD3 bispecific antibodies, bs-Ab-2 and bs-Ab-3 CD3 / CD117 bispecific antibodies bs-Ab-2 and bs-Ab-3 were engineered using antigen binding sequences described in Table 4 and using the “knob-in-hole” bispecific engineering technique. bs-Ab-2, having a CD117-binding arm and a CD3-binding arm, was prepared using the “knob- in-hole” heterodimerization technology as described below.
- the CD117-binding arm of bs-Ab-2 comprises the heavy chain variable region sequence set forth in 8EG ID NO: 13 and the light chain variable region sequence set forth in SEQ ID NO: 14, and was engineered to introduce the following Fc substitutions, T366Y and H435A.
- the Fc region of the heavy chain sequence of the anti-CD117 antibody Ab85 ie., SEQ ID NO: 150 as described in US 2019/0153114 A1 , the content of which is hereby expressly incorporated by reference in its entirety
- T366Y and H435A amino acid positions refer to the Fc region according to the EU index.
- the anti-CD117 Ab85 variant i.e., “Ab85 T366Y H435A,” was subsequently expressed.
- the CD3-binding arm of bs-Ab-2 comprises the heavy chain variable region sequence as set forth in SEQ ID NO: 41 and the light chain variable region sequence as set forth in SEQ ID NO: 45, and was engineered to introduce the following Fc substitutions, Y407T and H435A.
- the Fc region of the Ab2 (anti-CD3) antibody heavy chain sequence set forth SEQ ID NO: 49 was engineered to introduce the following substitutions, Y407T and H435A (amino acid positions refer to the Fc region according to the EU index).
- the anti-CD3 antibody variant, "anti-CD3 Y407T H435A,” was subsequently expressed.
- the Ab85 T366Y H435A parental antibody and anti-CD3 Y407T H435A parental antibody were then assembled using standard knob and hole techniques to produce the bispecific heterodimer, bs-Ab-2.
- bs-Ab-3 Another bispecific antibody, i.e., bs-Ab-3, having a CD117-binding arm and a CD3-binding arm was prepared using the “knob-in-hole” heterodimerization technology as described below.
- the CD117-binding arm of bs-Ab-3 comprises the heavy chain variable region sequence set forth in SEQ ID NO: 27 and the light chain variable region sequence set forth in SEQ ID NO: 28, and was engineered to introduce the following Fc substitutions, T366Y H453A.
- the Fc region of the heavy chain sequence of the anti-CD117 antibody Ab67 (i.e., SEQ ID NO: 152 as described in US 2019-0144558 A1 , the content of which is hereby expressly incorporated by reference in its entirety) was engineered to introduce the following substitutions, T366Y and H435A (amino acid positions refer to the Fc region according to the EU index).
- the anti- CD117 Ab67 variant i.e., “Ab67 T366Y H453A,” was subsequently expressed.
- the CD3-binding arm of bs-Ab-3 comprises the heavy chain variable region sequence as set forth in SEQ ID NO: 41 and the light chain variable region sequence as set forth in SEQ ID NO: 45, and was engineered to introduce the following Fc substitutions, Y407T and H435A.
- the Fc region of the Ab2 (anti-CD3) antibody heavy chain sequence set forth SEQ ID NO: 49 was engineered to introduce the following substitution, Y407T H435A (amino acid positions refer to the Fc region according to the EU index).
- the anti-CD3 antibody variant, “anti- CD3 Y407T H435A,” was subsequently expressed.
- the Ab67 T366Y H453A parental antibody and anti-CD3 Y407V H435A parental antibody were then assembled using standard knob and hole techniques to produce the bispecific heterodimer, bs-Ab-3.
- a tirst monospecific antibody i.e., an antibody having one binding arm and one non-targeting arm
- Ab85-T366Y-H435A-lso-Y407T-H435A having a CD117-binding arm and an isotype (i.e., non-binding) arm
- the CD117-binding arm of Ab85-T366Y-H435A-lso-Y407T-H435A was prepared to include the heavy chain variable region sequence set forth in SEQ ID NO: 13 and the light chain variable region sequence set forth in SEQ ID NO: 14, and was engineered to introduce the following Fc substitutions, T366Y and H435A.
- the isotype-binding arm of Ab85-T366Y- H435A-lso-Y407T-H435A was prepared to include the heavy chain variable region sequence of an isotype antibody, and was engineered to introduce the following Fc substitutions, Y407T and H435A.
- a second monospecific antibody i.e., an antibody having one binding arm and one non- targeting arm
- Ab67-T366Y-H435A -lso-Y4Q7T-H435A having a CD117-binding arm and an isotype (i.e,, non-binding) arm
- the CD117-binding arm of Ab67-T366Y-H435A -lso-Y407T-H435A was prepared to include the heavy chain variable region sequence set forth in SEQ ID NO: 27 and the light chain variable region sequence set forth in SEQ ID NO: 28, and was engineered to introduce the following Fc substitutions, T366Y and H435A.
- the isotype-binding arm of Ab67-T366Y-H435A -iso-Y407T-H435A was prepared to include the heavy chain variable region sequence of an isotype antibody, and was engineered to introduce the following Fc substitutions, Y407T and H435A.
- a third monospecific antibody i.e., an antibody having one binding arm and one non-targeting arm
- the CD3-binding arm of Ab2-Y4G7T-H435A-lso-T366Y-H435A was prepared to include the heavy chain variable region sequence set forth in SEQ ID NO: 41 and the light chain variable region sequence set forth in SEQ ID NO: 45, and was engineered to introduce the following Fc substitutions, T366Y and H435A.
- the isotype-binding arm of Ab2-Y4Q7T-H435A-lso-T366Y-H435A was prepared to include the heavy chain variable region sequence of an isotype antibody, and was engineered to introduce the following Fc substitutions, Y4G7T and H435A.
- the stability of the bs-Ab-2 bispecific antibody, the bs-Ab-3 bispecific antibody, and the three control antibodies i.e., the Ab85-T366Y-H435A-lso-Y407T-H435A antibody, the Ab67-T366Y-H435A- isotype-Y4G7T-H435A antibody and the anti-CD3-Y407T-H435A-iso-T366Y-H435A antibody
- the three control antibodies i.e., the Ab85-T366Y-H435A-lso-Y407T-H435A antibody, the Ab67-T366Y-H435A- isotype-Y4G7T-H435A antibody and the anti-CD3-Y407T-H435A-iso-T366Y-H435A antibody
- Example 6 in vitro cell killing assay using an anti-CD117 / anti-CD3 bispecific antibody
- human bone marrow- derived CD34+ cells were cultured for six days in the presence of either the bs-Ab-2 bispecific antibody from Example 5, the bs-Ab-3 bispecific antibody from Example 5, a combination of the Ab85- T366Y-H435A-lso-Y407T-H435A antibody (from Example 5) and anti-CD3-Y407T-H435A-lso-T366Y- H435A antibody (from Example 5) and a combination of the Ab67-T366Y-H435A-isotype-Y407T- H435A antibody (from Example 5) and the anii-CD3-Y407T-H435A-lso-T366Y-H435A antibody (from Example 5), Cell viability was measured using flow cytometry.
- the bs-Ab-2 bispecific antibody from Example 5 is more efficacious than the bs-Ab-3 bispecific antibody from Example 5 (Fig. 4).
- the difference in efficacy may be due to proximity of the bs-Ab-2 epitope to the cell membrane (the epitope of the Ab85 antibody is described in WO 2020/219770, which is hereby incorporated herein by reference in its entirety) compared to the proximity of the bs-Ab-3 epitope to the cell membrane (the epitope of the Ab67 antibody is described In WO 2020/219748, which is hereby incorporated herein by reference in its entirety).
- the % efficacy values at 1 nM of the bispecific antibody are set forth in Table 3 below.
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Solid-Sorbent Or Filter-Aiding Compositions (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2021239929A AU2021239929A1 (en) | 2020-03-16 | 2021-03-16 | T-cell bispecific binding proteins |
| EP21771456.7A EP4121462A4 (en) | 2020-03-16 | 2021-03-16 | BISPECIFIC T CELL BINDING PROTEINS |
| JP2022555860A JP2023520636A (ja) | 2020-03-16 | 2021-03-16 | T細胞二重特異性結合タンパク質 |
| US17/906,471 US20230183344A1 (en) | 2020-03-16 | 2021-03-16 | T-cell bispecific binding proteins |
| CA3171709A CA3171709A1 (en) | 2020-03-16 | 2021-03-16 | T-cell bispecific binding proteins |
| CN202180035812.8A CN115667314A (zh) | 2020-03-16 | 2021-03-16 | T细胞双特异性结合蛋白 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062990281P | 2020-03-16 | 2020-03-16 | |
| US62/990,281 | 2020-03-16 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2021188590A2 true WO2021188590A2 (en) | 2021-09-23 |
| WO2021188590A3 WO2021188590A3 (en) | 2022-07-21 |
Family
ID=77768281
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/022626 Ceased WO2021188590A2 (en) | 2020-03-16 | 2021-03-16 | T-cell bispecific binding proteins |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20230183344A1 (https=) |
| EP (1) | EP4121462A4 (https=) |
| JP (1) | JP2023520636A (https=) |
| CN (1) | CN115667314A (https=) |
| AU (1) | AU2021239929A1 (https=) |
| CA (1) | CA3171709A1 (https=) |
| WO (1) | WO2021188590A2 (https=) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11434291B2 (en) | 2019-05-14 | 2022-09-06 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| WO2024040194A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| WO2024131861A1 (en) * | 2022-12-21 | 2024-06-27 | Erasmus University Medical Center Rotterdam | Bispecific antibodies targeting cd117 and cd3 |
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| WO2024249954A1 (en) | 2023-05-31 | 2024-12-05 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| WO2025076127A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN119874942B (zh) * | 2025-03-28 | 2025-09-26 | 核欣(苏州)医药科技有限公司 | 一种放射性蛋白偶联药物及其应用 |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL263466B2 (en) * | 2013-12-17 | 2023-10-01 | Genentech Inc | Anti-CD3 antibodies and methods of using them |
| DK3105252T3 (da) * | 2014-02-12 | 2019-10-14 | Michael Uhlin | Bispecifikke antistoffer til anvendelse ved stamcelletransplantation |
| HRP20201779T1 (hr) * | 2015-05-28 | 2021-01-22 | Genentech, Inc. | Stanični test za otkrivanje anti-cd3 homodimera |
| TWI796283B (zh) * | 2015-07-31 | 2023-03-21 | 德商安美基研究(慕尼黑)公司 | Msln及cd3抗體構築體 |
| AU2016337525B2 (en) * | 2015-10-16 | 2022-01-20 | The Trustees Of Columbia University In The City Of New York | Compositions and methods for inhibition of lineage specific antigens |
| CN109073635A (zh) * | 2016-01-25 | 2018-12-21 | 豪夫迈·罗氏有限公司 | 用于测定t细胞依赖性双特异性抗体的方法 |
| US10538579B2 (en) * | 2016-08-15 | 2020-01-21 | Board Of Regents, The University Of Texas System | Bispecific pertussis antibodies |
| TWI687227B (zh) * | 2017-10-03 | 2020-03-11 | 生倍科技股份有限公司 | 用於t細胞免疫療法之組合及其用途 |
| WO2019084057A2 (en) * | 2017-10-24 | 2019-05-02 | Magenta Therapeutics, Inc. | COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS |
| WO2019084053A1 (en) * | 2017-10-24 | 2019-05-02 | Magenta Therapeutics, Inc. | COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS |
| KR20200069364A (ko) * | 2017-10-24 | 2020-06-16 | 마젠타 테라퓨틱스 인코포레이티드 | Cd117+ 세포의 고갈을 위한 조성물 및 방법 |
| AU2019366960A1 (en) * | 2018-10-23 | 2021-05-27 | Regeneron Pharmaceuticals, Inc. | Fc silenced antibody drug conjugates (ADCs) and uses thereof |
| GB201912681D0 (en) * | 2019-09-04 | 2019-10-16 | Eth Zuerich | Bispecific binding agent that binds to cd117/c-kit and cd3 |
-
2021
- 2021-03-16 AU AU2021239929A patent/AU2021239929A1/en not_active Abandoned
- 2021-03-16 US US17/906,471 patent/US20230183344A1/en active Pending
- 2021-03-16 EP EP21771456.7A patent/EP4121462A4/en active Pending
- 2021-03-16 CN CN202180035812.8A patent/CN115667314A/zh active Pending
- 2021-03-16 JP JP2022555860A patent/JP2023520636A/ja active Pending
- 2021-03-16 WO PCT/US2021/022626 patent/WO2021188590A2/en not_active Ceased
- 2021-03-16 CA CA3171709A patent/CA3171709A1/en active Pending
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| US11434291B2 (en) | 2019-05-14 | 2022-09-06 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
| WO2024040194A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| WO2024040195A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| WO2024131861A1 (en) * | 2022-12-21 | 2024-06-27 | Erasmus University Medical Center Rotterdam | Bispecific antibodies targeting cd117 and cd3 |
| WO2024249954A1 (en) | 2023-05-31 | 2024-12-05 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| WO2025076127A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3171709A1 (en) | 2021-09-23 |
| AU2021239929A1 (en) | 2022-10-13 |
| EP4121462A4 (en) | 2024-04-24 |
| CN115667314A (zh) | 2023-01-31 |
| JP2023520636A (ja) | 2023-05-18 |
| WO2021188590A3 (en) | 2022-07-21 |
| EP4121462A2 (en) | 2023-01-25 |
| US20230183344A1 (en) | 2023-06-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230183344A1 (en) | T-cell bispecific binding proteins | |
| US11919970B2 (en) | Antibodies and chimeric antigen receptors specific for ROR1 | |
| US11827714B2 (en) | Antibodies and chimeric antigen receptors specific for CD19 | |
| JP2019527061A (ja) | 抗gprc5d抗体、gprc5dとcd3を結合する二重特異性抗原結合分子、及びその使用 | |
| JP2019519223A (ja) | 免疫調節タンパク質及び腫瘍抗原に結合する二重特異性結合タンパク質 | |
| WO2019084067A1 (en) | ANTI-CD117 ANTIBODIES AND METHODS OF USE | |
| US20230144405A1 (en) | Human anti-cd33 antibodies and uses thereof | |
| AU2010214082A1 (en) | Humanized anti-CD20 antibodies and methods of use | |
| JP2023516286A (ja) | グリピカン-3(gpc3)を標的化する抗体及びキメラ抗原受容体並びにその使用方法 | |
| WO2019084053A1 (en) | COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS | |
| EP4592319A1 (en) | Antibodies capable of specifically binding tnf-like ligand 1a and use thereof | |
| HK40129548A (en) | Antibodies capable of specifically binding tnf‑like ligand 1a and use thereof | |
| HK40049993A (en) | Antibodies and chimeric antigen receptors specific for cd19 | |
| HK40104849A (zh) | 用於诊断和治疗用途的针对lilrb1的单克隆抗体 | |
| HK1240239A1 (en) | Antibodies and chimeric antigen receptors specific for cd19 | |
| HK1240239B (en) | Antibodies and chimeric antigen receptors specific for cd19 | |
| HK1240948B (zh) | Cd123结合剂及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21771456 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3171709 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022555860 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2021239929 Country of ref document: AU Date of ref document: 20210316 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021771456 Country of ref document: EP Effective date: 20221017 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21771456 Country of ref document: EP Kind code of ref document: A2 |