WO2021183720A1 - Compositions and methods for modulating forkhead box p3 (foxp3) gene expression - Google Patents

Compositions and methods for modulating forkhead box p3 (foxp3) gene expression Download PDF

Info

Publication number
WO2021183720A1
WO2021183720A1 PCT/US2021/021825 US2021021825W WO2021183720A1 WO 2021183720 A1 WO2021183720 A1 WO 2021183720A1 US 2021021825 W US2021021825 W US 2021021825W WO 2021183720 A1 WO2021183720 A1 WO 2021183720A1
Authority
WO
WIPO (PCT)
Prior art keywords
foxp3
site
disrupting agent
specific
effector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/021825
Other languages
English (en)
French (fr)
Other versions
WO2021183720A8 (en
Inventor
Pankaj MANDAL
Jeremiah D. FARELLI
Timsi RAO
Jodi KENNEDY
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Omega Therapeutics Inc
Original Assignee
Omega Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Omega Therapeutics Inc filed Critical Omega Therapeutics Inc
Priority to JP2022554320A priority Critical patent/JP2023517326A/ja
Priority to EP21715725.4A priority patent/EP4118207A1/en
Priority to AU2021234302A priority patent/AU2021234302A1/en
Priority to CA3173528A priority patent/CA3173528A1/en
Priority to CN202180034263.2A priority patent/CN116096886A/zh
Publication of WO2021183720A1 publication Critical patent/WO2021183720A1/en
Publication of WO2021183720A8 publication Critical patent/WO2021183720A8/en
Priority to US17/929,828 priority patent/US20230114151A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • C07K2319/81Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor containing a Zn-finger domain for DNA binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/80Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/001Vector systems having a special element relevant for transcription controllable enhancer/promoter combination

Definitions

  • IPEX syndrome IPEX
  • SLE systemic lupus erythematosus
  • RA rheumatoid arthritis
  • Tregs are a specialized subpopulation of T cells that act to suppress immune response, thereby maintaining homeostasis and self-tolerance. It has been shown that Tregs are able to inhibit T cell proliferation and cytokine production and play an important role in preventing or treating autoimmune disease.
  • Forkhead box P3 (FOXP3) is a master transcription factor that controls the differentiation of na ⁇ ve T-cells into regulatory T-cells (Tregs) and forced overexpression of FOXP3 has been shown to confer the Treg phenotype to T-cells.
  • Tregs In vitro generation of Tregs has been an important effort in the field of ex vivo therapy targeting autoimmune disorders. However, many of the strategies to produce Tregs either do not lead to sustained expression of genes that lead to Tregs or give rise to Tregs that do not have suppression phenotype.
  • compositions and methods that treat an autoimmune disease such as IPEX syndrome.
  • the present invention provides agents and compositions for modulating the expression (e.g., enhancing or reducing the expression) of the Forkhead box P3 (FOXP3) gene by targeting a FOXP3 expression control region.
  • the FOXP3 gene may be in a cell, e.g., a mammalian cell, such as a mammalian somatic cell, e.g., a human or mouse somatic cell, e.g., a naive T-cell.
  • the present invention also provides methods of using the agents and compositions of the invention for modulating the expression of a FOXP3 gene in, or for treating, a subject who would benefit from modulating the expression of a FOXP3 gene, e.g., a subject suffering or prone to suffering from a FOXP3-associated disease.
  • the present invention provides a site-specific forkhead box P3(FOXP3) disrupting agent, comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region.
  • the site-specific FOXP3 targeting moiety comprises a polymeric molecule.
  • the polymeric molecule may comprise a polyamide, a polynucleotide, a polynucleotide encoding a DNA-binding domain, or fragment thereof, that specifically binds to the FOXP3 expression control region, or a peptide nucleic acid (PNA).
  • PNA peptide nucleic acid
  • the expression control region comprises a region upstream of a FOXP3 transcription start site (TSS).
  • TSS FOXP3 transcription start site
  • the expression control region comprises one or more FOXP3 associated anchor sequences within an anchor sequence-mediated conjunction comprising a first and a second FOXP3-associated anchor sequence.
  • the FOXP3-associated anchor sequence comprises a CCCTC-binding factor (CTCF) binding motif.
  • CCF CCCTC-binding factor
  • the FOXP3-associated anchor sequence-mediated conjunction comprises one or more transcriptional control elements internal to the conjunction. In one embodiment, the FOXP3-associated anchor sequence-mediated conjunction comprises one or more transcriptional control elements external to the conjunction.
  • the FOXP3-associated anchor sequence is located within about 500 kb of the transcriptional control element. In another embodiment, the FOXP3-associated anchor sequence is located within about 300 kb of the transcriptional control element. In still another embodiment, the anchor sequence is located within 10 kb of the transcriptional control element. transcriptional control element. In still another embodiment, the transcriptional control element comprises a FOXP3 promoter. In yet another embodiment, the transcriptional control element comprises a transcriptional enhancer. In still another embodiment, the transcriptional control element comprises a transcriptional repressor.
  • the site-specific FOXP3 disrupting agent includes a nucleotide sequence having at least 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide identity to the entire nucleotide sequence of any one of the nucleotide sequences in Table 2.
  • the site-specific FOXP3 disrupting agent includes a polynucleotide encoding a DNA-binding domain, or fragment thereof, of a zinc finger polypeptide (ZNF) or a transcription activator-like effector (TALE) polypeptide that specifically binds to the FOXP3 expression control region.
  • ZNF zinc finger polypeptide
  • TALE transcription activator-like effector
  • the DNA-binding domain of the TALE or ZNF polypeptide comprises an amino acid sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of any one of the amino acid sequences listed in Table 1B.
  • the site-specific FOXP3 disrupting agent includes a nucleotide modification, e.g., a deoxy-nucleotide, a 3’-terminal deoxy-thymine (dT) nucleotide, a 2'-O-methyl modified nucleotide, a 2'-fluoro modified nucleotide, a 2'-deoxy-modified nucleotide, an abasic nucleotide, a nucleotide comprising a 5'-phosphorothioate group, a nucleotide comprising a 5'- methylphosphonate group, a nucleotide comprising a 3’-phosphorothioate group, or a nucleotide comprising a 3’-methylphosphonate group.
  • a nucleotide modification e.g., a deoxy-nucleotide, a 3’-terminal deoxy-thymine (dT) nucleot
  • the polymeric molecule comprises a peptide nucleic acid (PNA).
  • the present invention provides a vector.
  • the vector includes the site-specific FOXP3 disrupting agent of various embodiments of the above aspects or any other aspect of the invention delineated herein.
  • the vector is a viral expression vector.
  • the present invention provides a cell.
  • the cell provides the site-specific FOXP3 disrupting agent or the vector of various embodiments of the above aspects or any other aspect of the invention delineated hterein.
  • the site-specific FOXP3 disrupting agent is present in a composition.
  • the composition comprises a pharmaceutical composition.
  • the pharmaceutical composition comprises a lipid formulation.
  • the lipid formulation comprises one or more cationic lipids, one or more non-cationic lipids, one or more cholesterol-based lipids, or one or more PEG-modified lipids, or combinations of nanoparticle.
  • the present invention provides a site-specific FOXP3 disrupting agent.
  • the site-specific FOXP3 disrupting agent includes a nucleic acid molecule encoding a fusion protein, the fusion protein comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region and an effector molecule.
  • the site-specific FOXP3 targeting moiety comprises a polynucleotide encoding a DNA-binding domain, or fragment thereof, of a zinc finger polypeptide (ZNF) or a transcription activator-like effector (TALE) polypeptide that specifically binds to the FOXP3 expression control region.
  • ZNF zinc finger polypeptide
  • TALE transcription activator-like effector
  • the effector molecule comprises a polypeptide or a nucleic acid molecule encoding a polypeptide.
  • the fusion protein comprises a peptide-nucleic acid fusion.
  • the effector is selected from the group consisting of a nuclease, a physical blocker, an epigenetic recruiter, and an epigenetic CpG modifier, and combinations of any of the foregoing.
  • the effector comprises a CRISPR associated protein (Cas) polypeptide or nucleic acid molecule encoding the Cas polypeptide.
  • Cas polypeptide is an enzymatically inactive Cas polypeptide.
  • the site-specific FOXP3 disrupting agent further includes a catalytically active domain of human exonuclease 1 (hEXO1).
  • epigenetic recruiter comprises a transcriptional enhancer or a transcriptional repressor.
  • the transcriptional enhancer is a VPR (VP64-p65-Rta).
  • the VPR comprises an amino acid sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of DALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLSGGPKKKRK MHISTGLSIFDTSLF (SEQ ID NO: 64).
  • the transcriptional enhancer is a p300.
  • the p300 comprises an amino acid sequence having at least about 85% 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the entire amino acid sequence of P L A E NO: 65).
  • the epigenetic CpG modifier comprises a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase.
  • the effector molecule comprises a zinc finger polypeptide.
  • the effector molecule comprises a Transcription activator-like effector nuclease (TALEN) polypeptide.
  • the site-specific FOXP3 disrupting agent further comprises a second nucleic acid molecule encoding a second fusion protein, wherein the second fusion comprises a second site-specific FOXP3 targeting moiety which targets a second FOXP3 expression control region and a second effector molecule, wherein the second FOXP3 expression control region is different than the FOXP3 expression control region.
  • the second effector is different than the first effector.
  • the second effector is the same as the first effector.
  • the fusion protein and the second fusion protein are operably linked.
  • the fusion protein and the second fusion protein comprise an amino acid sequence that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to the entire amino acid sequence of a polypeptide selected from the group consisting of dCas9-P300, and dCas9-VPR.
  • the fusion protein is encoded by a polynucleotide comprising a nucleotide sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide sequence identity to the entire nucleotide sequence mRNA.
  • the present invention provides a site-specific FOXP3 disrupting agent.
  • the disrupting agent includes a nucleic acid molecule encoding a fusion protein, wherein the fusion protein comprises an amino acid sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of a polypeptide selected from the group consisting of dCas9-P300, and dCas9-VPR.
  • the present invention provides a site-specific FOXP3 disrupting agent.
  • the site-specific FOXP3 disrupting agent comprises a polynucleotide encoding the amino acid sequence of dCas-P300 comprising the amino acid sequence of
  • the present invention provides a vector.
  • the vector includes a nucleic acid molecule encoding the site-specific FOXP3 disrupting agent of various embodiments of the above apsects or any other aspect of the invention delineated herein.
  • the vector is a viral expression vector.
  • the present invention provides a cell.
  • the cell includes the site-specific FOXP3 disrupting agent or the vector of various embodiments of the above aspects or any other aspects of the invention delineated herein.
  • the site-specific FOXP3 disrupting agent is present in a composition.
  • the composition comprises a pharmaceutical composition.
  • the pharmaceutical composition comprises a lipid formulation.
  • the lipid formulation comprises one or more cationic lipids, one or more non-cationic lipids, one or more cholesterol-based lipids, or one or more PEG-modified lipids, or combinations of any of the foregoing.
  • the pharmaceutical composition comprises a lipid nanoparticle.
  • the present invention provides a method of modulating expression of forkhead box P3 (FOXP3) in a cell.
  • the method includes contacting the cell with a site-specific FOXP3 disrupting agent, the disrupting agent comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, and an effector molecule, thereby modulating expression of FOXP3 in the cell.
  • the modulation of expression is enhanced expression of FOXP3 in the cell.
  • the modulation of expression is reduced expression of FOXP3 in the cell.
  • the site-specific FOXP3 targeting moiety comprises a polymeric molecule.
  • the polymeric molecule comprises a polyamide.
  • the polymeric molecule comprises a polynucleotide.
  • the expression control region comprises a region upstream of FOXP3 transcription start site (TSS).
  • the expression control region comprises one or more FOXP3- associated anchor sequences within an anchor sequence-mediated conjunction comprising a first and a second FOXP3-associated anchor sequence.
  • the FOXP3-associated anchor sequence comprises a CCCTC-binding factor (CTCF) binding motif.
  • CCCTC-binding factor (CTCF) binding motif In one embodiment, the FOXP3-associated anchor sequence-mediated conjunction comprises one or more transcriptional control elements internal to the conjunction In another embodiment, the control elements external to the conjunction.
  • the anchor sequence is located within about 500 kb of the transcriptional control element. In another embodiment, the anchor sequence is located within about 300 kb of the transcriptional control element.
  • the anchor sequence is located within 10 kb of the transcriptional control element.
  • the expression control region comprises a FOXP3-specific transcriptional element.
  • the transcriptional element comprises a FOXP3 promoter.
  • the transcriptional control element comprises transcriptional enhancer.
  • the transcriptional control element comprises a transcriptional repressor.
  • the site-specific FOXP3 disrupting agent comprises a nucleotide sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide identity to the entire nucleotide sequence of any of the nucleotide sequences in Table 2.
  • the site-specific FOXP3 disrupting agent comprises a polynucleotide encoding a DNA-binding domain, or fragment thereof, of a zinc finger polypeptide (ZNF) or a transcription activator-like effector (TALE) polypeptide that specifically binds to the FOXP3 expression control region.
  • ZNF zinc finger polypeptide
  • TALE transcription activator-like effector
  • the DNA-binding domain of the TALE or ZNF comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of an amino acid sequence selected from the amino acid sequences listed in Table 1B.
  • the site-specific FOXP3 disrupting agent comprises a nucleotide modification.
  • the polymeric molecule comprises a peptide nucleic acid (PNA).
  • the effector molecule comprises a polypeptide.
  • the polypeptide comprises a fusion protein comprising the site-specific FOXP3 targeting moiety which targets a FOXP3 expression regulatory region, and the effector molecule.
  • the fusion protein comprises a peptide-nucleic acid fusion molecule.
  • the effector is selected from the group consisting of a nuclease, a physical blocker, an epigenetic recruiter, and an epigenetic CpG modifier, and combinations of any of the foregoing.
  • the effector comprises a CRISPR associated protein (Cas) polypeptide or nucleic acid molecule encoding the Cas polypeptide.
  • the Cas polypeptide is an enzymatically inactive Cas polypeptide.
  • the effector further comprises a catalytically active domain of human exonuclease 1 (hEXO1). transcriptional repressor.
  • transcriptional enhancer is a VPR.
  • the VPR comprises an amino acid sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of MHISTGLSIFDTSLF (SEQ ID NO: 64).
  • the transcriptional enhancer comprises two, three, four, or five VPRs.
  • the transcriptional enhancer is a p300.
  • the p300 has an amino acid sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQY QEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSP QTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRK NO: 65).
  • the epigenetic CpG modifier comprises a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase.
  • the effector molecule comprises a zinc finger polypeptide.
  • the effector molecule comprises a Transcription activator-like effector nuclease (TALEN) polypeptide.
  • the fusion protein comprises an enzymatically inactive Cas polypeptide and an epigenetic recruiter polypeptide.
  • the fusion protein comprises an enzymatically Cas polypeptide and an epigenetic CpG modifier polypeptide.
  • the site-specific FOXP3 disrupting agent further comprises a second nucleic acid molecule encoding a second fusion protein, wherein the second fusion comprises a second site-specific FOXP3 targeting moiety which targets a second FOXP3 expression control region and a second effector molecule, wherein the second FOXP3 expression control region is different than the FOXP3 expression control region.
  • the second effector is different than the first effector.
  • the second effector is the same as the first effector.
  • the fusion protein and the second fusion protein are operably linked.
  • the fusion protein and the second fusion protein comprise an amino acid sequence that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to the entire amino acid sequence of a polypeptide selected from the group consisting of dCas9-P300, and dCas9-VPR.
  • the fusion protein is encoded by a polynucleotide comprising a nucleotide sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide sequence identity to the entire nucleotide sequence of a polynucleotide selected from the group consisting of dCas9-P300 mRNA, and dCas9-VPR mRNA.
  • the present invention provides a site-specific FOXP3 disrupting agent.
  • the disrupting agent includes a nucleic acid molecule encoding a fusion protein, wherein the fusion protein comprises an amino acid sequence having at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid identity to the entire amino acid sequence of a polypeptide selected from the group consisting of dCas9-P300, and dCas9-VPR.
  • the site-specific disrupting agent, the effector, or both the site-specific disrupting agent and the effector are present in a vector.
  • the site-specific disrupting agent and the effector are present in the same vector.
  • the site- specific disrupting agent and the effector are present in different vectors.
  • the vector is a viral expression vector.
  • the site-specific disrupting agent, the effector, or both the site-specific disrupting agent and the effector are present in a composition.
  • the site-specific disrupting agent and the effector are present in the same composition.
  • the site-specific disrupting agent and the effector are present in different compositions.
  • the composition comprises a pharmaceutical composition.
  • the pharmaceutical composition comprises a lipid formulation.
  • the pharmaceutical composition comprises a lipid nanoparticle.
  • the cell is a mammalian cell.
  • the mammalian cell is a somatic cell. In yet another embodiment, the mammalian cell is a primary cell. In one embodiment, the contacting is performed in vitro. In another embodiment, the contacting is performed in vivo. In still another embodiment, the contacting is performed ex vivo. In one embodiment, the method further includes administering the cell to a subject. In another embodiment, the cell is within a subject. In still another embodiment, the subject has a FOXP3-associated disease.
  • the FOXP3-associated disease is selected from the group consisting of IPEX syndrome (IPEX), type 1 diabetes, multiple sclerosis, systemic lupus erythematosus (SLE), and rheumatoid arthritis (RA).
  • IPEX IPEX syndrome
  • SLE systemic lupus erythematosus
  • RA rheumatoid arthritis
  • the present invention provides a method for treating a subject having a FOXP3- associated disease. The method includes administering to the subject a therapeutically effective amount of a site-specific FOXP3 disrupting agent, the disrupting agent comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, and an effector molecule, thereby treating the subject.
  • the FOXP3-associated disease is IPEX syndrome and the site-specific FOXP3 disrupting agent increases expression of FOXP3 in the subject.
  • the site-specific FOXP3 disrupting agent and the effector molecule are administered to the subject concurrently.
  • the site-specific FOXP3 disrupting agent and the effector molecule are administered to the subject sequentially.
  • the effector molecule is administered to the subject prior to administration of the site- specific FOXP3 disrupting agent.
  • the site-specific FOXP3 disrupting agent is administered to the subject prior to administration of the effector molecule.
  • the cell is an immune cell.
  • the immune cell is a na ⁇ ve T cell or a regulatory T cell (Treg).
  • the site-specific FOXP3 disrupting agent of the invention includes a first nucleotide sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide identity to the entire nucleotide sequence of GD-28448, a second nucleotide sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide identity to the entire nucleotide sequence of GD-28449, and a third nucleotide sequence having at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% nucleotide identity to the entire nucleotide sequence of GD-28450
  • Figures 1A and 1B are graphs depicting the activation of FOXP3 expression after contacting Jurkat cells with the indicated pools of site-specific FOXP3 targeting moieties and an effector molecule comprising dCas, dCas9 and p300, or dCas9 and VPR.
  • Figure 1A shows qPCR quantification of FOXP3 mRNA levels 48 hour after transfection with either dCas9 + sgRNA pools (1, 2, or 3) or with dCas9-p300 + sgRNA pools (1, 2, or 3) or with dCas9-VPR+ sgRNA pools (1, 2, or 3).
  • Figure 1B shows quantitation of a FACS experiment determining the percentage of Jurkat cells that were FOXP3 positive 72 hours post transfection. All transfections were carried out using Lipofectamine MessengerMax reagent (Thermofisher) following the manufacturer’s instructions.
  • Figure 2 is graph depicting the activation of FOXP3 expression after contacting Jurkat cells with pools of site-specific FOXP3 targeting moieties and an effector molecule comprising dCas9 and p300, or dCas9 and VPR. Only the combination of sgRNA pool 2 and dCas9 + VPR showed significantly high FOXP3 activation of both mRNA level and protein level.
  • Figures 3A and 3B are graphs depicting activation of na ⁇ ve T-cells after contacting the cells with the indicated pools of site-specific FOXP3 targeting moieties and an effector molecule comprising dCas9, dCas9 and p300, or dCas9 and VPR.
  • Figure 3A shows qPCR quantification of FOXP3 mRNA levels 58 hours after transfection with either dCas9 + sgRNA pool-2 or with dCas9-p300 + sgRNA pool-2 or with dCas9-VPR+ sgRNA pool-2.
  • Figure 3B shows quantitation of the FACS experiment determining the percentage of na ⁇ ve T-cells that were FOXP3 positive 72 hours post transfection. All transfections were carried out using the MaxCyte electroporation buffer and an ATx electroporation system according to the manufacturer’s instructions. “Program T cell 2” and “Program T cell 3” are two of the electroporation settings on the instrument used for electroporating the T cells with mRNA+sgRNA for delivery into the cells. DETAILED DESCRIPTION OF THE INVENTION
  • the present invention provides agents and compositions for modulating the expression (e.g., enhanced or reduced expression) of a forkhead box P3 (FOXP3) gene by targeting a FOXP3 expression control region.
  • FOXP3 forkhead box P3
  • the FOXP3 gene may be in a cell, e.g., a mammalian cell, such as a mammalian immune cell, e.g., a mammalian na ⁇ ve T cell, e.g., a human or mouse na ⁇ ve T cell.
  • a mammalian cell such as a mammalian immune cell, e.g., a mammalian na ⁇ ve T cell, e.g., a human or mouse na ⁇ ve T cell.
  • the present invention also provides methods of using the agents and compositions of the invention for modulating the expression of a FOXP3 gene in, and/or for treating, a subject who would benefit from modulating the expression of a FOXP3 gene, e.g., a subject suffering or prone to suffering from an autoimmune disease. and are described in Section II, below. I. Definitions In order that the present invention may be more readily understood, certain terms are first defined.
  • an element means one element or more than one element, e.g., a plurality of elements, e.g., a pool of elements, such as sgRNAs.
  • the term “including” is used herein to mean, and is used interchangeably with, the phrase “including but not limited to”.
  • the number of nucleotides in a nucleic acid molecule must be an integer.
  • “at least 18 nucleotides of a 21 nucleotide nucleic acid molecule” means that 18, 19, 20, or 21 nucleotides have the indicated property.
  • “at least” can modify each of the numbers in the series or range.
  • “no more than” or “less than” is understood as the value adjacent to the phrase and logical lower values or integers, as logical from context, to zero.
  • “no more than” is present before a series of numbers or a range, it is understood that “no more than” can modify each of the numbers in the series or range.
  • the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
  • One of ordinary skill in the art will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
  • the term “substantially” may therefore be used in some embodiments herein to capture potential lack of completeness inherent in many biological and chemical phenomena.
  • FOX protein family member that is a master transcription factor that controls the differentiation of na ⁇ ve T-cells into regulatory T-cells (Tregs).
  • FOX proteins belong to the forkhead/winged-helix family of transcriptional regulators and are believed to exert control via similar DNA binding interactions during transcription.
  • the FOXP3 transcription factor occupies the promoters for genes involved in regulatory T-cell function, and may repress transcription of key genes following stimulation of T cell receptors. Defects in this gene's ability to function can cause immunodysregulation polyendocrinopathy enteropathy X-linked syndrome (or IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome, as well as numerous cancers.
  • IPEX immunodysregulation polyendocrinopathy enteropathy X-linked syndrome
  • the nucleotide and amino acid sequence of FOXP3 is known and may be found in, for example, GenBank Accession Nos. NM_014009.4 and NM_001114377.2, the entire contents of each of which are incorporated herein by reference.
  • nucleotide sequence of the genomic region of the X Chromosome in human which includes the endogenous promoters of FOXP3 and the FOXP3 coding sequence, is also known and may be found in, for example, NC_000023.11 (49250436-49264932).
  • NC_000023.11 49250436-49264932
  • NM_014009.4 GenBank Accession Nos. NM_014009.4
  • NM_001114377.2 The entire contents of each of the foregoing GenBank Accession numbers are incorporated herein by reference as of the date of filing this application.
  • site-specific FOXP3 disrupting agent refers to any agent that specifically binds to a target FOXP3 expression control region and, e.g., modulates expression of a FOXP3 gene.
  • Site-specific FOXP3 disruption agents of the invention may comprise a “site-specific FOXP3 targeting moiety.”
  • site-specific FOXP3 targeting moiety refers to a moiety that specifically binds to a FOXP3 expression control region, e.g., a transcriptional control region of a FOXP3 gene, such as a DNA region around/proximally upstream of the transcription start site, a promoter, an enhancer, or a repressor; or a FOXP3-associated anchor sequence, such as, for example within a FOXP3-associated anchor sequence-mediated conjunction.
  • Exemplary “site-specific FOXP3 targeting moieties” include, but are not limited to, polyamides, nucleic acid molecules, such as RNA, DNA, or modified RNA or DNA, polypeptides, protein nucleic acid molecules, and fusion proteins.
  • specific binding or “specifically binds” refer to an ability to discriminate between possible binding partners in the environment in which binding is to occur.
  • a disrupting agent that interacts, e.g., preferentially interacts, with one particular target when other potential disrupting agents are present is said to "bind specifically" to the target (i.e., the expression control region) with which it interacts.
  • specific binding is assessed by detecting or determining the degree of association between the disrupting agent and its target; in some embodiments, specific binding is assessed by detecting or determining degree of dissociation of a disrupting agent-target complex. In some embodiments, specific binding is assessed by detecting or determining ability of the disrupting agent to compete with an alternative interaction between its target and another entity. In some embodiments, specific binding is assessed by performing such detections or determinations across a range of concentrations.
  • expression control region or expression control domain refers to a region or domain present in a genomic DNA that modulates the expression of a target gene in a cell.
  • a functionality associated with an expression control region may directly affect expression of a target gene, e.g. , by recruiting or blocking recruitment of a transcription factor that would stimulate expression of the gene.
  • a functionality associated with an expression control region may indirectly affect expression of a target gene, e.g., by introducing epigenetic modifications or recruiting other factors that introduce epigenetic modifications that induce a change in chromosomal topology that modulates expression of a target gene.
  • Expression control regions may be upstream and/or downstream of the protein coding sequence of a gene and include, for example, transcriptional control elements, e.g., DNA regions around/proximally upstream of the transcription start site, promoters, enhancers, or repressors; and anchor sequences, and anchor sequence-mediated conjunctions.
  • transcriptional control element refers to a nucleic acid sequence that controls transcription of a gene.
  • Transcriptional control elements include, for example, anchor sequences, anchor sequence-mediated conjunctions, DNA regions around/proximally upstream of the transcription start site, promoters, transcriptional enhancers, and transcriptional repressors.
  • a transcription start site is the location where transcription starts at the 5’-end of a gene sequence.
  • the DNA regions around/proximally upstream of the TSS can regulate the expression of a gene by, for example, recruiting a transcription factor.
  • Alteration in the modification status of one or more nucleotides (e.g., methylation) or one or more chromatin proteins (e.g., acetylation) in the DNA regions around/proximally upstream of the TSS can regulate the expression of a gene.
  • a promoter is a region of DNA recognized by an RNA polymerase to initiate transcription of a particular gene and is generally located upstream of the 5 ’-end of the transcription start site of the gene.
  • a “transcriptional enhancer” increases gene transcription.
  • a “transcriptional silencer” or “transcriptional repressor” decreases gene transcription.
  • Enhancing and silencing sequences may be about 50-3500 base pairs in length and may influence gene transcription up to about 1 megabases away.
  • gene refers to a sequence of nucleotides that encode a molecule, such as a protein, that has a function.
  • a gene contains sequences that are transcribed (e.g., a 3’UTR), sequences that are not transcribed (e.g., a promoter), sequences that are translated (e.g., an exon), and sequences that are not translated (e.g., intron).
  • target gene means a FOXP3 gene that is targeted for modulation, e.g., increase or decrease, of expression.
  • a FOXP3 target gene is part of a targeted genomic complex (e.g. a FOXP3 gene that has at least part of its genomic sequence as part of a target genomic complex, e.g. inside an anchor sequence-mediated conjunction), which genomic complex is targeted by one or more site -specific disrupting agents as described herein.
  • modulation comprises activation of expression of the target gene.
  • a FOXP3 gene is modulated by contacting the FOXP3 gene or a transcription control element operably linked to the FOXP3 gene with one or more site-specific disrupting agents as described herein.
  • a FOXP3 gene is aberrantly expressed (e.g., over-expressed) in a cell, e.g., a cell in a subject (e.g., a subject having a FOXP3-associated disease or an autoimmune disease).
  • a FOXP3 gene is aberrantly expressed (e.g., under-expressed) in a cell, e.g., a cell in a subject (e.g., a subject having a FOXP3-associated disease or an autoimmune disease).
  • anchor sequence refers to a nucleic acid sequence recognized by a nucleating agent that binds sufficiently to form an anchor sequence-mediated conjunction, e.g., a complex.
  • an anchor sequence comprises one or more CTCF binding motifs.
  • an anchor sequence is not located within a gene coding region.
  • an anchor sequence is located within an intergenic region.
  • an anchor sequence is not located within either of an enhancer or a promoter.
  • an anchor sequence is located at least 400 bp, at least 450 bp, at least 500 bp, at least 550 bp, at least 600 bp, at least 650 bp, at least 700 bp, at least 750 bp, at least 800 bp, at least 850 bp, at least 900 bp, at least 950 bp, or at least lkb away from any transcription start site.
  • an anchor sequence is located within a region that is not associated with genomic imprinting, monoallelic expression, and/or monoallelic epigenetic marks.
  • the anchor sequence has one or more functions selected from binding an endogenous nucleating polypeptide (e.g., CTCF), interacting with a second anchor sequence to form an anchor sequence mediated conjunction, or insulating against an enhancer that is outside the anchor sequence mediated conjunction.
  • an endogenous nucleating polypeptide e.g., CTCF
  • technologies are provided that may specifically target a particular anchor sequence or anchor sequences, without targeting other anchor sequences (e.g., sequences that may contain a nucleating agent (e.g., CTCF) binding motif in a different context); such targeted anchor sequences may be referred to as the “target anchor sequence”.
  • sequence and/or activity of a target anchor sequence is modulated while sequence and/or activity of one or more other anchor sequences that may be present in the same system (e.g., in the same cell and/or in some embodiments on the same nucleic acid molecule, e.g., the same chromosome) as the other targeted anchor sequence is not modulated.
  • the anchor sequence comprises or is a nucleating polypeptide binding motif. In some embodiments, the anchor sequence is adjacent to a nucleating polypeptide binding motif.
  • anchor sequence-mediated conjunction refers to a DNA structure, in some cases, a complex, that occurs and/or is maintained via physical interaction or binding of at or one or more proteins and/or a nucleic acid entity (such as RNA or DNA), that bind the anchor sequences to enable spatial proximity and functional linkage between the anchor sequences.
  • genomic complex is a complex that brings together two genomic sequence elements that are spaced apart from one another on one or more chromosomes, via interactions between and among a plurality of protein and/or other components (potentially including, the genomic sequence elements).
  • the genomic sequence elements are anchor sequences to which one or more protein components of the complex bind.
  • a genomic complex may comprise an anchor sequence-mediated conjunction.
  • a genomic sequence element may be or comprise a CTCF binding motif, a promoter and/or an enhancer.
  • a genomic sequence element includes at least one or both of a promoter and/or regulatory region (e.g., an enhancer).
  • complex formation is nucleated at the genomic sequence element(s) and/or by binding of one or more of the protein component(s) to the genomic sequence element(s).
  • co-localization e.g., conjunction
  • co-localization of the genomic sites via formation of the complex alters DNA topology at or near the genomic sequence element(s), including, in some embodiments, between them.
  • a genomic complex comprises an anchor sequence-mediated conjunction, which comprises one or more loops.
  • a genomic complex as described herein is nucleated by a nucleating polypeptide such as, for example, CTCF and/or Cohesin.
  • a genomic complex as described herein may include, for example, one or more of CTCF, Cohesin, non-coding RNA (e.g., eRNA), transcriptional machinery proteins (e.g., RNA polymerase, one or more transcription factors, for example selected from the group consisting of TFIIA, TFIIB, TFIID, TFIIE, TFIIF, TFIIH, etc.), transcriptional regulators (e.g., Mediator, P300, enhancer-binding proteins, repressor-binding proteins, histone modifiers, etc.), etc.
  • CTCF non-coding RNA
  • eRNA non-coding RNA
  • transcriptional machinery proteins e.g., RNA polymerase, one or more transcription factors, for example selected from the group consisting of TFIIA, TFIIB, TFIID, TFIIE, TFIIF, TFIIH, etc.
  • transcriptional regulators e.g., Mediator, P300, enhancer-binding proteins, repressor
  • a genomic complex as described herein includes one or more polypeptide components and/or one or more nucleic acid components (e.g., one or more RNA components), which may, in some embodiments, be interacting with one another and/or with one or more genomic sequence elements (e.g., anchor sequences, promoter sequences, regulatory sequences (e.g., enhancer sequences)) so as to constrain a stretch of genomic DNA into a topological configuration (e.g., a loop) that the stretch of genomic DNA does not adopt when the complex is not formed.
  • An “effector molecule,” as used herein, refers to a molecule that is able to regulate a biological activity, such as enzymatic activity, gene expression, anchor sequence-mediated conjunction or cell signaling.
  • effectors are described in Section II, below, and in some embodiment include, for example, nucleases, physical blockers, epigenetic recruiters, e.g., a transcriptional enhancer or a transcriptional repressor, and epigenetic CpG modifiers, e.g., a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase and combinations of any of the f II.
  • epigenetic recruiters e.g., a transcriptional enhancer or a transcriptional repressor
  • epigenetic CpG modifiers e.g., a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase and combinations of any of the f II.
  • the present invention provides site-specific FOXP3 disrupting agents which, in one aspect of the invention, include a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region.
  • the site-specific disrupting agents of the invention include a site- specific FOXP3 targeting moiety which targets a FOXP3 expression control region and an effector molecule.
  • such disrupting agents are site- specific and, thus, specifically bind to a FOXP3 expression control region (e.g., one or more transcriptional control elements and/or one or more target anchor sequences), e.g., within a cell, and not to non-targeted expression control regions (e.g., within the same cell).
  • FOXP3 is a master transcription factor that controls the differentiation of naive T-cells into regulatory T-cells (Tregs) and forced overexpression of FOXP3 has been shown to confer the Treg phenotype to T-cells.
  • the present invention features the use of effector molecules, e.g., chromatin remodelers, that when fused to DNA-targeting moieties can induce epigenetic changes at specific genomic regions that lead to increased transcription of targeted genes, e.g., FOXP3 gene.
  • an effector molecule, p300-core or VPR, fused to dCas9, which is the DNA targeting moiety is targeted to the FOXP3 locus using single guide RNAs (sgRNAs) complementary to the DNA region around/just upstream of the transcription start site (TSS) of a FOXP3 gene and provokes changes in histone acetylation.
  • sgRNAs single guide RNAs
  • TSS transcription start site
  • Tregs can be identified based on cell surface markers, such as CD127, and/or based on a suppression phenotype where Tregs kill effector T-cells incubated in a mixed culture.
  • the present invention features methods to directly target the master regulator transcription factor in the Treg generation and maintenance pathway, FOXP3, using targeting moieties (e.g., dCas9, TALEs or ZFP) to directly deliver an effector molecule (e.g., an activator) to the site of action to increase activation of FOXP3 gene.
  • targeting moieties e.g., dCas9, TALEs or ZFP
  • the site-specific FOXP3 disrupting agents of the invention comprise a site-specific FOXP3 targeting moiety targeting a FOXP3 expression control region.
  • the expression control region targeted by the site-specific targeting moiety may be, for example, a transcriptional control element or an anchor sequence, such as an anchor sequence within an anchor-mediated conjunction.
  • site-specific FOXP3 disrupting agents of the invention may modulate expression of a gene, i.e., FOXP3 , e.g., by modulating expression of the gene from a DNA region around/proximally upstream of a transcription start site, an endogenous promoter, an enhancer, or an repressor; may alter methylation of the control region; may alter acetylation of the chromatin protein, may introduce one or more mutations, e.g., substitution, addition or deletion of nucleotide; may alter at least one anchor sequence; may alter at least one conjunction nucleating molecule binding site, such as by altering binding affinity for the conjunction nucleating molecule; may alter an orientation of at least one common nucleotide sequence, such as a CTCF binding motif by, e.g., substitution, addition or deletion in at least one anchor sequence, such as a CTCF binding motif.
  • the site-specific disrupting agents and compositions described herein target an expression control region comprising one or more FOXP3-specific transcriptional control elements to modulate expression in a cell.
  • FOXP3-specific transcriptional control elements that can be targeted include DNA region around or proximally upstream of FOXP3 -transcription start site, FOXP3-specific promoter, FOXP3-specific enhancers, FOXP3-specific repressors, and FOXP3- associated anchor sequence.
  • FOXP3-specific transcriptional control element regulates expression in immune cells, e.g. , DNA region around or proximally upstream of FOXP3- transcription start site.
  • a site-specific disrupting agent may include a site-specific targeting moiety, e.g., a nucleic acid molecule encoding a DNA-binding domain of a Transcription activator-like effector (TALE) polypeptide or a zinc finger (ZNF) polypeptide, or fragment thereof, that specifically targets and binds to a FOXP3 expression control region, such as a FOXP3 endogenous promoter region, and an effector molecule, such as an effector molecule that includes a transcriptional enhancer or transcriptional repressor that modulates, e.g., enhances or represses, expression of a target gene from an endogenous promoter to modulate gene expression.
  • a site-specific targeting moiety e.g., a nucleic acid molecule encoding a DNA-binding domain of a Transcription activator-like effector (TALE) polypeptide or a zinc finger (ZNF) polypeptide, or fragment thereof, that specifically targets and
  • the disrupting agent is “bicistronic nucleic acid molecule,” i.e., capable of making two fusion proteins from a single messenger RNA molecule, a first and a second site-specific targeting moiety, e.g., a nucleic acid molecule encoding a DNA-binding domain of a Transcription activator-like effector (TALE) polypeptide or a zinc finger (ZNF) polypeptide, or fragment thereof, that specifically targets and binds to a FOXP3 expression control region, such as a FOXP3 endogenous promoter region, and an effector molecule, such as an effector molecule that includes a transcriptional enhancer or transcriptional repressor that modulates, e.g., enhances or represses, expression of a target gene from an endogenous promoter to modulate gene expression.
  • TALE Transcription activator-like effector
  • ZNF zinc finger
  • a site-specific disrupting agent may include a site-specific targeting moiety, e.g., a nucleic acid molecule, such as a guide RNA targeting a FOXP3 endogenous DNA region around or proximally upstream of FOXP3 transcription starting site, and an effector molecule, such as an effector molecule that includes a transcriptional enhancer or transcriptional repressor that modulates, e.g., enhances or represses, expression of a target gene from an endogenous promoter to modulate gene expression.
  • a site-specific targeting moiety e.g., a nucleic acid molecule, such as a guide RNA targeting a FOXP3 endogenous DNA region around or proximally upstream of FOXP3 transcription starting site
  • an effector molecule such as an effector molecule that includes a transcriptional enhancer or transcriptional repressor that modulates, e.g., enhances or represses, expression of a target gene from an end
  • the site-specific disrupting agents and compositions described herein target an expression control region comprising one or more FOXP3-associated second FOXP3-associated anchor sequence to alter a two-dimensional chromatin structure, e.g., anchor sequence-mediated conjunctions in order to modulate expression in a cell, e.g., a cell within a subject, e.g., by modifying anchor sequence-mediated conjunctions in DNA, e.g., genomic DNA.
  • the invention includes a site-specific FOXP3 disrupting agent comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region comprising one or more FOXP3-associated anchor sequences within an anchor sequence-mediated conjunction.
  • the disrupting agent binds, e.g., specifically binds, a specific anchor sequence-mediated conjunction to alter a topology of the anchor sequence-mediated conjunction, e.g., an anchor sequence-mediated conjunction having a physical interaction of two or more DNA loci bound by a conjunction nucleating molecule.
  • the formation of an anchor sequence-mediated conjunction may force transcriptional control elements to interact with a FOXP3 gene or spatially constrain the activity of the transcriptional control elements. Altering anchor sequence- mediated conjunctions, therefore, allows for modulating FOXP3 expression without altering the coding sequences of the FOXP3 gene being modulated.
  • the site-specific disrupting agents and compositions of the invention modulate expression of a FOXP3 gene associated with an anchor sequence-mediated conjunction by physically interfering between one or more anchor sequences and a conjunction nucleating molecule.
  • a DNA binding small molecule e.g., minor or major groove binders
  • peptide e.g., zinc finger, TALE, novel or modified peptide
  • protein e.g., CTCF, modified CTCF with impaired CTCF binding and/or cohesion binding affinity
  • nucleic acids e.g., ssDNA, modified DNA or RNA, peptide oligonucleotide conjugates, locked nucleic acids, bridged nucleic acids, polyamides, and/or triplex forming oligonucleotides
  • the site-specific disrupting agents and compositions of the invention modulate expression of a FOXP3 gene associated with an anchor sequence-mediated conjunction by modification of an anchor sequence, e.g., epigenetic modifications, e.g., histone protein modifications, or genomic editing modifications.
  • one or more anchor sequences associated with an anchor sequence-mediated conjunction comprising a FOXP3 gene may be targeted for genome editing, e.g., Cas9-mediated genome editing.
  • the site-specific disrupting agents and compositions of the invention modulate expression of a FOXP3 gene associated with an anchor sequence-mediated conjunction, e.g., activate or represses transcription, e.g., induces epigenetic changes to chromatin or genome editing.
  • an anchor sequence-mediated conjunction includes one or more anchor sequences, a FOXP3 gene, and one or more transcriptional control elements, such as an enhancing or or outside the anchor sequence-mediated conjunction.
  • the anchor sequence-mediated conjunction comprises a loop, such as an intra-chromosomal loop.
  • the anchor sequence-mediated conjunction has a plurality of loops.
  • One or more loops may include a first anchor sequence, a nucleic acid sequence, a transcriptional control element, and a second anchor sequence.
  • at least one loop includes, in order, a first anchor sequence, a transcriptional control element, and a second anchor sequence; or a first anchor sequence, a nucleic acid sequence, and a second anchor sequence.
  • either one or both of the nucleic acid sequences and the transcriptional control element is located within or outside the loop.
  • one or more of the loops comprises a transcriptional control element.
  • the anchor sequence-mediated conjunction includes a TATA box, a CAAT box, a GC box, or a CAP site.
  • the anchor sequence-mediated conjunction comprises a plurality of loops, and where the anchor sequence-mediated conjunction comprises at least one of an anchor sequence, a nucleic acid sequence, and a transcriptional control element in one or more of the loops.
  • the site-specific disrupting agents and compositions of the invention may introduce a targeted alteration to an anchor sequence-mediated conjunction to modulate expression of a nucleic acid sequence with a disrupting agent that binds the anchor sequence.
  • the anchor sequence-mediated conjunction is altered by targeting one or more nucleotides within the anchor sequence-mediated conjunction for substitution, addition or deletion.
  • expression, e.g., transcription is activated by inclusion of an activating loop or exclusion of a repressive loop.
  • the anchor sequence- mediated conjunction comprises a transcriptional control sequence that increases transcription of a nucleic acid sequence, e.g., such a FOXP3 encoding nucleic acid.
  • the anchor sequence-mediated conjunction excludes a transcriptional control element that decreases expression, e.g., transcription, of a nucleic acid sequence, e.g., such a FOXP3 encoding nucleic acid.
  • expression, e.g., transcription is repressed by inclusion of a repressive loop or exclusion of an activating loop.
  • the anchor sequence-mediated conjunction includes a transcriptional control element that decreases expression, e.g., transcription, of a nucleic acid sequence, e.g., such a FOXP3 encoding nucleic acid sequence.
  • the anchor sequence-mediated conjunction excludes a transcriptional control sequence that increases transcription of a nucleic acid sequence, e.g., such a FOXP3 encoding nucleic acid.
  • Each anchor sequence-mediated conjunction comprises one or more anchor sequences, e.g., a plurality.
  • Anchor sequences can be manipulated or altered to disrupt naturally occurring loops or form new loops (e.g., to form exogenous loops or to form non naturally occurring loops with exogenous or altered anchor sequences).
  • Such alterations modulate FOXP3 gene expression by changing the 2- dimensional structure of DNA containing all or a portion of a FOXP3 gene, e.g.
  • the chromatin structure is modified by substituting, adding or deleting one or more nucleotides within an anchor sequence of the anchor sequence-mediated conjunction.
  • the anchor sequences may be non-contiguous with one another.
  • the first anchor sequence may be separated from the second anchor sequence by about 500bp to about 500Mb, about 750bp to about 200Mb, about lkb to about 100Mb, about 25kb to about 50Mb, about 50kb to about 1Mb, about lOOkb to about 750kb, about 150kb to about 500kb, or about 175kb to about 500kb.
  • the first anchor sequence is separated from the second anchor sequence by about 500bp, 600bp, 700bp, 800bp, 900bp, lkb, 5kb, lOkb, 15kb, 20kb, 25kb, 30kb, 35kb, 40kb, 45kb, 50kb, 55kb, 60kb, 65kb, 70kb, 75kb, 80kb, 85kb, 90kb, 95kb, lOOkb, 125kb, 150kb, 175kb, 200kb, 225kb, 250kb, 275kb, 300kb, 350kb, 400kb, 500kb, 600kb, 700kb, 800kb, 900kb, 1Mb, 2Mb, 3Mb, 4Mb, 5Mb, 6Mb, 7Mb, 8Mb, 9Mb, 10Mb, 15Mb, 20Mb, 25Mb, 50Mb, 75Mb, 100M
  • the anchor sequence comprises a common nucleotide sequence, e.g., a CTCF-binding motif: G/A/C) (SEQ ID NO: 1), where N is any nucleotide.
  • a CTCF-binding motif may also be in the opposite orientation, e.g., C/G)N (SEQ ID NO:2).
  • the anchor sequence comprises SEQ ID NO: 1 or SEQ ID NO:2 or a nucleotide sequence at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to either SEQ ID NO: 1 or SEQ ID NO:2.
  • the anchor sequence-mediated conjunction comprises at least a first anchor sequence and a second anchor sequence.
  • the first anchor sequence and second anchor sequence may each comprise a common nucleotide sequence, e.g., each comprises a CTCF binding motif.
  • the first anchor sequence and second anchor sequence comprise different sequences, e.g., the first anchor sequence comprises a CTCF binding motif and the second anchor sequence comprises an anchor sequence other than a CTCF binding motif.
  • each anchor sequence comprises a common nucleotide sequence and one or more flanking nucleotides on one or both sides of the common nucleotide sequence.
  • CTCF-binding motifs e.g., contiguous or non-contiguous CTCF binding motifs
  • CTCFBSDB 2.0 Database For CTCF binding motifs And Genome Organization (http ://insulatordb .uthsc . edu/) can be used to identify CTCF binding motifs associated with a target gene, e.g., FOXP3.
  • the anchor sequence-mediated conjunction is altered by changing an orientation of at least one common nucleotide sequence, e.g., a conjunction nucleating molecule binding site.
  • the anchor sequence comprises a conjunction nucleating molecule binding site, e.g., CTCF binding motif, and site-specific disrupting agent of the invention introduces an alteration in at least one conjunction nucleating molecule binding site, e.g. altering binding affinity for the conjunction nucleating molecule.
  • the anchor sequence-mediated conjunction is altered by introducing an exogenous anchor sequence.
  • the anchor sequence-mediated conjunction comprises a FOXP3 gene, and one or more, e.g., 2, 3, 4, 5, or other genes other than the FOXP3 gene.
  • the anchor sequence-mediated conjunction is associated with one or more, e.g., 2, 3, 4, 5, or more, transcriptional control elements.
  • the FOXP3 gene is noncontiguous with one or more of the transcriptional control elements.
  • the gene may be separated from one or more transcriptional control elements by about l00bp to about 500Mb, about 500bp to about 200Mb, about lkb to about 100Mb, about 25kb to about 50Mb, about 50kb to about 1Mb, about 100kb to about 750kb, about 150kb to about 500kb, or about 175kb to about 500kb.
  • the gene is separated from the transcriptional control element by about l00bp, 300bp, 500bp, 600bp, 700bp, 800bp, 900bp, lkb, 5kb, l0kb, 15kb, 20kb, 25kb, 30kb, 35kb, 40kb, 45kb, 50kb, 55kb, 60kb, 65kb, 70kb, 75kb, 80kb, 85kb, 90kb, 95kb, l00kb, 125kb, 150kb, 175kb, 200kb, 225kb, 250kb, 275kb, 300kb, 350kb, 400kb, 500kb, 600kb, 700kb, 800kb, 900kb, 1Mb, 2Mb, 3Mb, 4Mb, 5Mb, 6Mb, 7Mb, 8Mb, 9Mb, 10Mb, 15Mb, 20Mb, 25Mb, 50
  • the type of anchor sequence-mediated conjunction may help to determine how to modulate gene expression, e.g., choice of site-specific targeting moiety, by altering the anchor sequence- mediated conjunction.
  • some types of anchor sequence-mediated conjunctions comprise one or more transcription control elements within the anchor sequence - formation of the anchor sequence- mediated conjunction, e.g., altering one or more anchor sequences, is likely to decrease transcription of a FOXP3 gene within the anchor sequence-mediated conjunction.
  • expression of the FOXP3 gene is regulated, modulated, or influenced by one or more transcriptional control elements associated with the anchor sequence-mediated conjunction.
  • the anchor sequence-mediated conjunction comprises a FOXP3 gene and one or more transcriptional control elements.
  • the FOXP3 gene and one or more transcriptional control sequences are located within, at least partially, an anchor sequence- mediated conjunction, e.g., a Type 1 anchor sequence-mediated conjunction.
  • the anchor sequence- mediated conjunction may also be referred to as a "Type 1, EP subtype.”
  • the FOXP3 gene has a defined state of expression, e.g., in its native state, e.g., in a diseased state.
  • the FOXP3 gene may have a high level of expression.
  • both theFOXP3 gene associated and one or more transcriptional control sequences reside inside the anchor sequence-mediated conjunction. Disruption of the anchor sequence-mediated conjunction decreases expression of the FOXP3 gene.
  • the FOXP3 gene associated with the anchor sequence-mediated conjunction is accessible to one or more transcriptional control elements that reside inside, at least partially, the anchor sequence- mediated conjunction.
  • expression of the FOXP3 gene is regulated, modulated, or influenced by one or more transcriptional control elements associated with, but inaccessible due to the anchor sequence- mediated conjunction.
  • the anchor sequence-mediated conjunction associated with a FOXP3 gene disrupts the ability of one or more transcriptional control elements to regulate, modulate, or influence expression of the FOXP3 gene.
  • the transcriptional control sequences may be separated from the FOXP3 gene, e.g., reside on the opposite side, at least partially, e.g., inside or outside, of the anchor sequence-mediated conjunction as the FOXP3 gene, e.g., the FOXP3 gene is inaccessible to the transcriptional control elements due to proximity of the anchor sequence-mediated conjunction.
  • one or more enhancing sequences are separated from the FOXP3 gene by the anchor sequence-mediated conjunction, e.g., a Type 2 anchor sequence-mediated conjunction.
  • the FOXP3 gene is inaccessible to one or more transcriptional control elements due to the anchor sequence-mediated conjunction, and disruption of the anchor sequence- mediated conjunction allows the transcription influence anchor sequence-mediated conjunction and inaccessible to the one or more transcriptional control elements. Disruption of the anchor sequence- mediated conjunction increases access of the transcriptional control elements to regulate, modulate, or influence expression of the FOXP3 gene, e.g., the transcriptional control elements increase expression of the FOXP3 gene.
  • the FOXP3 gene is inside the anchor sequence-mediated conjunction and inaccessible to the one or more transcriptional control elements residing outside, at least partially, the anchor sequence- mediated conjunction. Disruption of the anchor sequence-mediated conjunction increases expression of the FOXP3 gene.
  • the FOXP3 gene is outside, at least partially, the anchor sequence- mediated conjunction and inaccessible to the one or more transcriptional control elements residing inside the anchor sequence-mediated conjunction. Disruption of the anchor sequence - mediated conjunction increases expression of the FOXP3 gene.
  • the site-specific FOXP3 targeting moieties of the invention target a FOXP3 expression control region and may comprise a polymer or polymeric molecule, such as a polyamide (i.e., a molecule of repeating units linked by amide binds, e.g., a polypeptide), a polymer of nucleotides (such as a guide RNA, a nucleic acid molecule encoding a TALE polypeptide or a zinc finger polypeptides), a peptide nucleic acid (PNA), or a polymer of amino acids, such as a peptide or polypeptide, e.g., a fusion protein, etc.
  • a polyamide i.e., a molecule of repeating units linked by amide binds
  • a polypeptide a polymer of nucleotides
  • PNA peptide nucleic acid
  • PNA peptide nucleic acid
  • a site-specific disrupting agent of the invention comprises a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule, such as a guide RNA (or gRNA) or a guide RNA and an effector, or fragment thereof, or nucleic acid molecule encoding an effector, or fragment thereof.
  • a nucleic acid molecule such as a guide RNA (or gRNA) or a guide RNA and an effector, or fragment thereof, or nucleic acid molecule encoding an effector, or fragment thereof.
  • a site specific disrupting agent of the invention comprises a site- specific FOXP3 targeting moiety comprising a nucleic acid molecule encoding a polypeptide, such as a DNA-binding domain, or fragment thereof, of a zinc finger polypeptide (ZNF) or a transcription activator-like effector (i.e., a TALE DNA binding domain, or TALE) polypeptide, that is engineered to specifically target a FOXP3 expression control region to modulate expression of a FOXP3 gene.
  • ZNF zinc finger polypeptide
  • TALE transcription activator-like effector
  • a site-specific disrupting agent of the invention comprises a site- specific FOXP3 targeting moiety comprising a polynucleotide, such as a PNA, e.g., a nucleic acid gRNA linked to an effector polypeptide, or fragment thereof.
  • a site-specific disrupting agent of the invention comprises a site- specific FOXP3 targeting moiety comprising a fusion molecule, such as a nucleic acid molecule encoding a DNA-binding domain, of a Transcription activator-like effector (TALE) polypeptide or a zinc finger (ZNF) polypeptide, or fragment thereof, and an effector.
  • TALE Transcription activator-like effector
  • ZNF zinc finger
  • such site-specific disrupting agents comprise a second fusion protein, wherein the second fusion protein comprises a second site-specific FOXP3 targeting moiety which targets a second FOXP3 expression control region and a second effector molecule, wherein the second FOXP3 expression control region is different than the FOXP3 expression control region.
  • a site-specific disrupting agent of the invention comprises a site- specific FOXP3 targeting moiety comprising a fusion molecule, such as a nucleic acid molecule encoding a fusion protein comprising a Cas polypeptide and, e.g., an epigenetic recruiter or an epigenetic CpG modifier.
  • a site-specific disrupting agent of the invention comprises a site- specific FOXP3 targeting moiety comprising a fusion molecule, such as fusion protein comprising a Cas polypeptide and, e.g., an epigenetic recruiter or an epigenetic CpG modifier.
  • nucleic acid refers to any compound and/or substance that is or can be incorporated into an oligonucleotide chain.
  • a nucleic acid is a compound and/or substance that is or can be incorporated into a polynucleotide chain via a phosphodiester linkage.
  • nucleic acid refers to an individual nucleic acid residue (e.g., a nucleotide and/or nucleoside); in some embodiments, “nucleic acid” refers to a polynucleotide chain comprising individual nucleic acid residues.
  • a "nucleic acid” is or comprises RNA; in some embodiments, a “nucleic acid” is or comprises DNA. In some embodiments, a “nucleic acid” is a “mixmer” comprising locked nucleic acid molecules and deoxynucleic acid molecules. In some embodiments, a nucleic acid is, comprises, or consists of one or more natural nucleic acid residues. In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleic acid analogs. In some embodiments, a nucleic acid analog differs from a nucleic acid in that it does not utilize a phosphodiester backbone.
  • a nucleic acid is, comprises, or consists of one or more "peptide nucleic acids", which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention.
  • a nucleic acid has one or more phosphorothioate and/or 5'-N-phosphoramidite linkages rather than phosphodiester bonds.
  • a nucleic acid is, comprises, or consists of one or more natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxy thymidine, deoxy guanosine, and deoxycytidine).
  • adenosine thymidine
  • guanosine guanosine
  • cytidine uridine
  • deoxyadenosine deoxy thymidine
  • deoxy guanosine deoxycytidine
  • a nucleic acid is, comprises, or consists of one or more nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3 - methyl adenosine, 5-methylcytidine, C-5 propynyl -cytidine, C-5 propynyl -uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5 -propynyl-cytidine, C5- methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8- oxoguanosine, 0(6)-methylguanine, 2-thiocytidine, methylated bases
  • a nucleic acid comprises one or more modified sugars (e.g., 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose) as compared with those in natural nucleic acids.
  • a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or protein.
  • a nucleic acid includes one or more in Irons.
  • nucleic acids are prepared by one or more of isolation from a natural source, enzymatic synthesis by polymerization based on a complementary template (in vivo or in vitro), reproduction in a recombinant cell or system, and chemical synthesis.
  • a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, 20, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000 or more residues long.
  • a nucleic acid is partly or wholly single stranded; in some embodiments, a nucleic acid is partly or wholly double stranded.
  • a nucleic acid has a nucleotide sequence comprising at least one element that encodes, or is the complement of a sequence that encodes, a polypeptide. In some embodiments, a nucleic acid has enzymatic activity.
  • peptide As used herein, the terms “peptide,” “polypeptide,” and “protein” refer to a compound comprised of amino acid residues covalently linked by peptide bonds, or by means other than peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein’s or peptide’s sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or by means other than peptide bonds.
  • the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
  • a polypeptide is or may comprise a chimeric or “fusion protein.”
  • a "chimeric protein” or “fusion protein” comprises all or part (preferably a biologically active part) of a first protein operably linked to a heterologous second polypeptide (i.e., a polypeptide other than the first protein).
  • a heterologous second polypeptide i.e., a polypeptide other than the first protein.
  • the term "operably linked” is intended to indicate that the first protein or segment thereof and the heterologous polypeptide are fused in-frame to each other.
  • the heterologous polypeptide can be fused to the amino-terminus or the carboxyl- terminus of the first protein or segment.
  • a “polyamide” is a polymeric molecule with repeating units linked by amide binds. Proteins are examples of naturally occurring polyamides.
  • a polyamide comprises a peptide nucleic acid (PNA).
  • PNA peptide nucleic acid
  • amide containing backbone e.g., aminoethyl-glycine
  • This character of PNA not only makes them a stable hybrid with the nucleic acid side chains, but at the same time, the neutral backbone and hydrophobic side chains result in a hydrophobic unit within the polypeptide.
  • the nucleic acid side chain includes, but is not limited to, a purine or a pyrimidine side chain such as adenine, cytosine, guanine, thymine and uracil.
  • the nucleic acid side chain includes a nucleoside analog as described herein.
  • a site-specific FOXP3 targeting moiety of the invention comprises a polyamide. Suitable polyamides for use in the agents and compositions of the invention are known in the art.
  • a site-specific FOXP3 targeting moiety of the invention comprises a polynucleotide.
  • the nucleotide sequence of the polynucleotide encodes a FOXP3 gene or a FOXP3 expression product. In some embodiments, the nucleotide sequence of the polynucleotide does not include a FOXP3 coding sequence or a FOXP3 expression product.
  • a site-specific FOXP3 targeting moiety of the invention comprises a polynucleotide that hybridizes to a target expression control region, e.g., a promoter, an anchor sequence, or a DNA region around or proximally upstream of the transcription starting site.
  • the nucleotide sequence of the polynucleotide is a complement of a target DNA region around or proximally upstream of the transcription starting site, or has a sequence that is at least 80%, at least 85%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to a complement of the target sequence.
  • the polynucleotides of the invention may include deoxynucleotides, ribonucleotides, modified deoxynucleotides, modified ribonucleotides (e.g., chemical modifications, such as modifications that alter the backbone linkages, sugar molecules, and/or nucleic acid bases), and artificial nucleic acids.
  • the polynucleotide includes, but is not limited to, genomic DNA, cDNA, peptide nucleic acids (PNA) or peptide oligonucleotide conjugates, locked nucleic acids (LNA), bridged nucleic acids (BNA), polyamides, triplex forming oligonucleotides, modified DNA, antisense DNA oligonucleotides, tRNA, mPvNA, rPvNA, modified RNA, miRNA, gRNA, and siRNA or other RNA or DNA molecules.
  • PNA peptide nucleic acids
  • LNA locked nucleic acids
  • BNA bridged nucleic acids
  • polyamides polyamides
  • the polynucleotides of the invention have a length from about 2 to about 5000 nts, about 10 to about 100 nts, about 50 to about 150 nts, about 100 to about 200 nts, about 150 to about 250 nts, about 200 to about 300 nts, about 250 to about 350 nts, about 300 to about 500 nts, about 10 to about 1000 nts, about 50 to about 1000 nts, about 100 to about 1000 nts, about 1000 to about 2000 nts, about 2000 to about 3000 nts, about 3000 to about 4000 nts, about 4000 to about 5000 nts, or any range therebetween.
  • the polynucleotides of the invention may include nucleosides, e.g., purines or pyrimidines, e.g., adenine, cytosine, guanine, thymine and uracil.
  • the polynucleotides include one or more nucleoside analogs.
  • the nucleoside analog includes, but is not limited to, a nucleoside analog, such as 5-fluorouracil; 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 4- methylbenzimidazole, 5-(carboxyhydroxylmethyl) uracil, 5- carboxymethylaminomethyl-2-thiouridine, 5- carboxymethylaminomethyluracil, dihydrouracil, dihydrouridine, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1- methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2- methylguanine, 3-methylcytosine, 5- methylcytosine, N6-adenine, 7-methylguanine, 5- methylaminomethyluracil, 5-methoxyaminomethyl- 2-thiouracil, beta-
  • the site-specific FOXP3 targeting moieties of the invention comprising a polynucleotide encoding a polypeptide that comprises a DNA-binding domain (DBD), or fragment thereof, of a zinc finger polypeptide (ZNF) or a transcription activator -like effector (TALE) polypeptide, that is engineered to specifically target a FOXP3 expression control region to modulate expression of a FOXP3 gene.
  • DBD DNA-binding domain
  • ZNF zinc finger polypeptide
  • TALE transcription activator -like effector
  • zinc finger polypeptides which specifically bind to a DNA target region of interest, such as a FOXP3 expression control region
  • ZNF zinc finger
  • ZNF zinc finger
  • a modular assembly process which includes combining separate zinc finger DNA binding domains that can each recognize a specific 3-basepair DNA sequence to generate 3-finger, 4-, 5-, 6-, 6-, or 8- zinc finger polypeptide that recognizes specific target sites ranging from 9 basepairs to 24 basepairs in length may be used.
  • Another suitable method may include 2-finger modules to generate ZNF polynucleotides with up to six individual zinc fingers. See, e.g., Shukla VK, et al, Nature. 459 (7245) 2009: 437-41; Dreier B, et al, JBC. 280 (42) 2005: 35588-97; Dreier B, et al, JBC 276 (31) 2001: 29466-78; Bae KH, et al., Nature Biotechnology. 21 (3) 2003: 275-80.
  • a site-specific FOXP3 targeting moiety of the invention comprises a polynucleotide encoding a polypeptide that comprises a DNA-binding domain (DBD), or fragment thereof, of a zinc finger, that is engineered to specifically target a FOXP3 expression control region to modulate expression of a FOXP3 gene.
  • DBD DNA-binding domain
  • Exemplary amino acid sequences encoding a zinc finger that (See, e.g., Gersbach et al., Synthetic Zinc Finger Proteins: The advent of Targeted Gene Regulation and Genome Modification Technologies). Table 1A.
  • a zinc finger DNA binding domain comrpises an N-terminal region and a C-terminal region with the “fingers” that bind to the target DNA sequence in between.
  • the N-terminal region generally is 7 amino acids in length.
  • the C-terminal region is generally 6 amino acids in length.
  • the N- terminal region generally comprises the amino acid sequence of X1X2X3X4X 5X5X7- “X” can be any amino acid.
  • the N-terminal region comprises the exemplary amino acid sequence of LEPGEKP (SEQ ID NO: 76).
  • “X” can be any amino acid.
  • the C-terminal region generally comprises the amino acid sequence of X25X26X27X28X29X30.
  • the C- terminal region comprises the exemplary amino acid sequence of TGKKTS (SEQ ID NO: 77).
  • Each finger in the DNA binding domain is flanked by a N-terminal backbone located to the
  • the N-terminus of the finger and a C-terminal backbone located to the C-terminus of the finger generally is 11 amino acids long with two conservative cysteines (C) locate at 3 rd and 6 th positions.
  • C cysteines
  • the N-terminal backbone of the finger generally comprises the amino acid sequence of X8X9CX10X11CX12X13X14X15X16 ⁇ “X” can be any amino acid.
  • the C-terminal backbone of the finger generally is 5 amino acids long with two conservative histines (H) located at P 1 and 5 th positions.
  • the C-terminal backbone of the finger generally comprises the amino acid sequence of HX17X18X19H. “X” can be any amino acid.
  • the N-terminal backbone comprises the exemplary amino acid sequence of YKCPECGKSFS (SEQ ID No: 61) and the C-terminal backbone comprises the exemplary amino acid sequence of HQRTH (SEQ ID No: 62).
  • Two “fingers” are linked through a linker.
  • a linker generally is 5 amino acids in length and comprises the amino acidsequence 01 ” can be any amino acid.
  • the linker comprises the exemplary amino acid sequence of TGEKP (SEQ ID No: 63).
  • the zinc finger of a site specific FOXP3 site-specific disrupting agent has a structure as follows: (N-terminal backbone - finger - C-terminal backbone - linker) n and the zinc finger DNA binding domain of a site specific FOXP3 site-specific disrupting agent has a structure as follows: [N-terminal region (N-terminal backbone - finger - C-terminal backbone - linker) n - C-terminal region], “N” represents the number of triplets of nucleotides to which the zinc finger DNA binding domain and, thus, to which the FOXP3 site-specific disrupting agent binds.
  • linker span 1 is used to skip one base pair if a “finger” amino acid sequence of a triplet is not available.
  • Linker span 2 is used to skip 2 base pairs if a “finger” amino acid sequence of a triplet is not available.
  • Linker span 1 is generally 12 amino acids long.
  • Linker span 2 is generally 16 amino acids long.
  • linker span 1 generally comprises the amino acid sequence of X
  • Linker span 2 generally comprises the amino acid sequence of ⁇
  • linker span 1 comprises the amino acid sequence of THPRAPIPKPFQ (SEQ ID NO: 78).
  • linker span 2 comprises the amino acid sequence of 79).
  • the finger - linker span 1/ span 2 - finger comprises the structure as follows: N-terminal back bone - finger - C-terminal backbone - linker span 1 /span 2 - N-terminal backbone - finger - C-terminal backbone - linker.
  • Table IB provides the amino acid sequence of exemplary zinc finger DNA binding domains for use in the present invention and their corresponding target regions.
  • a zinc finger DNA binding domain suitable for use in the disrupting agents of the invention comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% amino acid identity to the entire amino acid sequence of any one of the zinc finger DNA binding domains provided in Table IB.
  • the TALE DNA binding domain contains a repeated highly conserved 33–34 amino acid sequence with divergent 12th and 13th amino acids. These two positions, referred to as the Repeat Variable Diresidue (RVD), are highly variable and show a strong correlation with specific nucleotide recognition.
  • RVD Repeat Variable Diresidue
  • the site-specific FOXP3 targeting moieties of the invention comprising a polynucleotide comprise a guide RNA (or gRNA) or nucleic acid encoding a guide RNA.
  • a gRNA is a short synthetic RNA molecule comprising a "scaffold" sequence necessary for, e.g., directing an effector to a FOXP3 expression control element which may, e.g., include an about 20 nucleotide site-specific sequence targeting a genomic target sequence comprising the FOXP3 expression control element.
  • guide RNA sequences are designed to have a length of between about 17 to about 24 nucleotides (e.g., 19, 20, or 21 nucleotides) and are complementary to the target sequence.
  • Custom gRNA generators and algorithms are available commercially for use in the design of effective guide RNAs.
  • Gene editing has also been achieved using a chimeric "single guide RNA" (“sgRNA”), an engineered (synthetic) single RNA molecule that mimics a naturally occurring crRNA-tracrRNA complex and contains both a tracrRNA (for binding the nuclease) and at least one crRNA (to guide the nuclease to the sequence targeted for editing).
  • sgRNA single guide RNA
  • the site-specific FOXP3 targeting moieties of the invention comprise a guide RNA (or gRNA) or nucleic acid encoding a guide RNA and a protein or a peptide.
  • the protein or the peptide comprises a CRISPR associated protein (Cas) polypeptide, or fragment thereof (e.g., a Cas9 polypeptide, or fragment thereof).
  • a suitable Cas polypeptide is an enzymatically inactive Cas polypeptide, e.g., a “dead Cas polypeptide” or “dCas” polypeptide.
  • exemplary site-specific FOXP3 targeting moieties comprising a polynucleotide, e.g., gRNA are provided in Table 2, below.
  • the polynucleotide comprises a nucleotide sequence at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the entire nucleotide sequence of any one of the nucleotide sequences in Table 2.
  • nucleic acid molecules encompassed by the invention may comprise any one of the sequences set forth in Table 2 that is unmodified or modified differently than described therein.
  • a site-specific FOXP3 targeting moiety comprising a polynucleotide, e.g., gRNA, comprises a nucleotide sequence complementary to an anchor sequence.
  • the anchor sequence comprises a CTCF-binding motif or consensus sequence: (SEQ ID NO: 1), where N is any nucleotide.
  • a CTCF-binding motif or consensus sequence may also be in the opposite orientation, e.g., (G/A/C)(C/T/A)(C/G)(G/A)(C/A/T)GG(G/T)(G/A)GA(C/T/A)(C/G)(A/T/G)CC(G/A/T)N(T/C/G)N (SEQ ID NO: 2).
  • the nucleic acid sequence comprises a sequence complementary to a CTCF-binding motif or consensus sequence.
  • the polynucleotide comprises a nucleotide sequence at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% complementary to an anchor sequence.
  • the polynucleotide comprises a nucleotide sequence at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% complementary to a CTCF-binding motif or consensus sequence.
  • the polynucleotide is selected from the group consisting of a gRNA, and a sequence complementary or a sequence comprising at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% complementary sequence to an anchor sequence.
  • a site-specific FOXP3 targeting moiety comprising a polynucleotide of the invention is an RNAi molecule.
  • RNAi molecules comprise RNA or RNA-like structures typically containing 15-50 base pairs (such as about 18-25 base pairs) and having a nucleobase sequence identical (complementary) or nearly identical (substantially complementary) to a coding sequence in an expressed target gene within the cell.
  • RNAi molecules include, but are not limited to: short interfering RNAs (siRNAs), double-strand RNAs (dsRNA), micro RNAs (miRNAs), short hairpin RNAs (shRNA), meroduplexes, and dicer substrates (U.S. Patent Nos.8,084,599, 8,349,809, and 8,513,207).
  • the invention includes a composition to inhibit expression of a gene encoding a polypeptide described herein, e.g., a conjunction nucleating molecule.
  • RNAi molecules comprise a sequence substantially complementary, or fully complementary, to all or a fragment of a target gene. RNAi molecules may complement sequences at the boundary between introns and exons to prevent the maturation of newly-generated nuclear RNA transcripts of specific genes into mRNA for transcription. RNAi molecules complementary to specific genes can hybridize with the mRNA for that gene and prevent its translation.
  • the antisense molecule can be DNA, RNA, or a derivative or hybrid thereof.
  • RNAi molecules can be provided to the cell as "ready-to-use” RNA synthesized in vitro or as an antisense gene transfected into cells which will yield RNAi molecules upon transcription. Hybridization with mRNA results in degradation of the hybridized molecule by RNAse H and/or inhibition of the formation of translation complexes. Both result in a failure to produce the product of the original gene.
  • RNAi molecules that hybridizes to the transcript of interest should be around 10 nucleotides, between about 15 or 30 nucleotides, or about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more nucleotides.
  • the degree of identity of the antisense sequence to the targeted transcript should be at least 75%, at least 80%, at least 85%, at least 90%, or at least 95.
  • RNAi molecules may also comprise overhangs, i.e. typically unpaired, overhanging nucleotides which are not directly involved in the double helical structure normally formed by the core sequences of the herein defined pair of sense strand and antisense strand.
  • RNAi molecules may contain 3' and/or 5' overhangs of about 1-5 bases independently on each of the sense strands and antisense strands. In one embodiment, both the sense strand and the antisense strand contain 3' and 5' overhangs. In one embodiment, one or more of the 3' overhang nucleotides of one strand base pairs with one or more 5' overhang nucleotides of the other strand. In another embodiment, the one or more of the 3' overhang nucleotides of one strand base do not pair with the one or more 5' overhang nucleotides of the other strand.
  • the sense and antisense strands of an RNAi molecule may or may not contain the same number of nucleotide bases.
  • the antisense and sense strands may form a duplex wherein the 5' end only has a blunt end, the 3' end only has a blunt end, both the 5' and 3' ends are blunt ended, or neither the 5' end nor the 3' end are blunt ended.
  • one or more of the nucleotides in the overhang contains a thiophosphate, phosphorothioate, deoxynucleotide inverted (3' to 3' linked) nucleotide or is a modified ribonucleotide or deoxynucleotide.
  • Small interfering RNA (siRNA) molecules comprise a nucleotide sequence that is identical to about 15 to about 25 contiguous nucleotides of the target mRNA.
  • the siRNA sequence commences with the dinucleotide AA, comprises a GC -content of about 30-70% (about 50- 60%, about 40-60%, or about 45%-55%), and does not have a high percentage identity to any nucleotide sequence other than the target in the genome of the mammal in which it is to be introduced, for example as determined by standard BLAST search.
  • siRNAs and shRNAs resemble intermediates in the processing pathway of the endogenous microRNA (miRNA) genes (Bartel, Cell 116:281-297, 2004).
  • siRNAs can function as miRNAs and vice versa (Zeng et al., Mol Cell 9: 1327-1333, 2002; Doench et al., Genes Dev 17:438-442, 2003).
  • MicroRNAs like siRNAs, use RISC to downregulate target genes, but unlike siRNAs, most animal miRNAs do not cleave the mRNA. Instead, miRNAs reduce protein output through translational suppression or polyA removal and mRNA degradation (Wu et al., Proc Natl Acad Sci USA 103 :4034-4039, 2006).
  • miRNA binding sites are within mRNA 3' UTRs; miRNAs seem to target sites with near-perfect complementarity to nucleotides 2-8 from the miRNA's 5' end (Rajewsky, Nat Genet 38 Suppl: S8- 13, 2006; Lim et al, Nature 433 :769-773, 2005). This region is known as the seed region. Because siRNAs and miRNAs are interchangeable, exogenous siRNAs downregulate mRNAs with seed complementarity to the siRNA (Birmingham et al., Nat Methods 3 : 199-204, 2006. Multiple target sites within a 3' UTR give stronger downregulation (Doench et al., Genes Dev 17:438-442, 2003).
  • RNAi molecules are readily designed and produced by technologies known in the art. In addition, there are computational tools that increase the chance of finding effective and specific sequence motifs (Pei et al. 2006, Reynolds et al.2004, Khvorova et al.2003, Schwarz et al.2003, Ui-Tei et al.2004, Heale et al.
  • RNAi molecule modulates expression of RNA encoded by a gene. Because multiple genes can share some degree of sequence homology with each other, in some embodiments, the RNAi molecule can be designed to target a class of genes with sufficient sequence homology. In some embodiments, the RNAi molecule can contain a sequence that has complementarity to sequences that are shared amongst different gene targets or are unique for a specific gene target.
  • the RNAi molecule can be designed to target conserved regions of an RNA sequence having homology between several genes thereby targeting several genes in a gene family (e.g., different gene isoforms, splice variants, mutant genes, etc.). In some embodiments, the RNAi molecule can be designed to target a sequence that is unique to a specific RNA sequence of a single gene.
  • the RNAi molecule targets a sequence in a conjunction nucleating molecule, e.g., CTCF, cohesin, USF 1, YY1, TATA-box binding protein associated factor 3 (TAF3), ZNF 143, or another polypeptide that promotes the formation of an anchor sequence-mediated conjunction, or an epigenetic modifying agent, e.g., an enzyme involved in post-translational modifications including, but are not limited to, DNA methylases (e.g., DNMT3a, DNMT3b, DNMTL), DNA demethylation (e.g., the TET family enzymes catalyze oxidation of 5-methylcytosine to 5- hydroxymethylcytosine and higher oxidative derivatives), histone methyltransferases, histone deacetylase (e.g., HDACl, HDAC2, HDAC3), sirtuin 1, 2, 3, 4, 5, 6, or 7, lysine-specific histone demethylase 1 (LSD1), histone
  • the RNAi molecule targets a protein deacetylase, e.g., sirtuin 1, 2, 3, 4, 5, 6, or 7.
  • the invention includes a composition comprising an RNAi that targets a conjunction nucleating molecule, e.g., CTCF.
  • the site-specific FOXP3 targeting moiety comprises a peptide or protein moiety.
  • a site-specific disrupting agent comprises a fusion protein.
  • an effector is a peptide or protein moiety.
  • the peptide or protein moieties may include, but is not limited to, a peptide ligand, antibody fragment, or targeting aptamer that binds a receptor such as an extracellular receptor, neuropeptide, hormone peptide, peptide drug, toxic peptide, viral or microbial peptide, synthetic peptide, and agonist or antagonist peptide.
  • exemplary peptides or protein include a DNA- binding protein, a CRISPR component protein, a conjunction nucleating molecule, a dominant negative conjunction nucleating molecule, an epigenetic modifying agent, or any combination thereof.
  • the peptide comprises a nuclease, a physical blocker, an epigenetic recruiter, and an epigenetic CpG modifier, and fragments and combinations of any of the foregoing.
  • the peptide comprises a DNA-binding domain of a protein, such as a helix-turn-helix motif, a leucine zipper, a Zn-finger, a TATA box binding proteins, a transcription factor.
  • Peptides or proteins may be linear or branched.
  • the peptide or protein moiety may have a length from about 5 to about 200 amino acids, about 15 to about 150 amino acids, about 20 to about 125 amino acids, about 25 to about 100 amino acids, about 20-70 amino acids, about 20-80 amino acids, about 20-90 amino acids, about 30-100 amino acids, about 30-60 amino acids, about 30-80 amino acids, about 35-85 amino acids, about 40-100 amino acids, or about 50-125 amino acids or any range therebetween.
  • the site-specific FOXP3 targeting moieties of the invention comprise a fusion protein.
  • the fusion proteins of the invention include a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region and an effector molecule.
  • a fusion protein of the invention comprises an effector molecule.
  • effector molecules include, for example, nucleases, physical blockers, epigenetic recruiters, e.g., a transcriptional enhancer or a transcriptional repressor, and epigenetic CpG modifiers, e.g., a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase, and combinations of any of the foregoing.
  • a site-specific targeting moiety may comprise a gRNA and an effector, such as a nuclease, e.g., a Cas9, e.g., a wild type Cas9, a nickase Cas9 (e.g., Cas9 D10A), a dead Cas9 (dCas9), eSpCas9, Cpfl, C2C1, or C2C3, or a nucleic acid encoding such a nuclease.
  • a nuclease e.g., a Cas9, e.g., a wild type Cas9, a nickase Cas9 (e.g., Cas9 D10A), a dead Cas9 (dCas9), eSpCas9, Cpfl, C2C1, or C2C3, or a nucleic acid encoding such a nuclease.
  • a nuclease e
  • nuclease and gRNA(s) are determined by whether the targeted mutation is a deletion, substitution, or addition of nucleotides, e.g., a deletion, substitution, or addition of nucleotides to a target sequence.
  • RNA sequences e.g., DNA recognition elements including, but not restricted to zinc finger arrays, sgRNA, TAL arrays, peptide nucleic acids described herein
  • target nucleic acids sequences e.g., to methylate or demethylate a DNA sequence
  • a fusion protein of the invention may comprise an effector molecule comprising, for example, a CRISPR associated protein (Cas) polypeptide, or fragment thereof, (e.g., a Cas9 polypeptide, or fragment thereof) and an epigenetic recruiter or an epigenetic CpG modifier.
  • a suitable Cas polypeptide is an enzymatically inactive Cas polypeptide, e.g., a “dead Cas polypeptide” or “dCas” polypeptide
  • Exemplary Cas polypeptides that are adaptable to the methods and compositions described herein are described below.
  • the invention includes a composition comprising a protein comprising a domain, e.g., an effector, that acts on DNA (e.g., a nuclease domain, e.g., a Cas9 domain, e.g., a dCas9 domain; a DNA methyltransferase, a demethylase, a deaminase), in combination with at least one guide RNA (gRNA) or antisense DNA oligonucleotide that targets the protein to site-specific target sequence, wherein the composition is effective to alter, in a human cell, the expression of a target gene.
  • a domain e.g., an effector
  • DNA e.g., a nuclease domain, e.g., a Cas9 domain, e.g., a dCas9 domain
  • gRNA guide RNA
  • antisense DNA oligonucleotide that targets the protein to site-specific target
  • the enzyme domain is a Cas9 or a dCas9.
  • the protein comprises two enzyme domains, e.g., a dCas9 and a methylase or demethylase domain.
  • the invention includes a composition comprising a protein comprising a domain, e.g., an effector, that comprises a transcriptional control element (e.g., a nuclease domain, e.g., a Cas9 domain, e.g., a dCas9 domain; a transcriptional enhancer; a transcriptional repressor), in combination with at least one guide RNA (gRNA) or antisense DNA oligonucleotide that targets the protein to a site- specific target sequence, wherein the composition is effective to alter, in a human cell, the expression of a target gene.
  • the enzyme domain is a Cas9 or a dCas9.
  • the protein comprises two enzyme domains, e.g., a dCas9 and a transcriptional enhancer or transcriptional repressor domain.
  • a "biologically active portion of an effector domain” is a portion that maintains the function (e.g. completely, partially, minimally) of an effector domain (e.g., a "minimal" or “core” domain).
  • the chimeric proteins described herein may also comprise a linker, e.g., an amino acid linker.
  • a linker comprises 2 or more amino acids, e.g., one or more GS sequences.
  • fusion of Cas9 with two or more effector domains (e.g., of a DNA methylase or enzyme with a role in DNA demethylation or protein acetyl transferase or deacetylase) comprises one or more interspersed linkers (e.g., GS linkers) between the domains.
  • interspersed linkers e.g., GS linkers
  • dCas9 is fused with 2- 5 effector domains with interspersed linkers.
  • a site-specific FOXP3 targeting moiety comprises a conjunction nucleating molecule, a nucleic acid encoding a conjunction nucleating molecule, or a combination thereof.
  • an anchor sequence-mediated conjunction is mediated by a first conjunction nucleating molecule bound to the first anchor sequence, a second conjunction nucleating molecule bound to the noncontiguous second anchor sequence, and an association between the first and second conjunction nucleating molecules.
  • a conjunction nucleating molecule may disrupt, e.g., by competitive binding, the binding of an endogenous conjunction nucleating molecule to its binding site.
  • the conjunction nucleating molecule may be, e.g., CTCF, cohesin, USF1, YY1, TATA-box binding protein associated factor 3 (TAF3), ZNF143 binding motif, or another polypeptide that promotes the formation of an anchor sequence-mediated conjunction.
  • the conjunction nucleating molecule may be an endogenous polypeptide or other protein, such as a transcription factor, e.g., autoimmune regulator (AIRE), another factor, e.g., X-inactivation specific transcript (XIST), or an engineered polypeptide that is engineered to recognize a specific DNA sequence of interest, e.g., having a zinc finger, leucine zipper or bHLH domain for sequence recognition.
  • AIRE autoimmune regulator
  • XIST X-inactivation specific transcript
  • the conjunction nucleating molecule may modulate DNA interactions within or around the anchor sequence -mediated conjunction.
  • the conjunction nucleating molecule can recruit other factors to the anchor sequence that alters an anchor sequence- mediated conjunction formation or disruption.
  • the conjunction nucleating molecule may also have a dimerization domain for homo- or heterodimerization.
  • One or more conjunction nucleating molecules may interact to form the anchor sequence-mediated conjunction.
  • the conjunction nucleating molecule is engineered to further include a stabilization domain, e.g., cohesion interaction domain, to stabilize the anchor sequence-mediated conjunction.
  • the conjunction nucleating molecule is engineered to bind a target sequence, e.g., target sequence binding affinity is modulated.
  • the conjunction nucleating molecule is selected or engineered with a selected binding affinity for an anchor sequence within the anchor sequence-mediated conjunction.
  • Conjunction nucleating molecules and their corresponding anchor sequences may be identified through the use of cells that harbor inactivating mutations in CTCF and Chromosome Conformation Capture or 3C-based methods, e.g., Hi-C or high-throughput sequencing, to examine topologically associated domains, e.g., topological interactions between distal DNA regions or loci, in the absence of CTCF. Long-range DNA interactions may also be identified. Additional analyses may include ChlA- PET analysis using a bait, such as Cohesin, YY1 or USF1, ZNF143 binding motif, and MS to identify complexes that are associated with the bait. B.
  • a bait such as Cohesin, YY1 or USF1, ZNF143 binding motif
  • Effector molecules for use in the compositions and methods of the invention include those that modulate a biological activity, for example increasing or decreasing enzymatic activity, gene expression, cell signaling, and cellular or organ function.
  • Preferred effector molecules of the invention are nucleases, physical blockers, epigenetic recruiters, e.g., a transcriptional enhancer or a transcriptional repressor, and epigenetic CpG modifiers, e.g., a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase, and combinations of any of the foregoing.
  • Additional effector activities may also include binding regulatory proteins to modulate activity of the regulator, such as transcription or translation.
  • Effector molecules also may include activator or inhibitor (or "negative effector") functions as described herein.
  • the effector molecule may inhibit substrate binding to a receptor and inhibit its activation, e.g., naltrexone and naloxone bind opioid receptors without activating them and block the receptors' ability to bind opioids.
  • Effector molecules may also modulate protein stability/degradation and/or transcript stability /degradation. For example, proteins may be targeted for degradation by the polypeptide co-factor, ubiquitin, onto proteins to mark them for degradation.
  • an effector molecule inhibits enzymatic activity by blocking the enzyme's active site, e.g., methotrexate is a structural analog of tetrahydrofolate, a coenzyme for the enzyme dihydrofolate reductase that binds to dihydrofolate reductase 1000-fold more tightly than the natural substrate and inhibits nucleotide base synthesis.
  • the effector molecule is a chemical, e.g., a chemical that modulates a cytosine (C) or an adenine(A) (e.g., Na bisulfite, ammonium bisulfite).
  • the effector molecule has enzymatic activity (methyl transferase, demethylase, nuclease (e.g., Cas9), a deaminase).
  • the effector molecule sterically hinders formation of an anchor sequence-mediated conjunction or binding of an RNA polymerase to a promoter.
  • the effector molecule with effector activity may be any one of the small molecules, peptides, fusion proteins, nucleic acids, nanoparticle, aptamers, or pharmacoagents with poor PK/PD described herein.
  • the effector molecule is an inhibitor or "negative effector molecule”.
  • the negative effector molecule is characterized in that dimerization of an endogenous nucleating polypeptide is reduced when the negative effector molecule is present as compared with when it is absent.
  • the negative effector molecule is or comprises a variant of the endogenous nucleating polypeptide's dimerization domain, or a dimerizing portion thereof.
  • an anchor sequence-mediated conjunction is altered (e.g., disrupted) by use of a dominant negative effector, e.g., a protein that recognizes and binds an anchor sequence, (e.g., a CTCF binding motif), but with an inactive (e.g., mutated) dimerization domain, e.g., a dimerization domain that is unable to form a functional anchor sequence-mediated conjunction.
  • a dominant negative effector e.g., a protein that recognizes and binds an anchor sequence, (e.g., a CTCF binding motif), but with an inactive (e.g., mutated) dimerization domain, e.g., a dimerization domain that is unable to form a functional anchor sequence-mediated conjunction.
  • the Zinc Finger domain of CTCF can be altered so that it binds a specific anchor sequence (by adding zinc fingers that recognize flanking nucleic acids), while the homo-dimerization domain is altered to prevent the interaction between the engineered CT
  • the effector molecule comprises a synthetic conjunction nucleating molecule with a selected binding affinity for an anchor sequence within a target anchor sequence- mediated conjunction, (the binding affinity may be at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or higher or lower than the affinity of an endogenous conjunction nucleating molecule that associates with the target anchor sequence.
  • the synthetic conjunction nucleating molecule may have between 30-90%, 30-85%, 30-80%, 30-70%, 50- 80%, 50-90% amino acid sequence identity to the endogenous conjunction nucleating molecule).
  • the conjunction nucleating molecule may disrupt, such as through competitive binding, the binding of an endogenous conjunction nucleating molecule to its anchor sequence.
  • the conjunction nucleating molecule is engineered to bind a novel anchor sequence within the anchor sequence-mediated conjunction.
  • a dominant negative effector molecule has a domain that recognizes specific DNA sequences (e.g., an anchor sequence, a CTCF anchor sequence, flanked by sequences that confer sequence specificity), and a second domain that provides a steric presence in the vicinity of the anchoring sequence.
  • the second domain may include a dominant negative conjunction nucleating molecule or fragment thereof, a polypeptide that interferes with conjunction nucleating molecule sequence recognition (e.g., the amino acid backbone of a peptide/nucleic acid or PNA), a nucleic acid sequence ligated to a small molecule that imparts steric interference, or any other combination of DNA recognition elements and a steric blocker.
  • the effector molecule is an epigenetic modifying agent.
  • Epigenetic modifying agents useful in the methods and compositions described herein include agents that affect, e.g., DNA methylation / demethylation, histone acetylation / deacetylation, and RNA-associated silencing.
  • the effectors sequence-specifically target an epigenetic enzyme e.g., an enzyme that generates or removes epigenetic marks, e.g., acetylation and/or methylation.
  • an epigenetic enzyme e.g., an enzyme that generates or removes epigenetic marks, e.g., acetylation and/or methylation.
  • exemplary epigenetic effectors may target an expression control region comprising, e.g., a transcriptional control element or an anchor sequence, by a site-specific disrupting agent comprising a site-specific targeting moiety.
  • an effector molecule comprises one or more components of a gene editing system. Components of gene editing systems may be used in a variety of contexts including but not limited to gene editing. For example, such components may be used to target agents that physically modify, genetically modify, and/or epigenetically modify FOXP3 sequences.
  • Exemplary gene editing systems include the clustered regulatory interspaced short palindromic repeat (CRISPR) system, zinc finger nucleases (ZFNs), and Transcription Activator-Like Effector-based Nucleases (TALEN).
  • CRISPR clustered regulatory interspaced short palindromic repeat
  • ZFNs zinc finger nucleases
  • TALEN Transcription Activator-Like Effector-based Nucleases
  • ZFNs, TALENs, and CRISPR-based methods are described, e.g., in Gaj et al. Trends Biotechnol.31.7(2013):397-405
  • CRISPR methods of gene editing are described, e.g., in Guan et al, Application of CRISPR-Cas system in gene therapy: Pre-clinical progress in animal model.
  • CRISPR systems are adaptive defense systems originally discovered in bacteria and archaea.
  • CRISPR systems use RNA-guided nucleases termed CRISPR-associated or "Cas" endonucleases (e. g., Cas9 or Cpfl) to cleave foreign DNA.
  • CRISPR-associated or "Cas" endonucleases e. g., Cas9 or Cpfl
  • an endonuclease is directed to a target nucleotide sequence (e.
  • the class II CRISPR systems use a single Cas endonuclease (rather than multiple Cas proteins).
  • One class II CRISPR system includes a type II Cas endonuclease such as Cas9, a CRISPR RNA ("crRNA”), and a trans-activating crRNA ("tracrRNA”).
  • the crRNA contains a "guide RNA", typically about 20- nucleotide RNA sequence that corresponds to a target DNA sequence.
  • the crRNA also contains a region that binds to the tracrRNA to form a partially double-stranded structure which is cleaved by RNase III, resulting in a crRNA/tracrRNA hybrid.
  • the crRNA/tracrRNA hybrid then directs the Cas9 endonuclease to recognize and cleave the target DNA sequence.
  • the target DNA sequence must generally be adjacent to a "protospacer adjacent motif ("PAM”) that is specific for a given Cas endonuclease; however, PAM sequences appear throughout a given genome.
  • PAM protospacer adjacent motif
  • CRISPR endonucleases identified from various prokaryotic species have unique PAM sequence requirements; examples of PAM sequences include 5'- NGG (Streptococcus pyogenes), 5'-NNAGAA (Streptococcus thermophilus CRISPR1), 5'-NGGNG (Streptococcus thermophilus CRISPR3), and 5'-NNNGATT (Neisseria meningiditis).
  • Some endonucleases e. g., Cas9 endonucleases, are associated with G-rich PAM sites, e.
  • Another class II CRISPR system includes the type V endonuclease Cpfl, which is smaller than Cas9; examples include AsCpfl (from Acidaminococcus sp.) and LbCpfl (from Lachnospiraceae sp.).
  • Cpf 1 -associated CRISPR arrays are processed into mature crRNAs without the requirement of a tracrRNA; in other words a Cpfl system requires only the Cpfl nuclease and a crRNA to cleave the target DNA sequence.
  • Cpfl endonucleases are associated with T-rich PAM sites, e. g., 5'-TTN. Cpfl can also recognize a 5'-CTA PAM motif. Cpfl cleaves the target DNA by introducing an offset or staggered double-strand break with a 4- or 5-nucleotide 5' overhang, for example, cleaving a target DNA with a 5- nucleotide offset or staggered cut located 18 nucleotides downstream from (3 ' from) from the PAM site on the coding strand and 23 nucleotides downstream from the PAM site on the complimentary strand; the 5-nucleotide overhang that results from such offset cleavage allows more precise genome editing by DNA insertion by homologous recombination than by insertion at blunt-end cleaved DNA.
  • Cas protein e.g., a Cas9 protein
  • a Cas protein may be from any of a variety of prokaryotic species.
  • a particular Cas protein e.g., a particular Cas9 protein
  • the site-specific targeting moiety includes a sequence targeting polypeptide, such as an enzyme, e.g., Cas9.
  • a Cas protein e.g., a Cas9 protein
  • a Cas protein may be obtained from a bacteria or archaea or synthesized using known methods.
  • a Cas protein may be from a gram positive bacteria or a gram negative bacteria.
  • a Cas protein may be from a Streptococcus, (e.g., a S.
  • nucleic acids encoding two or more different Cas proteins, or two or more Cas proteins may be introduced into a cell, zygote, embryo, or animal, e.g., to allow for recognition and modification of sites comprising the same, similar or different PAM motifs.
  • the Cas protein is modified to deactivate the nuclease, e.g., nuclease-deficient Cas9, and to recruit transcription activators or repressors, e.g., the co-subunit of the E.
  • CRISPR arrays can be designed to contain one or multiple guide RNA sequences corresponding to a desired target DNA sequence; see, for example, Cong et al.
  • At least about 16 or 17 nucleotides of gRNA sequence are required by Cas9 for DNA cleavage to occur; for Cpfl at least about 16 nucleotides of gRNA sequence is needed to achieve detectable DNA cleavage.
  • dCas9 double-strand breaks
  • dCas9 catalytically inactive Cas9
  • dCas9 can further be fused with a heterologous effector to repress (CRISPRi) or activate (CRISPRa) expression of a target gene.
  • Cas9 can be fused to a transcriptional silencer (e.g., a KRAB domain) or a transcriptional activator (e.g., a dCas9-VP64 fusion).
  • a transcriptional silencer e.g., a KRAB domain
  • a transcriptional activator e.g., a dCas9-VP64 fusion
  • a catalytically inactive Cas9 (dCas9) fused to Fokl nuclease (“dCas9-FokI”) can be used to generate DSBs at target sequences homologous to two gRNAs. See, e. g., the numerous CRISPR/Cas9 plasmids disclosed in and publicly available from the Addgene repository (Addgene, 75 Sidney St., Suite 550A, Cambridge, MA 02139; addgene.org/crispr ).
  • a "double nickase" Cas9 that introduces two separate double-strand breaks, each directed by a separate guide RNA, is described as achieving more accurate genome editing by Ran et al. (2013) Cell, 154: 1380 - 1389.
  • CRISPR technology for editing the genes of eukaryotes is disclosed in US Patent Application Publications 2016/0138008A1 and US2015/0344912A1, and in US Patents 8,697,359, 8,771,945, 8,945,839, 8,999,641, 8,993,233, 8,895,308, 8,865,406, 8,889,418, 8,871,445, 8,889,356, 8,932,814, 8,795,965, and 8,906,616.
  • an effector comprises one or more components of a CRISPR system described hereinabove.
  • suitable effectors for use in the agents, compositions, and methods of the invention include, for example, nucleases, physical blockers, epigenetic recruiters, e.g., a transcriptional enhancer or a transcriptional repressor, and epigenetic CpG modifiers, e.g., a DNA methylase, a DNA demethylase, a histone modifying agent, a histone transacetylase, or a histone deacetylase, and combinations of any of the foregoing.
  • Suitable effectors include a polypeptide or its variant.
  • the term “variant,” as used herein, refers to a polypeptide that is derived by incorporation of one or more amino acid insertions, substitutions, or deletions in a precursor polypeptide (e.g., “parent” polypeptide).
  • a variant polypeptide has at least about 85% amino acid sequence identity, e.g., about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%, amino acid sequence identity to the entire amino acid sequence of a parent polypeptide.
  • sequence identity refers to a comparison between pairs of nucleic acid or amino acid molecules, i.e., the relatedness between two amino acid sequences or between two nucleotide sequences. In general, the sequences are aligned so that the highest order match is obtained. Methods for determining sequence identity are known and can be determined by commercially available computer programs that can calculate the percentage of identity between two or more sequences. A typical example of such a computer program is CLUSTAL.
  • Exemplary effectors include ubiquitin, bicyclic peptides as ubiquitin ligase inhibitors, transcription factors, DNA and protein modification enzymes such as topoisomerases, topoisomerase inhibitors such as topotecan, DNA methyltransferases such as the DNMT family (e.g., DNMT3a, DNMT3b, DNMTL), protein methyltransferases (e.g., viral lysine methyltransferase (vSET), protein- lysine N- methyltransferase (SMYD2), deaminases (e.g., FOXP3 EC, UG1), histone methyltransferases such as enhancer of zeste homolog 2 (EZH2), PRMT1, histone-lysine-N-methyltransferase (Setdbl), histone methyltransferase (SET2), Vietnameseromatic histone-lysine N-methyltransferase 2 (G9a), his
  • a suitable nuclease for use in the agent, compositions, and methods of the invention comprises a Cas9 polypeptide, or enzymatically active portion thereof.
  • the Cas9 polypeptide, or enzymatically active portion thereof further comprises a catalytically active domain of human exonuclease 1 (hEXO1), e.g., 5' to 3' exonuclease activity and/or an RNase H activity.
  • a suitable nuclease comprises a transcription activator like effector nuclease (TALEN).
  • TALEN transcription activator like effector nuclease
  • a suitable nuclease comprises a zinc finger protein.
  • TALEN as used herein, is broad and includes a monomeric TALEN that can cleave double stranded DNA without assistance from another TALEN.
  • TALEN is also used to refer to one or both members of a pair of TALENs that are engineered to work together to cleave DNA at the same site. TALENs that work together may be referred to as a left-TALEN and a right-TALEN, which references the handedness of DNA.
  • TALE TAL effectors
  • the DNA binding domain contains a highly conserved 33-34 amino acid sequence with the exception of the 12th and 13th amino acids. These two locations are highly variable (Repeat Variable Diresidue (RVD)) and show a strong correlation with specific nucleotide recognition.
  • RVD Repeat Variable Diresidue
  • the non-specific DNA cleavage domain from the end of the FokI endonuclease can be used to construct hybrid nucleases that are active in a yeast assay. These reagents are also active in plant cells and in animal cells.
  • Initial TALEN studies used the wild-type FokI cleavage domain, but some subsequent TALEN studies also used FokI cleavage domain variants with mutations designed to improve cleavage specificity and cleavage activity.
  • the FokI domain functions as a dimer, requiring two constructs with unique DNA binding domains for sites in the target genome with proper orientation and spacing.
  • Both the number of amino acid residues between the TALE DNA binding domain and the FokI cleavage domain and the number of bases between the two individual TALE binding sites are parameters for achieving high levels of activity.
  • the number of amino acid residues between the TALE DNA binding domain and the FokI cleavage domain may be modified by introduction of a spacer (distinct from the spacer sequence) between the plurality of TAL effector repeat sequences and the FokI endonuclease domain.
  • the spacer sequence may be 12 to 30 nucleotides, e.g., 12-15, 12-20, 20-25, or 15-30 nucleotides.
  • the relationship between amino acid sequence and DNA recognition of the TALE binding domain allows for designable proteins.
  • TALENs can be used to edit genomes by inducing double-strand breaks (DSB), which cells respond to with repair mechanisms. In this manner, they can be used to correct mutations in the genome which, for example, cause disease.
  • a “zinc finger polypeptide” or “zinc finger protein” is a protein that binds to DNA, RNA and/or protein, in a sequence-specific manner, by virtue of a metal stabilized domain known as a zinc finger.
  • Zinc finger proteins are nucleases having a DNA cleavage domain and a DNA binding zinc finger domain. Zinc finger polypeptides may be made by fusing the nonspecific DNA. cleavage domain of an endonuclease with site-specific DNA binding zinc finger domains.
  • Such nucleases are powerful tools for gene editing and can be assembled to induce double strand breaks (DSBs) site-specifically into genomic DNA.
  • ZFNs allow specific gene disruption as during DNA repair, the targeted genes can be disrupted via mutagenic non-homologous end joint (NHEJ) or modified via homologous recombination (HR) if a closely related DNA template is supplied.
  • Zinc finger nucleases are chimeric enzymes made by fusing the nonspecific DNA. cleavage domain of the endonuclease FokI with site-specific DNA binding zinc finger domains. Due to the flexible nature of zinc finger proteins (ZFPs), ZFNs can be assembled that induce double strand breaks (DSBs) site-specifically into genomic DNA.
  • a suitable physical blocker for use in the agent, compositions, and methods of the invention comprises a gRNA, antisense DNA, or triplex forming oligonucleotide (which may target an expression control unit) steric block a transcriptional control element or anchoring sequence.
  • the gRNA recognizes specific DNA sequences and further includes sequences that interfere with, e.g., a conjunction nucleating molecule sequence to act as a steric blocker.
  • the gRNA is combined with one or more peptides, e.g., S-adenosyl methionine (SAM), that acts as a steric presence.
  • a physical blocker comprises an enzymatically inactive Cas9 polypeptide, or fragment thereof (e.g., dCas9).
  • an epigenetic recruiter activates or enhances transcription of a target gene.
  • a suitable epigenetic recruiter for use in the agent, compositions, and methods of the invention comprises a VP64 domain or a p300 core domain.
  • an epigenetic recruiter silences or represses transcription of a target gene.
  • a suitable epigenetic recruiter for use in the agent, compositions, and methods of the invention comprises a KRAB domain, or an MeCP2 domain.
  • a suitable epigenetic recruiter for use in the agent, compositions, and methods of the invention comprises dCas9-VP64 fusion, a dCas9-p300 core fusion, a dCas9-KRAB fusion, or a dCas9-KRAB-MeCP2 fusion.
  • VP64 is a transcriptional activator composed of four tandem copies of VP16 (Herpes Simplex Viral Protein 16, amino acids 437-447*: DALDDFDLDML (SEQ ID NO: 95)) connected with glycine-serine (GS) linkers.
  • the VP64 further comprises the transcription factors p65 and Rta at the C terminus.
  • the VP64 that comprises p65 and Rta is sometimes referred to as “VPR,” or “VP64-p65-Rta.”
  • VPR VP64-p65-Rta
  • the VP64-p65-Rta, or VPR was created by adding the transcription factors p65 and Rta to the Vp64 at the C terminus. Therefore, all three transcription factors can be targeted to the same gene.
  • GenBank Accession number of VP64 is ADD60007.1
  • GenBank Accession number of p65 is NP_001138610.1
  • GenBank Accession number of Rta is AAA66528.1
  • An exemplary amino acid sequence of a VPR is as follows: DALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLSGGPKKKRKVGS NO.: 64).
  • p300 core domain refers to the catalytic core of the human acetyltransferase p300.
  • GenBank Accession number for the protein comprising p300 is NP_001420.2.
  • KRAB refers to a Krüppel associated box (KRAB) transcriptional repression domain present in human zinc finger protein-based transcription factors (KRAB zinc finger proteins).
  • MeCp2 refers to methyl CpG binding protein 2 which represses transcription, e.g., by binding to a promoter comprising methylated DNA.
  • an epigenetic CpG modifier methylates DNA and inactivates or represses transcription.
  • a suitable epigenetic CpG modifier for use in the agent, compositions, and methods of the invention comprises a MQ1 domain or a DNMT3a-3L domain.
  • an epigenetic CpG modifier demethylates DNA and activates or stimulates transcription.
  • a suitable epigenetic recruiter for use in the agent, compositions, and methods of the invention comprises a TET1 or TET2 domain.
  • MQ1 refers to a prokaryotic DNA methyltransferase.
  • DNMT3a-3L refers to a fusion of a DNA methyltransferase, Dnmt3a and a Dnmt3L which is catalytically inactive, but directly interacts with the catalytic domains of Dnmt3a.
  • TET1 refers to “ten-eleven translocation methylcytosine dioxygenase 1,” a member of the TET family of enzymes, encoded by the TET1 gene.
  • TET1 is a dioxygenase that catalyzes the conversion of the modified DNA base 5-methylcytosine (5-mC) to 5-hydroxymethylcytosine (5-hmC) by oxidation of 5-mC in an iron and alpha-ketoglutarate dependent manner, the initial step of active DNA demethylation in mammals.
  • Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, plays a more general role in chromatin regulation. Preferentially binds to CpG-rich sequences at promoters of both transcriptionally active and Polycomb- repressed genes.
  • TET1 Involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.
  • Exemplary TET1 nucleotide and amino acid sequence can be found at GenBank Accession Nos.: NM_030625.3, NP_085128.2
  • “TET2” refers to “ten-eleven translocation 2 (TET2),” a member of the TET family of enzymes, encoded by the TET1 gene.
  • TET2 is a dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation.
  • TET2 a preference for 5- hydroxymethylcytosine in CpG motifs.
  • TET2 also mediates subsequent conversion of 5hmC into 5- formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). The conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation.
  • Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.
  • a suitable epigenetic recruiter for use in the agent, compositions, and methods of the invention comprises a MQ1 domain, a DNMT3a-3L, a TET1 or TET2 domain.
  • a suitable epigenetic recruiter for use in the agent, compositions, and methods of the invention comprises a dCas9-MQ1 fusion, a dCas9-DNMT3a-3L fusion, or a dCas9-TET1 fusion or - dCase9-TET2 fusion.
  • a cell e.g., a cell within a subject, such as a human subject (e.g., a subject in need thereof, such as a subject having a FOXP3-associated disorder, e.g., an autoimmune disease, such as IPEX syndrome )
  • delivery may be performed by contacting a cell with a disrupting agent of the invention either in vitro, ex vivo, or in vivo.
  • In vivo delivery may be performed directly by administering a composition, such as a lipid composition, comprising a disrupting agent to a subject.
  • a composition such as a lipid composition
  • in vivo delivery may be performed indirectly by administering one or more vectors that encode and direct the expression of the disrupting agent in a cell of a subject.
  • In vitro introduction into a cell includes methods known in the art such as electroporation and lipofection. Further approaches are described herein below and/or are known in the art.
  • the disrupting agent comprises a nucleic acid molecule encoding a fusion protein, the fusion protein comprising a site-specific FOXP3 targeting moiety, such as a polynucleotide encoding a DNA-binding domain of a Transcription activator-like effector (TALE) polypeptide or a zinc finger (ZNF) polypeptide, or fragment thereof, that specifically targets and binds to the FOXP3 expression control region and an effector molecule., such as a VPR.
  • TALE Transcription activator-like effector
  • ZNF zinc finger
  • the disrupting agent comprises a guide RNA and an mRNA encoding an effector molecule.
  • the ratio of guide RNA to mRNA may be about 100:1 to about 1:100 (wt:wt).
  • any method of delivery of a site-specific FOXP3 disrupting agent of the invention may be adapted for use with the disrupting agents of the invention (see e.g., Akhtar S. and Julian RL., (1992) Trends Cell. Biol.2(5):139-144 and WO94/02595, which are incorporated herein by reference in their entireties).
  • factors to be considered for delivering a site-specific FOXP3 disrupting agent of the invention include, for example, biological stability of the disrupting agent, prevention of non-specific effects, and accumulation of the disrupting agent in the target tissue.
  • the non-specific effects of a disrupting agent can be minimized by local administration, for example, by direct injection or implantation into a tissue or topically administering a composition comprising the disrupting agent.
  • Local administration to a treatment site maximizes local concentration of the disrupting agent, limits the exposure of the disrupting agent to systemic tissues that can otherwise be harmed by the disrupting agent or that can degrade the disrupting agent, and permits a lower total dose of the disrupting agent to be administered.
  • the disrupting agent e.g., a disrupting agent comprising a site-specific targeting moiety comprising a nucleic acid molecule
  • a disrupting agent comprising a site-specific targeting moiety comprising a nucleic acid molecule can be modified or alternatively delivered using a drug delivery system; both methods act to prevent the rapid degradation of a site- specific targeting moiety comprising a nucleic acid molecule by endo- and exo-nucleases in vivo.
  • Modification of a disrupting agent comprising a site-specific targeting moiety comprising a nucleic acid molecule or a pharmaceutical carrier also permits targeting of the disrupting agent to a target tissue and avoidance of undesirable off-target effects.
  • a disrupting agent of the invention may be modified by chemical conjugation to lipophilic groups such as cholesterol to enhance cellular uptake and prevent degradation.
  • a disrupting agent of the invention may be delivered using a drug delivery system such as a nanoparticle, a dendrimer, a polymer, a liposome, or a cationic delivery system.
  • Positively charged cationic delivery systems facilitate binding of disrupting agent (e.g., negatively charged molecule) and also enhance interactions at the negatively charged cell membrane to permit efficient uptake of a disrupting agent by the cell.
  • Cationic lipids, dendrimers, or polymers can either be bound to a disrupting agent, or induced to form a vesicle or micelle (see e.g., Kim SH. et al., (2008) Journal of Controlled Release 129(2):107-116) that encases the disrupting agent.
  • the formation of vesicles or micelles further prevents degradation of the disrupting agent when administered systemically.
  • Methods for making and administering cationic complexes are well within the abilities of one skilled in the art (see e.g., Sorensen, DR., et al. (2003) J. Mol. Biol 327:761-766; Verma, UN. et al., (2003) Clin. Cancer Res.
  • Some non-limiting examples of drug delivery systems useful for systemic delivery of a distrupting agent of the invention include DOTAP (Sorensen, DR., et al (2003), supra; Verma, UN. et al., (2003), supra), Oligofectamine, "solid nucleic acid lipid particles” (Zimmermann, TS. et al., (2006) Nature 441:111-114), cardiolipin (Chien, PY. et al., (2005) Cancer Gene Ther. 12:321-328; Pal, A. et al., (2005) Int J.
  • a disrupting agent e.g., gRNA, or mRNA
  • a disrupting agent forms a complex with cyclodextrin for systemic administration.
  • Methods for administration and pharmaceutical compositions comprising cyclodextrins may be found in U.S. Patent No. 7,427,605, the entire contents of which are incorporated herein by reference.
  • the disrupting agents of the invention may be incorporated into pharmaceutical compositions suitable for administration.
  • Such compositions typically include one or more species of disrupting agent and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
  • compositions of the present invention may be administered in a number of ways depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration may be topical (including ophthalmic, vaginal, rectal, intranasal, transdermal), oral, or parenteral. Parenteral administration includes intravenous drip, subcutaneous, intraperitoneal or intramuscular injection, or intrathecal or intraventricular administration.
  • the route and site of administration may be chosen to enhance delivery or targeting of the disrupting agent comprising a site-specific targeting moiety to a particular location.
  • intravenous injection may be used to target liver cells.
  • Lung cells may be targeted by administering the disrupting agent in aerosol form.
  • Jejunum cells may be targeted by anal administration.
  • Formulations for topical administration may include transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids, and powders.
  • Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
  • Coated condoms, gloves and the like may also be useful.
  • compositions for oral administration include powders or granules, suspensions or solutions in water, syrups, elixirs or non-aqueous media, tablets, capsules, lozenges, or troches.
  • carriers that can be used include lactose, sodium citrate and salts of phosphoric acid.
  • Various disintegrants such as starch, and lubricating agents such as magnesium stearate, sodium lauryl sulfate and talc, are commonly used in tablets.
  • useful diluents are lactose and high molecular weight polyethylene glycols.
  • the nucleic acid compositions can be combined with emulsifying and suspending agents.
  • compositions for intravenous administration may include sterile aqueous solutions which may also contain buffers, diluents, and other suitable additives.
  • Formulations for parenteral administration may include sterile aqueous solutions which may also contain buffers, diluents, and other suitable additives.
  • the total concentration of solutes may be controlled to render the preparation isotonic.
  • the administration of a disrupting agent composition of the invention is parenteral, e.g., intravenous (e.g., as a bolus or as a diffusible infusion), intradermal, intraperitoneal, intramuscular, intrathecal, intraventricular, intracranial, subcutaneous, transmucosal, buccal, sublingual, endoscopic, rectal, oral, vaginal, topical, pulmonary, intranasal, urethral, or ocular.
  • Administration can be provided by the subject or by another person, e.g., a health care provider.
  • the composition may be provided in measured doses or in a dispenser which delivers a metered dose. Selected modes of delivery are discussed in more detail below.
  • the disrupting agents of the invention are polynucleotides, such as mRNAs, and are formulated in lipid nanoparticles (LNPs).
  • LNPs lipid nanoparticles
  • the site-specific FOXP3 disrupting agents of the invention may be formulated into compositions, such as pharmaceutical compositions, using one or more excipients to: (1) increase stability; (2) increase cell transfection; (3) permit sustained or delayed release (e.g., from a depot formulation); (4) alter the biodistribution (e.g., target the disrupting agent to specific tissues or cell types); (5) increase the translation of an encoded protein in vivo; and/or (6) alter the release profile of an encoded protein in vivo.
  • excipients for use in the compositions of the invention may include, without limitation, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with nucleic acid molecules, modified nucleic acid molecules, or RNA (e.g., for transplantation into a subject), hyaluronidase, nanoparticle mimics and combinations thereof.
  • compositions of the invention can include one or more excipients, each in an amount that together increases the stability of the disrupting agent, increases cell transfection by the disrupting agent, increases the expression of modified nucleic acid, or mRNA encoded protein, and/or alters the release profile of a disrupting agent.
  • the disrupting agents of the present invention may be formulated using self-assembled nucleic acid nanoparticles (see, e.g., U.S. Patent Publication No.2016/0038612A1, which is incorporated herein by reference in its entirety. i.
  • Lipidoid The synthesis of lipidoids has been extensively described and formulations containing these compounds are particularly suited for delivery of a disrupting agent of the invention, such as a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule, e.g., comprising modified nucleic acid molecules or mRNA (see Mahon et al., Bioconjug Chem.2010 21:1448-1454; Schroeder et al., J Intern Med.
  • a disrupting agent of the invention such as a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule, e.g., comprising modified nucleic acid molecules or mRNA (see Mahon et al., Bioconjug Chem.2010 21:1448-1454; Schroeder et al., J Intern Med.
  • lipidoids have been used to effectively deliver double stranded small interfering RNA molecules, single stranded nucleic acid molecules, modified nucleic acid molecules or modified mRNA. (See, e.g., US Patent Publication 2016/0038612A1).
  • Complexes, micelles, liposomes or particles can be prepared containing these lipidoids and, therefore, provide effective delivery of a site- specific FOXP3 targeting moiety comprising a nucleic acid molecule, as judged by the production of an encoded protein, following the administration of a lipidoid formulation, e.g., via localized and/or systemic administration.
  • Lipidoid complexes of can be administered by various means including, but not limited to, intravenous, intramuscular, intradermal, intraperitoneal or subcutaneous routes.
  • a site-specific FOXP3 targeting moiety comprising, e.g., a nucleic acid molecule
  • PEG poly(ethylene glycol)
  • Formulations with different lipidoids including, but not limited to penta[3 -(1-laury laminopropiony I) ]-triethy lenetetramine hydrochloride (TETA-5LAP; aka 98NI2-5, see Murugaiah et al., Analytical Biochemistry, 401:61 (2010); the contents of which are herein incorporated by reference in its entirety), C12-200 (including derivatives and variants), and MDl, may be used.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising, e.g., a nucleic acid molecule, is formulated with a lipidoid for systemic intravenous administration to target cells of the liver.
  • a final optimized intravenous formulation comprising a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule, and a lipid molar composition of 42% 98NI2-5, 48% cholesterol, and 10% PEG-lipid with a final weight ratio of about 7.5 to 1 total lipid to nucleic acid molecule, and a C14 alkyl chain length on the PEG lipid, with a mean particle size of roughly 50-60 nm, can result in the distribution of the formulation to be greater than 90% to the liver (see, Akinc et al., Mol Ther.200917:872-879; the contents of which is herein incorporated by reference in its entirety).
  • an intravenous formulation using a C12-200 lipidoid (see, e.g., PCT Publication No. WO 2010/129709, which is herein incorporated by reference in their entirety) having a molar ratio of 50/10/38.5/1.5 of C12- 200/disteroylphosphatidyl choline/cholesteroI/PEG-DMG, with a weight ratio of 7 to 1 total lipid to nucleic acid molecule, and a mean particle size of 80 nm may be used to deliver a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule, to hepatocytes (see, Love et al., Proc Natl Acad Sci USA.
  • an MDl lipidoid-containing formulation may be used to effectively deliver a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule, to hepatocytes in vivo.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule
  • the characteristics of optimized lipidoid formulations for intramuscular or subcutaneous routes may vary significantly depending on the target cell type and the ability of formulations to diffuse through the extracellular matrix into the blood stream.
  • lipidoid-formulated nucleic acid molecules to deliver the formulation to other cells types including, but not limited to, endothelial cells, myeloid cells, and muscle cells may not be similarly size-limited.
  • Use of lipidoid formulations to deliver siRNA in vivo to other non-hepatocyte cells such as myeloid cells and endothelium has been reported (see Akinc et al., Nat Biotechnol.
  • lipidoid formulations may have a similar component molar ratio.
  • lipidoids and other components including, but not limited to, disteroylphosphatidyl choline, cholesterol and PEG-DMG, may be used to optimize the formulation for delivery to different cell types including, but not limited to, hepatocytes, myeloid cells, muscle cells, etc.
  • the component molar ratio may include, but is not limited to, 50% CI2-200, 10% disteroylphosphatidyl choline, 38.5% cholesterol, and 1.5% PEG-DMG (see Leuschner et al., Nat Biotechnol 201129: 1005-1010; the contents of which are herein incorporated by reference in their entirety).
  • lipidoid formulations for the localized delivery to cells (such as, but not limited to, adipose cells and muscle cells) via either subcutaneous, intradermal or intramuscular delivery, may not require all of the formulation components desired for systemic delivery and, as such, may comprise only the lipidoid and a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising, e.g., a nucleic acid molecule, as described herein.
  • Combinations of different lipidoids may be used to improve the efficacy of the formulations by increasing cell transfection and/or increasing the translation of encoded protein contained therein(see Whitehead et al., Mol.
  • the lipidoid may be prepared from the conjugate addition of alklamines to acrylates.
  • a lipidoid may be prepared by the methods described in PCT Patent Publication No. WO 2014/028487, the contents of which are herein incorporated by reference in its entirety.
  • the lipidoid may comprise a compound having formula (I), formula (II), formula (III), formula (IV) or formula (V) as described in PCT Patent Publication No. WO 2014/028487, the contents of which are herein incorporated by reference in their entirety.
  • the lipidoid may be biodegradable.
  • Liposomes, Lipoplexes, and Lipid Nanoparticles A disrupting agent of the invention may be formulated using one or more liposomes, lipoplexes, or lipid nanoparticles.
  • pharmaceutical compositions of the invention include liposomes. Liposomes are artificially-prepared vesicles which are primarily composed of a lipid bilayer and may be used as a delivery vehicle for the administration of nutrients and pharmaceutical formulations.
  • Liposomes may be of different sizes such as, but not limited to, a multilamellar vesicle (MLV) which may be hundreds of nanometers in diameter and may contain a series of concentric bilayers separated by narrow aqueous compartments, a small unicellular vesicle (SUV) which may be smaller than 50 nm in diameter, and a large unilamellar vesicle (LUV) which may be between 50 and 500 nm in diameter.
  • MLV multilamellar vesicle
  • SUV small unicellular vesicle
  • LUV large unilamellar vesicle
  • Liposome design may include, but is not limited to, opsonins or ligands in order to improve the attachment of liposomes to unhealthy tissue or to activate events such as, but not limited to, endocytosis.
  • Liposomes may contain a low or a high pH in order to improve the delivery of the pharmaceutical formulations.
  • the formation of liposomes may depend on the physicochemical characteristics such as, but not limited to, the pharmaceutical formulation entrapped and the liposomal ingredients, the nature of the medium in which the lipid vesicles are dispersed, the effective concentration of the entrapped substance and its potential toxicity, any additional processes involved during the application and/or delivery of the vesicles, the optimization size, polydispersity and the shelf-life of the vesicles for the intended application, and the batch-to-batch reproducibility and possibility of large-scale production of safe and efficient liposomal products.
  • liposomes such as synthetic membrane vesicles
  • liposomes may be prepared by the methods, apparatus and devices described in U.S. Patent Publication Nos. 2013/0177638, 2013/0177637, 2013/0177636, 201/30177635, 2013/0177634, 2013/0177633, 2013/0183375, 2013/0183373, 2013/0183372 and 2016/0038612) and PCT Patent Publication No WO 2008/042973, the contents of each of which are herein incorporated by reference in their entirety.
  • a pharmaceutical composition described herein may include, without limitation, liposomes such as those formed from 1 ,2-dioleyloxy-N,N -dimethyl ami - nopropane (DODMA) liposomes, DiLa2 liposomes from Marina Biotech (Bothell, Wash.), 1,2-dilinoleyloxy-3- dimethylaminopropane (DLin-DMA), 2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[ 1,3]-dioxolane (DLin- KC2-DMA), and MC3 (US20100324120; herein incorporated by reference in its entirety) and liposomes which may deliver small molecule drugs such as, but not limited to, DOXIL® from Janssen Biotech, Inc.
  • DODMA 1,2-dilinoleyloxy-3- dimethylaminopropane
  • DLin- KC2-DMA 2,2-dilinoleyl-4-(2-dimethylamin
  • a pharmaceutical composition described herein may include, without limitation, liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see Wheeler et al. Gene Therapy.19996:271- 281; Zhang et al. Gene Therapy.19996:1438-1447; Jeffs et al. Pharm Res.200522:362-372; Morrissey et al., Nat Biotechnol.20052:1002-1007; Zimmermann et al., Nature.
  • liposomes such as those formed from the synthesis of stabilized plasmid-lipid particles (SPLP) or stabilized nucleic acid lipid particle (SNALP) that have been previously described and shown to be suitable for oligonucleotide delivery in vitro and in vivo (see Wheeler et al.
  • the liposome formulations of the invention may be composed of 3 to 4 lipid components in addition a disrupting agent comprising a site-specific FOXP3 targeting moiety.
  • a liposome of the invention can contain, but is not limited to, 55% cholesterol, 20% disteroylphosphatidyl choline (DSPC), 10% PEG-SDSG, and 15% 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), as described by Jeffs et al.
  • liposome formulations of the invention may contain, but are not limited to,
  • liposome formulations may comprise from about 25.0% cholesterol to about 40.0% cholesterol, from about 30.0% cholesterol to about 45.0% cholesterol, from about 35.0% cholesterol to about 50.0% cholesterol and/or from about 48.5% cholesterol to about 60% cholesterol.
  • formulations of the invention may comprise a percentage of cholesterol selected from the group consisting of 28.5%, 31.5%, 33.5%, 36.5%, 37.0%, 38.5%, 39.0% and 43.5%.
  • liposome formulations of the invention may comprise from about 5.0 % to about 10.0% DSPC and/or from about 7.0% to about 15.0% DSPC.
  • a pharmaceutical composition may include liposomes which may be formed to deliver a disrupting agent of the invention.
  • the disrupting agent comprising a site-specific FOXP3 targeting moiety comprising may be encapsulated by the liposome and/or it may be contained in an aqueous core which may then be encapsulated by the liposome (see, e.g., PCT Patent Publication Nos. WO 2012/031046, WO 2012/031043, WO 2012/030901 and WO 2012/006378 and U.S. Patent Publication Nos. 2013/0189351, 2013/0195969 and 201/30202684, the contents of each of which are herein incorporated by reference in their entirety).
  • liposomes for use in the present invention may be formulated for targeted delivery.
  • the liposome may be formulated for targeted delivery to the liver.
  • a liposome may include, but is not limited to, a liposome described in U.S. Patent Publication No. 2013/0195967, the contents of which are herein incorporated by reference their its entirety.
  • formulations comprising liposomes and a disrupting agent may be administered intramuscularly, intrademrally, or intravenously.
  • a lipid formulation of the invention may include at least one cationic lipid, a lipid which enhances transfection and a least one lipid which contains a hydrophilic head group linked to a lipid moiety (International Pub. No. WO2011076807 and U.S. Pub. No. 20110200582; the entire contents of each of which is herein incorporated by reference in their entirety).
  • a lipid formulation of the invention is a lipid vesicle which may have crosslinks between functionalized lipid bilayers (see U.S Patent Publication No. 2012/0177724, the contents of which are herein incorporated by reference in their entirety).
  • a formulation comprising a disrupting agent is a lipid nanoparticle (LNP) which may comprise at least one lipid.
  • the lipid may be selected from, but is not limited to, DLin-DMA, DLin-K-DMA, 98NI2-5, CI2-200, DLin-MC3-DMA, DLin-KC2-DMA, DODMA, PLGA, PEG, PEG- DMG, PEGylated lipids and amino alcohol lipids.
  • the lipid may be a cationic lipid such as, but not limited to, DLin-DMA, DLin-D-DMA, DLin-MC3- DMA, DLin-KC2-DMA, DODMA and amino alcohol lipids.
  • the amino alcohol cationic lipid may be the lipids described in and/or made by the methods described in U.S. Patent Publication No.2013/0150625.
  • the cationic lipid may be selected from, but not limited to, a cationic lipid described in PCT Publication Nos.
  • WO 2012/040184 WO 2011/153120, WO 2011/149733, WO 2011/090965, WO 2011/043913, WO 2011/022460, WO 2012/061259, WO 2012/054365, WO 2012/044638, WO 2010/080724, WO 2010/21865, WO 2008/103276, WO 2013/086373 and WO 2013/086354, U.S. Patent Nos.7,893,302, 7,404,969, 8,283, 333, 8,466,122 and 8,569,256, and U.S.
  • the cationic lipid may be selected from, but not limited to, formula A described in PCT Publication Nos. WO 2012/040184, WO 0111/53120, WO 2011/149733, WO 2011/090965, WO 2011/043913, WO 2011/022460, WO 2012/061259, WO 2012/054365, WO 2012/044638 and WO 2013/116126 or U.S. Patent Publication Nos.
  • the cationic lipid may be selected from, but not limited to, formula CLI- CLXXIX of PCT Publication No. WO 2008/103276, formula CLICLXXIX of U.S Patent No. 7,893,302, formula CLICLXXXXII of U.S. Patent No.7,404,969 and formula I-VI of us Patent Publication No. 2010/0036115, formula I of U.S. Patent Publication No 2013/0123338; each of which is herein incorporated by reference in their entirety.
  • the cationic lipid may be synthesized by methods known in the art and/or as described in PCT Publication Nos. WO 2012/040184 WO 2011/153120, WO 2011/149733, WO 2011/090965: WO 2011/043913, WO 2011/022460, WO 2012/061259, WO 2012/054365, WO 2012/044638, WO 2010/080724, WO 2010/21865, WO 2013/126803, WO 2013/086373, and WO 2013/086354; the contents of each of which are herein incorporated by reference in their entirety.
  • the lipids which may be used in the formulations and/or for delivery of the disrupting agents described herein may be a cleavable lipid.
  • a cleavable lipid and/or pharmaceutical compositions comprising cleavable lipids include those described in PCT Patent Publication No. WO 2012/170889, the contents of which are herein incorporated by reference in their entirety.
  • the cleavable lipid may be HGT400l, HGT4002, HGT4003, HGT4004 and/or HGT4005 as described in PCT Patent Publication No. WO 2012/170889, the contents of which are herein incorporated by reference in their entirety.
  • polymers which may be used in the formulation and/or delivery of the disrupting agents described herein may include, but is not limited to, poly( ethylene) glycol (PEG), polyethylenimine (PEI), dithiobis(succinimidylpropionate) (DSP), Dimethy 1-3,3' - dithiobispropionimidate (DTBP), poly( ethylene imine) biscarbamate (PEIC), poly(L-lysine) (PLL), histidine modified PLL, poly(N-vinylpyrrohdone) (PVP), poly(propylenimine (PPI), poly(amidoamine) (PAMAM), poly(amido ethylenimine) (SS-PAEI), triehtylenetetramine (TETA), poly( ⁇ -aminoester), poly( 4- hydroxy-L-proine ester) (PHP), poly(allylamine), poly( ⁇ -[4- aminobutyl]-L-g
  • the polymer may be an inert polymer such as, but not limited to, PEG.
  • the polymer may be a cationic polymer such as, but not limited to, PEl, PLL, TETA, poly(allylamine), Poly(N -ethyl-4-vinylpyridinium bromide), pHPMA and pDMAEMA.
  • the polymer may be a biodegradable PEl such as, but not limited to, DSP, DTBP and PEIC.
  • the polymer may be biodegradable such as, but not limited to, histine modified PLL SSPAEI, poly( ⁇ -aminoester), PHP, PAGA, PLGA, PPZ, PPE, PPA and PPE-EA.
  • an LNP formulation of the invention may be prepared according to the methods described in PCT Publication Nos. WO 2011/127255 or WO 2008/103276, the contents of each of which are herein incorporated by reference in their entirety.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety may be encapsulated in an LNP formulation as described in PCT Publication Nos.
  • WO 2011/127255 and/or WO 2008/103276 the contents of each of which are herein incorporated by reference in their entirety.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety as described herein, may be formulated in a nanoparticle to be delivered by a parenteral route as described in U.S. Patent Publication No. 2012/0207845 and PCT Publication No. WO 2014/008334; the contents of each of which are herein incorporated by reference in their entirety.
  • LNP formulations described herein may be administered intramusculary.
  • the LNP formulation may comprise a cationic lipid described herein, such as, but not limited to, DLin-DMA, DLin-KC2-DMA, DLin-MC3-DMA, DODMA and C12-200.
  • LNP formulations described herein comprising a disrupting agent as described herein may be administered intradermally.
  • the LNP formulation may comprise a cationic lipid described herein, such as, but not limited to, DLin-DMA, DLin-KC2-DMA, DLin-MC3-DMA, DODMA and C12-200.
  • the nanoparticle formulations may comprise conjugate, such as a phosphate conjugate, a polymer conjugates, a conjugate that enhances the delivery of nanoparticle as described in US Patent Publication No. US20160038612 A1.
  • the lipid nanoparticle formulation comprises DLin-MC3-DMA as described in US Patent Publication No. US20100324120.
  • the lipid nanoparticle comprises a lipid compound, or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, or a lipid nanoparticle formulation, as described in US Patent No.: US10723692B2, US Patent Publication Nos. U the contents of each of which are herein incorporated by reference in their entirety (Acuitas Therapeutics, Inc.).
  • the lipid nanoparticle comprises an amino lipid, or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, or a lipid nanoparticle formulation, described by Tekmira Pharmaceuticals Corp. in US9139554B2, US9051567B2, US8883203B2, US Patent Publication US20110117125A1, the contents of each of which are herein incorporated by reference in their entirety.
  • the compound described in US9139554B2 is DLin-kC2-DMA.
  • the lipid nanoparticle comprises an amino lipid, or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, or a lipid nanoparticle formulation, described by Arbutus Biopharma Corp.
  • Lipid nanoparticles may be engineered to alter the surface properties of particles so the lipid nanoparticles may penetrate the mucosal barrier.
  • Mucus is located on mucosal tissue such as, but not limited to, oral (e.g., the buccal and esophageal membranes and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach, small intestine, large intestine, colon, rectum), nasal, respiratory (e.g., nasal, pharyngeal, tracheal and bronchial membranes), genital (e.g., vaginal, cervical and urethral membranes). Nanoparticles larger than 10-200 nm which are preferred for higher drug encapsulation efficiency and the ability to provide the sustained delivery of a wide array of drugs have been thought to be too large to rapidly diffuse through mucosal barriers.
  • oral e.g., the buccal and esophageal membranes and tonsil tissue
  • ophthalmic e.g., gastrointestinal (e.g., stomach, small intestine, large intestine, colon, rectum)
  • nasal, respiratory e.g.,
  • Mucus is continuously secreted, shed, discarded or digested and recycled so most of the trapped particles may be removed from the mucosla tissue within seconds or within a few hours.
  • Large polymeric nanoparticles 200 nm-500 nm in diameter
  • PEG polyethylene glycol
  • the transport of nanoparticles may be determined using rates of permeation and/or fluorescent microscopy techniques including, but not limited to, fluorescence recovery after photobleaching (FRAP) and high resolution multiple particle tracking (MPT).
  • FRAP fluorescence recovery after photobleaching
  • MPT high resolution multiple particle tracking
  • compositions which can penetrate a mucosal barrier may be made as described in US Pat. No. 8,241,670 or International Patent Publication No. WO2013110028, the contents of each of which are herein incorporated by reference in their entirety.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety as described herein is formulated as a lipoplex, such as, without limitation, the ATUPLEX TM system, the DACC system, the DBTC system and other siRNAlipoplex technology from Silence Therapeutics (London, United Kingdom), STEMFECFM from STEMGENT® (Cambridge, Mass.), and polyethylenimine (PEl) or protamine- based targeted and non-targeted delivery of nucleic acids (Aleku et al. Cancer Res.200868:9788-9798; Strumberg et al.
  • a lipoplex such as, without limitation, the ATUPLEX TM system, the DACC system, the DBTC system and other siRNAlipoplex technology from Silence Therapeutics (London, United Kingdom), STEMFECFM from STEMGENT® (Cambridge, Mass.), and polyethylenimine (PEl) or protamine- based targeted and non-targeted delivery of nucleic acids
  • such formulations may also be constructed or compositions altered such that they passively or actively are directed to different cell types in vivo, including but not limited to hepatocytes, immune cells, tumor cells, endothelial cells, antigen presenting cells, and leukocytes (Akinc et al. Mol Ther.
  • One example of passive targeting of formulations to liver cells includes the DLin-DMA, DLin-KC2-DMA and DLin-MC3-DMA- based lipid nanoparticle formulations which have been shown to bind to apolipoprotein E and promote binding and uptake of these formulations into hepatocytes in vivo (Akinc et al. Mol Ther.
  • Formulations can also be selectively targeted through expression of different ligands on their surface as exemplified by, but not limited by, folate, transferrin, N-acetylgalactosamine (GaINAc), and antibody targeted approaches (Kolhatkar et al., Curr Drug Discov Technol.20118: 197 -206; Musacchio and Torchilin, Front Biosci. 201116: 1388-1412; Yu et al., Mol Membr BioI. 201027:286-298; Patil et al., Crit Rev Ther Drug Carrier Syst.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety of the invention may be formulated as a solid lipid nanoparticle.
  • a solid lipid nanoparticle may be spherical with an average diameter between 10 to 1000 nm. SLN possess a solid lipid core matrix that can solubilize lipophilic molecules and may be stabilized with surfactants and/or emulsifiers.
  • the lipid nanoparticle may be a self-assembly lipid-polymer nanoparticle (see Zhang et al., ACS Nano, 2008, 2 (8), pp 1696-1702; herein incorporated by reference in its entirety).
  • the SLN may be the SLN described in PCT Publication No. WO2013/105101, the contents of which are herein incorporated by reference in their entirety.
  • the SLN may be made by the methods or processes described in PCT Publication No. WO 2013/105101, the contents of which are herein incorporated by reference in their entirety.
  • Liposomes, lipoplexes, or lipid nanoparticles may be used to improve the efficacy of a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising, e.g., a nucleic acid molecule, to direct protein production as these formulations may be able to increase cell transfection by a nucleic acid molecule; and/or increase the translation of encoded protein (e.g., an effector of the invention).
  • lipid encapsulation to enable the effective systemic delivery of polyplex plasmid DNA (Heyes et al., Mol Ther.200715:713- 720; the contents of which are herein incorporated by reference in its entirety).
  • the liposomes, lipoplexes, or lipid nanoparticles of the invention may also increase the stability of a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising, e.g., a nucleic acid molecule.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising may be formulated for controlled release and/or targeted delivery.
  • controlled release refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety may be encapsulated into a delivery agent described herein and/or known in the art for controlled release and/or targeted delivery.
  • the term "encapsulate” means to enclose, surround or encase. As it relates to the formulation of the compounds of the invention, encapsulation may be substantial, complete or partial.
  • substantially encapsulated means that at least greater than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or greater than 99.999% of the pharmaceutical composition or disrupting agent of the invention may be enclosed, surrounded or encased within the delivery agent.
  • Partial encapsulation or “partially encapsulated” means that less than 10, 10, 20, 30, 4050 or less of the pharmaceutical composition or disrupting agent of the invention may be enclosed, surrounded or encased within the delivery agent.
  • encapsulation may be determined by measuring the escape or the activity of the pharmaceutical composition or compound of the invention using fluorescence and/or electron micrograph. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the pharmaceutical composition or disrupting agent of the invention are encapsulated in the delivery agent.
  • a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising as described herein, may be encapsulated in a therapeutic nanoparticle.
  • Therapeutic nanoparticles may be formulated by methods described herein and known in the art such as, but not limited to, PCT Publication Nos. WO 2010/005740, WO 2010/030763, WO 2010/005721, WO 2010/005723, WO 2012/054923, U.S.
  • therapeutic polymer nanoparticles may be prepared by the methods described in U.S. Patent Publication No.2012/0140790, herein incorporated by reference in its entirety.
  • the therapeutic nanoparticle may comprise about 4 to about 25 weight percent of a disrupting agent and about 10 to about 99 weight percent of a diblock poly (lactic) acid-poly (ethylene)glycol copolymer comprising poly(lactic) acid as described in US Patent Publication No. 2013/0236500, the contents of which are herein incorporated by reference in its entirety.
  • the nanoparticle may comprise about 0.2 to about 35 weight percent of a disrupting agent and about 10 to about 99 weight percent of a diblock poly(lactic) acid-poly( ethylene )glycol copolymer as described in U.S. Patent Publication Nos.2013/0280339 and 2010251757 and U.S. Patent No. 8,652,528, the contents of each of which are herein incorporated by reference in their entirety.
  • a disrupting agent formulated in therapeutic nanoparticles may be administered intramuscularly, intradermally, or intravenously.
  • a disrupting agent may be delivered in therapeutic nanoparticles having a high glass transition temperature such as, but not limited to, the nanoparticles described in US Patent Publication Nos. 2014/0030351 and 2011/0294717, the entire contents of each of which are incorporated herein by reference.
  • the therapeutic nanoparticle may be formulated for sustained release.
  • sustained release refers to a pharmaceutical composition or compound that conforms to a release rate over a specific period of time. The period of time may include, but is not limited to, hours, days, weeks, months and years.
  • the sustained release nanoparticle may comprise a polymer and a disrupting agent of the present invention (see PCT Publication No.
  • a disrupting agent of the invention may be encapsulated in, linked to and/or associated with synthetic nanocarriers.
  • Synthetic nanocarriers include, but are not limited to, those described in PCT Publication . Nos.
  • WO 2010/005740 WO 2010/030763, WO 2012/13501, WO 2012/149252, WO 2012149255, WO 2012149259, WO 2012149265, WO 2012149268, WO 2012149282, WO 2012149301, WO 2012149393, WO 2012149405, WO 2012149411 and WO 20l2149454 and US Patent Publication Nos.20l10262491, 20100104645, 20100087337, 20120244222 and US20130236533, and U.S. Patent No. 8,652,487, the contents of each of which is herein incorporated by reference in their entirety.
  • the synthetic nanocarriers may be formulated using methods known in the art and/or described herein.
  • the synthetic nanocarriers may be formulated by the methods described in PCT Publication Nos. WO 2010005740, WO 2010030763 and WO 201213501 and US Patent Publication Nos. 20110262491, 20100104645, 20100087337 and 20120244222, each of which is herein incorporated by reference in their entirety.
  • the synthetic nanocarrier formulations may be lyophilized by methods described in PCT Publication No. WO 2011072218 and U.S. Patent No. 8,211,473; each of which is herein incorporated by reference in their entirety.
  • formulations of the present invention may be lyophilized or reconstituted by the methods described in US Patent Publication No.20130230568, the contents of which are herein incorporated by reference in its entirety.
  • synthetic nanocarriers comprising a disrupting agent may be administered intramuscularly, intradermally, or intravenously.
  • a disrupting agent may be formulated for delivery using smaller LNPs.
  • Such particles may comprise a diameter from below 0.1 ⁇ m up to 1000 ⁇ m such as, but not limited to, less than 0.1 ⁇ m, less than 1.0 ⁇ m, less than 5 ⁇ m, less than 10 ⁇ m, less than 15 ⁇ m, less than 20 ⁇ m, less than 25 ⁇ m, less than 30 ⁇ m, less than 35 ⁇ m, less than 40 ⁇ m, less than 50 ⁇ m, less than 55 ⁇ m, less than 60 ⁇ m, less than 65 ⁇ m, less than 70 ⁇ m, less than 75 ⁇ m, less than 80 ⁇ m, less than 85 ⁇ m, less than 90 ⁇ m, less than 95 ⁇ m, less than 100 ⁇ m, less than 125 ⁇ m, less than 150 ⁇ m, less than 175 ⁇ m, less than 200 ⁇ m, less than 225 ⁇ m, less than 250 ⁇ m, less than 275 ⁇ m, less than 300 ⁇ m, less than 325 ⁇ m, less than 350 ⁇ m, less than
  • a disrupting agent may be formulated for delivery using smaller LNPs which may comprise a diameter from about 1 nm to about 100 nm, from about 1 nm to about 10 nm, about 1 nm to about 20 nm, from about 1 nm to about 30 nm, from about 1 nm to about 40 nm, from about 1 nm to about 50 nm, from about 1 nm to about 60 nm, from about 1 nm to about 70 nm, from about 1 nm to about 80 nm, from about 1 nm to about 90 nm, from about 5 nm to about from 100 nm, from about 5 nm to about 10 nm, about 5 nm to about 20 nm, from about 5 nm to about 30 nm, from about 5 nm to about 40 nm, from about 5 nm to about 50 nm, from about 5 nm to about 60 nm, from about 5 nm to about 70
  • a disrupting agent may be formulated in smaller LNPs and may be administered intramuscularly, intrademrally, or intravenously.
  • a disrupting agent may be formulated for delivery using the drug encapsulating microspheres described in PCT Patent Publication No. WO 2013063468 or U.S. Patent No. 8,440,614, each of which is herein incorporated by reference in its entirety.
  • the amino acid, peptide, polypeptide, lipids (APPL) are useful in delivering the disrupting agents of the invention to cells (see PCT Patent Publication No. WO 2013063468, herein incorporated by reference in its entirety).
  • the lipid nanoparticle may be a limit size lipid nanoparticle described in PCT Patent Publication No. WO 2013059922, herein incorporated by reference in its entirety.
  • the limit size lipid nanoparticle may comprise a lipid bilayer surrounding an aqueous core or a hydrophobic core; where the lipid bilayer may comprise a phospholipid such as, but not limited to, diacylphosphatidylcholine, a diacylphosphatidylethanolamine, a ceramide, a sphingomyelin, a dihydrosphingomyelin, a cephalin, a cerebroside, a C8-C20 fatty acid diacylphophatidylcholine, and I-palmitoyl-2-oIeoyl phosphatidylcholine (POPC).
  • POPC I-palmitoyl-2-oIeoyl phosphatidylcholine
  • the limit size lipid nanoparticle may comprise a polyethylene glycol-lipid such as, but not limited to, DLPEPEG, DMPE-PEG, DPPC-PEG and DSPE-PEG.
  • a disrupting agent of the invention may be delivered, localized and/or concentrated in a specific location using the delivery methods described in PCT Patent Publication No. WO 2013063530, the contents of which are herein incorporated by reference in its entirety.
  • a subject may be administered an empty polymeric particle prior to, simultaneously with or after delivering the disrupting agent to the subject.
  • a disrupting agent may be formulated in an active substance release system (See e.g., US Patent Publication No.20130102545, herein incorporated by reference in its entirety).
  • the active substance release system may comprise 1) at least one nanoparticle bonded to an oligonucleotide inhibitor strand which is hybridized with a catalytically active nucleic acid and 2) a compound bonded to at least one substrate molecule bonded to a therapeutically active substance (e.g., a disrupting agent of the invention), where the therapeutically active substance is released by the cleavage of the substrate molecule by the catalytically active nucleic acid.
  • the nanoparticles of the present invention may be water soluble nanoparticles such as, but not limited to, those described in PCT Publication No. WO 2013090601, the contents of which are herein incorporated by reference in its entirety.
  • the nanoparticles may be inorganic nanoparticles which have a compact and zwitterionic ligand in order to exhibit good water solubility.
  • the nanoparticles may also have small hydrodynamic diameters (HD), stability with respect to time, pH, and salinity and a low level of non-specific protein binding.
  • the nanoparticles of the present invention are stealth nanoparticles or target- specific stealth nanoparticles such as, but not limited to, those described in U.S. Patent Publication Nos. 20130172406 (Bind), US20130251817 (Bind), 2013251816 (Bind) and 20130251766 (Bind), the contents of each of which are herein incorporated by reference in its entirety.
  • the stealth nanoparticles may comprise a diblock copolymer and a chemotherapeutic agent. These stealth nanoparticles may be made by the methods described in us Patent Publication Nos.20130172406, 20130251817, 2013251816 and 20130251766, the contents of each of which are herein incorporated by reference in its entirety. As a non- limiting example, the stealth nanoparticles may target cancer cells such as the nanoparticles described in US Patent Publication Nos.20130172406, 20130251817, 2013251816 and 20130251766, the contents of each of which are herein incorporated by reference in its entirety.
  • stealth nanoparticles comprising a disrupting agent of the invention may be administered intramuscularly, intradermally, or intravenously.
  • a disrupting agent of the invention may be formulated in and/or delivered in a lipid nanoparticle comprising a plurality of cationic lipids such as, but not limited to, the lipid nanoparticles described in US Patent Publication No.20130017223, the contents of which are herein incorporated by reference in its entirety.
  • the LNP formulation may comprise a first cationic lipid and a second cationic lipid.
  • the LNP formulation may comprise DLin-MC2-DMA and DLinMC4- DMA.
  • the LNP formulation may comprise DLin-MC3-DMA and CI2-200.
  • the LNP formulations comprising a plurality of cationic lipids (such as, but not limited to, those described in US Patent Publication No. US20130017223, the contents of which are herein incorporated by reference in its entirety) and may be administered intramuscularly, intradermally, or intravenously.
  • a disrupting agent as described herein may be formulated in and/or delivered in a lipid nanoparticle comprising the cationic lipid DLin-MC3-DMA and the neutral lipid DOPE.
  • the lipid nanoparticle may also comprise a PEG based lipid and a cholesterol or antioxidant.
  • lipid nanoparticle formulations comprising DLin-MC3-DMA and DOPE and a disrupting agent may be administered intramuscularly, intradermally, or intravenously.
  • the lipid nanoparticle comprising DLin-MC3-DMA and DOPE may comprise a PEG lipid such as, but not limited to, pentaerythritol PEG ester tetrasuccinimidyl and pentaerythritol PEG ether tetra-thiol, PEGc- DOMG, PEG-DMG (1,2-Dimyristoyl-sn-glycerol, methoxypolyethylene Glycol), PEG-DSG (1,2-Distearoyl-snglycerol, methoxypolyethylene Glycol), PEG-DPG (1,2- Dipalmitoyl-sn-glycerol, methoxypolyethylene glycol), PEG-DSA (PEG coupled to 1,2- distearyloxypropyl
  • the lipid nanoparticle comprising DLin-MC3-DMA and DOPE may include 0.5% to about 3.0%, from about 1.0% to about 3.5%, from about 1.5% to about 4.0%, from about 2.0% to about 4.5%, from about 2.5% to about 5.0% and/or from about 3.0% to about 6.0% of the lipid molar ratio of a PEG lipid.
  • the lipid nanoparticle comprising DLin-MC3-DMA and DOPE may include 25.0% cholesterol to about 50.0% cholesterol, from about 30.0% cholesterol to about 45.0% cholesterol, from about 35.0% cholesterol to about 50.0% cholesterol and/or from about 48.5% cholesterol to about 60% cholesterol.
  • formulations may comprise a percentage of cholesterol selected from the group consisting of 28.5%, 31.5%, 33.5%, 36.5%, 37.0%, 38.5%, 39.0%, 43.5% and 48.5%.
  • the lipid nanoparticle comprising DLin-MC3-DMA and DOPE may include 25.0% antioxidant to about 50.0% antioxidant, from about 30.0% antioxidant to about 45.0% antioxidant, from about 35.0% antioxidant to about 50.0% antioxidant and/or from about 48.5% antioxidant to about 60% antioxidant.
  • formulations may comprise a percentage of antioxidant selected from the group consisting of 28.5%, 31.5%, 33.5%, 36.5%, 37.0%, 38.5%, 39.0%, 43.5% and 48.5%.
  • the disrupting agent of the invention can be formulated using natural and/or synthetic polymers.
  • polymers which may be used for delivery include, but are not limited to, DYNAMIC POLYCONJUGATE ® (Arrowhead Research Corp., Pasadena, Calif.) formulations from MIRUS® Bio (Madison, Wis.) and Roche Madison (Madison, Wis.), PHASERXTM polymer formulations such as, without limitation, SMARTT POLYMER TECHNOLOGYTM (Seattle, Wash.), DMRIIDOPE, poloxamer, VAXFECTIN® adjuvant from Vical (San Diego, Calif.), chitosan, cyclodextrin from Calando Pharmaceuticals (Pasadena, Calif.), dendrimers and poly(lactic-co-glycolic acid) (PLGA) polymers, RONDELTM (RNAi/Oligonucleotide Nanoparticle Delivery) polymers (Arrowhead Research Corporation, Pasa
  • the polymer formulations may permit the sustained or delayed release of a disrupting agent (e.g., following intramuscular, intradermal or subcutaneous injection).
  • the altered release profile of the disrupting agent can result in, for example, translation of an encoded protein over an extended period of time.
  • the polymer formulation may also be used to increase the stability of the disrupting agent.
  • biodegradable polymers have been previously used to protect nucleic acids other than modified mRNA from degradation and been shown to result in sustained release of payloads in vivo (Rozema et al., Proc Natl Acad Sci USA.2007104:12982-12887; Sullivan et al., Expert Opin Drug Deliv.
  • the pharmaceutical compositions may be sustained release formulations.
  • the sustained release formulations may be for subcutaneous delivery.
  • Sustained release formulations may include, but are not limited to, PLGA microspheres, ethylene vinyl acetate (EVAc), poloxamer, GELSITE® (Nanotherapeutics, Inc. Alachua, Fla.), HYLENEX® (Halozyme Therapeutics, San Diego Calif.), surgical sealants such as fibrinogen polymers (Ethic on Inc.
  • Disrupting agents comprising a site-specific FOXP3 targeting moiety, e.g., comprising a nucleic acid molecule, may be expressed from transcription units inserted into DNA or RNA vectors (see, e.g., Couture, A, et al., TIG. (1996), 12:5-10; WO 00/22113, WO 00/22114, and US 6,054,299).
  • expression is sustained (months or longer), depending upon the specific construct used and the target tissue or cell type.
  • transgenes can be introduced as a linear construct, a circular plasmid, or a viral vector, which can be an integrating or non-integrating vector.
  • the transgene can also be constructed to permit it to be inherited as an extrachromosomal plasmid (Gassmann, et al., (1995) Proc. Natl. Acad. Sci. USA 92:1292).
  • Different components of the disrupting agent e.g., gRNA and effector, can be located on separate expression vectors that can be co-introduced (e.g., by transfection or infection) into a target cell.
  • each individual component can be transcribed by promoters both of which are located on the same expression plasmid.
  • Delivery of a disrupting agent expressing vector can be systemic, such as by intravenous or intramuscular administration, by administration to target cells ex-planted from the patient followed by reintroduction into the patient, or by any other means that allows for introduction into a desired target cell.
  • the nucleic acids described herein or the nucleic acids encoding a protein described herein, e.g., an effector are incorporated into a vector, e.g., a viral vector.
  • the individual strand or strands of a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule can be transcribed from a promoter in an expression vector.
  • two separate strands are to be expressed to generate, for example, a dsRNA
  • two separate expression vectors can be co-introduced (e.g., by transfection or infection) into a target cell.
  • each individual strand of a nucleic acid molecule can be transcribed by promoters both of which are located on the same expression plasmid.
  • a nucleic acid molecule is expressed as inverted repeat polynucleotides joined by a linker polynucleotide sequence such that the nucleic acid molecule has a stem and loop structure.
  • Expression vectors are generally DNA plasmids or viral vectors.
  • Expression vectors compatible with eukaryotic cells preferably those compatible with vertebrate cells, can be used to produce recombinant constructs for the expression of a disrupting agent as described herein. Constructs for the recombinant expression of a disrupting agent will generally require regulatory elements, e.g., promoters, enhancers, etc., to ensure the expression of the disrupting agent in target cells.
  • Expression of natural or synthetic nucleic acids is typically achieved by operably linking a nucleic acid encoding the nucleic acid of interest to a regulatory region, such as a promoter, and incorporating the construct into an expression vector.
  • the vectors can be suitable for replication and integration in eukaryotes.
  • Regulatory regions, such as a promoter suitable for operable linking to a nucleic acid molecules can be operably linked to a regulatory region such as a promoter. can be from any species. Any type of promoter can be operably linked to a nucleic acid sequence. Examples of promoters include, without limitation, tissue-specific promoters, constitutive promoters, and promoters responsive or unresponsive to a particular stimulus (e.g., inducible promoters).
  • Additional promoter elements e.g., enhancing sequences, regulate the frequency of transcriptional initiation.
  • these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • tk thymidine kinase
  • individual elements can function either cooperatively or independently to activate transcription.
  • a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence.
  • CMV immediate early cytomegalovirus
  • This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
  • EF-la Elongation Growth Factor- la
  • other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter.
  • SV40 simian virus 40
  • MMTV mouse mammary tumor virus
  • HSV human immunodeficiency virus
  • LTR long terminal repeat
  • inducible promoters are also contemplated as part of the invention.
  • the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
  • inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
  • Additional regulatory regions that may be useful in nucleic acid constructs, include, but are not limited to, transcription and translation terminators, initiation sequences, polyadenylation sequences, translation control sequences (e.g., an internal ribosome entry segment, IRES), enhancers, inducible elements, or introns. Such regulatory regions may not be necessary, although they may increase expression by affecting transcription, stability of the mRNA, translational efficiency, or the like. Such regulatory regions can be included in a nucleic acid construct as desired to obtain optimal expression of the nucleic acids in the cell(s). Sufficient expression, however, can sometimes be obtained without such additional elements.
  • the expression vector to be introduced can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
  • the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate transcriptional control sequences to enable expression in the host cells.
  • Useful selectable markers include, for example, antibiotic -resistance genes, such as neo and the like.
  • Non-limiting examples of selectable markers include puromycin, ganciclovir, adenosine deaminase (ADA), aminoglycoside phosphotransferase (neo, G418, APH), dihydrofolate reductase (DHFR), hygromycin-B-phosphtransferase, thymidine kinase (TK), and xanthin-guanine phosphoribosyltransferase (XGPRT).
  • selectable markers include fluorescent polypeptides, such as green fluorescent protein or yellow fluorescent protein.
  • Signal peptides may also be included and can be used such that an encoded polypeptide is directed to a particular cellular location (e.g., the cell surface).
  • Reporter genes may be used for identifying potentially transfected cells and for evaluating the functionality of transcriptional control sequences.
  • a reporter gene is a gene that is not present in or expressed by the recipient source and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
  • Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82).
  • Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
  • the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
  • Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
  • Other aspects to consider for vectors and constructs are known in the art.
  • a vector e.g., a viral vector comprises a disrupting agent comprising a site-specific FOXP3 targeting moiety comprising a nucleic acid molecule.
  • Viral vector systems which can be utilized with the methods and compositions described herein include, but are not limited to, (a) adenovirus vectors (e.g., an Ad5/F35 vector); (b) retrovirus vectors, including but not limited to lentiviral vectors (including integration competent or integration-defective lentiviral vectors), moloney murine leukemia virus, etc.; (c) adeno- associated virus vectors; (d) herpes simplex virus vectors; (e) SV 40 vectors; (f) polyoma virus vectors; (g) papilloma virus vectors; (h) picornavirus vectors; (i) pox virus vectors such as an orthopox, e.g., vaccinia virus vectors or avipox, e
  • the constructs can include viral sequences for transfection, if desired.
  • the construct can be incorporated into vectors capable of episomal replication, e.g. EPV and EBV vectors. See, e.g., U.S. Patent Nos.6,534,261; 6,607,882; 6,824,978; 6,933,113; 6,979,539; 7,013,219; and 7,163,824, the entire contents of each of which is incorporated by reference herein.
  • Vectors including those derived from retroviruses such as lentivinis, are suitable tools to achieve long- term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
  • Examples of vectors include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • the expression vector may be provided to a cell in the form of a viral vector.
  • Viral vector technology is well known in the art, and described in a variety of virology and molecular biology manuals.
  • a suitable viral vector for use in the present invention is an adeno-associated viral vector, such as a recombinant adeno-associate viral vector.
  • Recombinant adeno-associated virus vectors are gene delivery systems based on the defective and nonpathogenic parvovirus adeno-associated type 2 virus. All vectors are derived from a plasmid that retains only the AAV 145 bp inverted terminal repeats flanking the transgene expression cassette. Efficient gene transfer and stable transgene delivery due to integration into the genomes of the transduced cell are key features for this vector system. (Wagner et al., Lancet 351:91171702-3 (1998), Kearns et al., Gene Ther. 9:748-55 (1996)).
  • AAV serotypes including AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8 and AAV9, can be used in accordance with the present invention.
  • Replication-deficient recombinant adenoviral vectors can be produced at high titer and readily infect a number of different cell types. Most adenovirus vectors are engineered such that a transgene replaces the Ad E1a, E1b, and/or E3 genes; subsequently the replication defective vector is propagated in human 293 cells that supply deleted gene function in trans.
  • Ad vectors can transduce multiple types of tissues in vivo, including nondividing, differentiated cells such as those found in liver, kidney and muscle.
  • Ad vectors have a large carrying capacity.
  • An example of the use of an Ad vector in a clinical trial involved polynucleotide therapy for antitumor immunization with intramuscular injection (Sterman et al., Hum. Gene Ther. 7:1083-9 (1998)).
  • Additional examples of the use of adenovirus vectors for gene transfer in clinical trials include Rosenecker et al., Infection 24:15-10 (1996); Sterman et al., Hum. Gene Ther. 9:71083-1089 (1998); Welsh et al., Hum. Gene Ther.2:205-18 (1995); Alvarez et al., Hum.
  • Packaging cells are used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ⁇ 2 cells or PA317 cells, which package retrovirus.
  • Viral vectors used in gene therapy are usually generated by a producer cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host (if applicable), other viral sequences being replaced by an expression cassette encoding the protein to be expressed.
  • AAV vectors used in gene therapy typically only possess inverted terminal repeat (ITR) sequences from the AAV genome which are required for packaging and integration into the host genome.
  • Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
  • the cell line is also infected with adenovirus as a helper.
  • the helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid.
  • the helper plasmid is not packaged in significant amounts due to a lack of ITR sequences.
  • Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
  • IV. Methods of the Invention A. Modulation of Expression of FOXP3 in a Cell
  • the present invention also provides methods of use of the agents and compositions described herein to modulate expression of forkhead box P3 (FOXP3) in a cell.
  • the methods include contacting the cell, e.g., a na ⁇ ve T cell, with a site-specific FOXP3 disrupting agent, the disrupting agent comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, and an effector molecule, thereby modulating expression of FOXP3 in the cell.
  • the site-specific disrupting agent, the effector, or both the site-specific disrupting agent and the effector may be present in a composition, such as a composition described above. In some embodiments, the site-specific disrupting agent and the effector are present in the same compositions. In other embodiments, the site-specific disrupting agent and the effector are present in different compositions. In some embodiments, the methods of the invention include contacting a cell with two site-specific FOXP3 disrupting agents (a first and a second agent).
  • the two site specific FOXP3 disrupting agents may be present in the same composition, e.g., pharmaceutical composition, e.g., pharmaceutical composition comprising an LNP, or in seprate compositions , e.g., pharmaceutical composition, e.g., pharmaceutical composition comprising an LNP.
  • the cell may be contacted with the first site specific FOXP3 disrupting agent at one time and contacted with the second site specific FOXP3 disrupting agent at a second time, or the cell may be contacted with both agents at the same time.
  • Expression of FOXP3 may be enhanced or reduced as compared to, for example, a cell that was not contacted with the site-specific FOXP3 disrupting agent. Modulation in gene expression can be assessed by any methods known in the art.
  • a modulation in the expression may be determined by determining the mRNA expression level of a gene, e.g., in a cell, a plurality of cells, and/or a tissue sample, using methods routine to one of ordinary skill in the art, e.g., northern blotting, qRT- PCR; by determining the protein level of a gene using methods routine to one of ordinary skill in the art, such as western blotting, immunological techniques.
  • the term “reduced” in the context of the level of FOXP3 gene expression or FOXP3 protein production in a subject, or a disease marker or symptom refers to a statistically significant decrease in such level.
  • the decrease can be, for example, at least 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or below the level of detection for the detection method.
  • the expression of the target is normalized, i.e., decreased towards or to a level accepted as within the range of normal for an individual without such disorder.
  • “lower” in a subject can refer to lowering of gene expression or protein production in a cell in a subject does not require lowering of expression in all cells or tissues of a subject.
  • lowering in a subject can include lowering of gene expression or protein production in the liver of a subject.
  • the term “reduced” can also be used in association with normalizing a symptom of a disease or condition, i.e. decreasing the difference between a level in a subject suffering from an autoimmune disease or a FOXP3-associated disease towards or to a level in a normal subject not suffering from an autoimmune disease or a FOXP3-associated disease.
  • a disease is associated with an elevated value for a symptom, “normal” is considered to be the upper limit of normal. If a disease is associated with a decreased value for a symptom, “normal” is considered to be the lower limit of normal.
  • the term “enhanced” in the context of the level of FOXP3 gene expression or FOXP3 protein production in a subject, or a disease marker or symptom refers to a statistically significant increase in such level.
  • the increase can be, for example, at least 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or above the level of detection for the detection method.
  • the expression of the target is normalized, i.e., increase towards or to a level accepted as within the range of normal for an individual without such disorder.
  • “higher” in a subject can refer to increasing gene expression or protein production in a cell in a subject does not require increasing expression in all cells or tissues of a subject.
  • increasing in a subject can include increasing gene expression or protein production in the liver of a subject.
  • the term “enhanced” can also be used in association with normalizing a symptom of a disease or condition, i.e. increasing the difference between a level in a subject suffering from a FOXP3-associated disease or an autoimmune disease towards or to a level in a normal subject not suffering from a FOXP3- associated disease or an autoimmune disease.
  • a suitable cell for use in the methods of the invention is a mammalian cell.
  • the cell is a somatic cell.
  • the cell is a primary cell.
  • the cell is a mammalian somatic cell.
  • the mammalian somatic cell is a primary cell.
  • the mammalian somatic cell is a non- embryonic cell.
  • the step of contacting may be performed in vitro, in vivo (i.e., the cell may be within a subject), or ex vivo.
  • contacting a cell is performed ex vivo and the methods further include, prior to the step of contacting, a step of removing the cell (e.g., a mammalian cell) from a subject.
  • the methods further comprise, after the step of contacting, a step of (b) administering the cell (e.g., mammalian cells) to a subject.
  • the present invention provides methods of generating immune cells, e.g., Tregs, which, in one aspect of the invention include a site-specific FOXP3 disrupting agent of the invention.
  • the FOXP3 disrupting agent may modulate, e.g., increase, the expression of FOXP3 gene for a period of time that is sufficient to direct the immune cells to a differentiation pathway or alter the activation status, for example, to induce a na ⁇ ve T cell to differentiate into a Treg cell or to activate a Treg cell.
  • the instant invention provides a method for manipulating cells, e.g., immune cells or a sub-population thereof (e.g., Tregs or na ⁇ ve T cells).
  • cells e.g., immune cells or a sub-population thereof (e.g., Tregs or na ⁇ ve T cells).
  • the term “manipulation” includes, for example, activation, division, differentiation, growth, expansion, reprogramming, anergy, quiescence, senescence, apoptosis or death of the target cells.
  • a variety of cells, e.g., immune cells may be manipulated, including, fresh samples derived from subjects, primary cultured cells, immortalized cells, cell-lines, hybridomas, etc.
  • the cells to be manipulated may also include stem cells, such as embryonic stem cells, induced pluripotent stem cells, mobilized peripheral blood stem cells.
  • the manipulated cells may be used for various immunotherapeutic applications as well as for research.
  • the cells may be manipulated ex vivo by culturing a sample containing immune cells, such as a sample obtained from a subject, such as a subject that would benefit from modulating the expression of FOXP3, with the FOXP3 disrupting agent of the invention.
  • the immune cells to be manipulated may be na ⁇ ve T cells isolated from cord blood or peripheral blood.
  • the na ⁇ ve T cells may be manipulated (e.g., differentiated and/or activated) by contacting the cells with a FOXP3 disrupting agent of the invention.
  • the na ⁇ ve T cells may further be contacted with an antigen or an antigen presenting cell to differentiate into antigen specific Tregs.
  • the immune cells to be manipulated may be Treg cells.
  • Tregs may be manipulated (e.g., activated) by contacting the cells with the FOXP3 disrupting agent of the invention.
  • the term “regulatory T cells,” “Treg cells,” or “Tregs,” also known as “suppressor T cells,” refers to a population of T cells which modulate the immune system, maintain tolerance to self-antigens, and prevent autoimmune disease. Tregs are immunosuppressive and generally suppress or downregulate induction and proliferation of effector T cells. Tregs express the biomarkers CD4, FOXP3, and CD25 and are thought to be derived from the same lineage as na ⁇ ve CD4 cells. As used herein, the term “na ⁇ ve T cells,” refers to a population of T cells that has differentiated in bone marrow, and successfully undergone the positive and negative processes of central selection in the thymus.
  • the present invention further relates to methods for expanding certain immune cells, such as na ⁇ ve T cells or Tregs from a population of immune cells, e.g., expanding Tregs or na ⁇ ve T cells contained in sample containing B-cells, dendritic cells, macrophages, plasma cells, and the like.
  • the present invention also relates to methods for expanding a specific population of T-cells, e.g., expanding differentiated / activated Tregs.
  • the immune cells e.g., Tregs
  • ex vivo T cell expansion can be performed by first isolating Tregs or na ⁇ ve T cells from a sample and subsequently stimulating T-cells by contacting them with the FOXP3 disrupting agent of the invention, such that the Tregs are activated, and/or expanded.
  • the T cells are primary T-cells obtained from a subject.
  • T- cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, spleen tissue, and tumors.
  • any number of primary T-cells and/or T-cell lines available in the art may be used. Studies on whole blood counts reveal that the number of T-cells in whole blood is very low.
  • the leukocyte population in whole blood is about 0.1- 0.2% (due to predominance of erythrocytes), of which T-cells make up about 7-24% of the overall leukocyte population.
  • T-cells CD4+ T-cells make up about 4-20% of the overall leukocyte population (translating to less than 0.04% of the overall cell population in whole blood) and CD8+ T-cells make up about 2-11% of the overall leukocyte population (translating to less than 0.022% of the overall cell population in whole blood).
  • methods of the invention may be coupled with other art-known techniques for enrichment of immune cells, e.g., na ⁇ ve T cells or Tregs.
  • the enrichment step may be carried out prior to contacting the sample with the FOXP3 disrupting agent of the instant invention.
  • the enrichment step may be carried out after the sample has been contacted with the FOXP3 disrupting agent of the present invention.
  • the Tregs population may be enriched using FICOLL separation.
  • cells from the circulating blood of an individual are obtained by apheresis or leukapheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are then washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • a semi-automated “flow-through” centrifuge may also be used according to the manufacturer's instructions.
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • peripheral or whole blood T cells may be enriched by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient.
  • a specific subpopulation of T cells such as CD28+, CD4+, CD8+, CD45RA+, and CD45RO+T cells, can be further isolated by positive or negative selection techniques. In accordance with the present invention, various sorting techniques may be optionally employed.
  • the expanded or manipulated T cell population may be further sorted using a combination of antibodies directed to surface markers unique to the cells.
  • a preferred method is cell sorting and/or selection via magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells selected.
  • to enrich Tregs it may be desirable to select regulatory T cells which typically express CD4+, CD25+, CD62Lhi, GITR+, and FoxP3+.
  • the concentration of cells and scaffold surface can be varied.
  • a concentration of 2 billion cells/ml is used.
  • a concentration of 1 billion cells/ml is used.
  • greater than 100 million cells/ml is used.
  • a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used.
  • concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest.
  • the instant invention may include art-known procedures for sample preparation. For example, T cells may be frozen after the washing step and thawed prior to use. Freezing and subsequent thawing provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After the washing step that removes plasma and platelets, the cells may be suspended in a freezing solution.
  • one method involves using PBS containing 20% DMSO and 8% human serum albumin, or other suitable cell freezing media containing for example, HESPAN and PLASMALYTE A, the cells then are frozen to ⁇ 80° C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank.
  • Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at ⁇ 20° C or in liquid nitrogen.
  • the source of the cells to be expanded can be collected at any time point necessary, and desired cells, such as T cells, isolated and frozen for later use in T cell therapy for any number of diseases or conditions that would benefit from T cell therapy, such as those described herein.
  • a blood sample or a leukapheresis is taken from a generally healthy subject.
  • a blood sample or a leukapheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
  • the T cells may be expanded, frozen, and used at a later time.
  • samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
  • the instant invention relates to methods for obtaining a polyclonal population of CD4+/FOXP3+ or CD4+/FOXP3- cells.
  • the method comprises contacting the FOXP3 disrupting agent of the invention with a subject’s biological sample, thereby activating, and optionally expanding a population of T-cells present within the sample; contacting the T-cells in the sample with a reagent for detection of CD4+ cells; further contacting the T-cells with a reagent for detection of FOXP3+ cells; and isolating a sub-population of detected CD4+/FOXP3+ or CD4+/FOXP3- T-cells from the sample.
  • the reagent for the detection and/or isolation of CD4+ and/or FOXP3+ T- cells is preferably an antibody or antigen-binding fragment thereof which specifically binds to CD4+ and FOXP3 markers.
  • the present invention relates to methods for obtaining a population of na ⁇ ve T cells.
  • the method for isolating na ⁇ ve T cells are known in the art, for example, using commercially available kits such as EasySep TM Human Na ⁇ ve CD4+ T Cell Isolation Kit of STEMCELL Technologies.
  • the immune cells that have been differentiated / activated may be further expanded.
  • the activated Tregs may be cultured in the presence of certain cytokines, e.g., IL- 2, to be further expanded.
  • the present invention provides immune cells which include the FOXP3 disrupting agent.
  • the FOXP3 disrupting agent may be present in the immune cells for a period of time that is long enough to induce the immune cells, e.g., na ⁇ ve T cells, to differentiate into Tregs or to activate the Tregs.
  • the immune cells may contain one or more genetic modifications that modulate, e.g., activate, the expression of the FOXP3 gene.
  • Such a genetic modification may be present in the cells after the FOXP3 disrupting agent disappears from the cells or remains in the cell at very low level. Accordingly, the expression of the FOXP3 gene may remain activated even after the FOXP3 disrupting agent stops functioning.
  • the genetic modification may be introduced by the site-specific FOXP3 disrupting agent.
  • the genetic modification includes addition, deletion, or substitution of one or more nucleotides to a target sequence, e.g., DNA regions around/proximally upstream of the TSS of FOXP3 gene.
  • the genetic modification may be an epigenetic modification of one or more nucleotides of the target sequence (e.g., methylation /demethylation) or an epigenetic modification of one or more chromatin proteins (e.g., acetylation / deacetylation) at the target sequence, e.g., DNA regions around/proximally upstream of the TSS of FOXP3 gene.
  • the in vivo methods of the invention may include administering to a subject an agent, a composition, or cells of the invention.
  • immune cells e.g., na ⁇ ve T cell or Tregs
  • the FOXP3 disrupting agent may be administered in a subject, e.g., subcutaneously or intravenously.
  • subject refers to an organism, for example, a mammal (e.g., a human, a non-human mammal, a non-human primate, a primate, a laboratory animal, a mouse, a rat, a hamster, a gerbil, a cat, or a dog).
  • a human subject is an adult, adolescent, or pediatric subject.
  • a subject had a disease or a condition.
  • the subject is suffering from a disease, disorder or condition, e.g., a disease, disorder or condition that can be treated as provided herein.
  • a subject is susceptible to a disease, disorder, or condition; in some embodiments, a susceptible subject is predisposed to and/or shows an increased risk (as compared to the average risk observed in a reference subject or population) of developing the disease, disorder or condition.
  • a subject displays one or more symptoms of a disease, disorder or condition.
  • a subject does not display a particular symptom (e.g.,. clinical manifestation of disease) or characteristic of a disease, disorder, or condition.
  • a subject does not display any symptom or characteristic of a disease, disorder, or condition.
  • a subject is a patient.
  • a subject is an individual to whom diagnosis and/or therapy is and/or has been administered.
  • Subjects that would benefit from the methods of the invention include subjects having an autoimmune disease, a subject at risk of an autoimmune disease, “FOXP3-associated disease,” or a subject at risk of an “FOXP3-associated disease.”
  • the treatment methods of the invention include administering an agent, a composition, or cells of the invention to a subject, e.g., a subject that would benefit from a modulation of FOXP3 expression, such as a subject having an autoimmune disease or a FOXP3-associated disease, in a therapeutically effective amount.
  • the methods of the invention include the subject may be administered two site-specific FOX3P disrupting agents (a first and a second agent).
  • the two site specific FOX3P disrupting agents may be present in the same composition, e.g., pharmaceutical composition, e.g., pharmaceutical composition comprising an LNP, or in seprate compositions, e.g., pharmaceutical composition, e.g., pharmaceutical composition comprising an LNP.
  • the subject may be administered the first site specific FOX3P disrupting agent at one time and administered the second site specific FOX3P disrupting agent at a second time, or the subject may be administered both agents at the same time.
  • the present invention provides methods for preventing at least one symptom in a subject that would benefit from a modulation of FOXP3 expression, such as a subject having an autoimmune disease or a FOXP3-associated disease, by administering to the subject an agent, a composition, or cells of the invention in a prophylactically effective amount.
  • “Therapeutically effective amount,” as used herein, is intended to include the amount of an agent or composition or cells that, when administered to a patient for treating a subject having an autoimmune disease or a FOXP3-associated disease, is sufficient to effect treatment of the disease (e.g., by diminishing, ameliorating, or maintaining the existing disease or one or more symptoms of disease or its related comorbidities).
  • the “therapeutically effective amount” may vary depending on the agent or composition or cells, how it is administered, the disease and its severity and the history, age, weight, family history, genetic makeup, stage of pathological processes mediated by FOXP3 gene expression, the types of preceding or concomitant treatments, if any, and other individual characteristics of the patient to be treated.
  • “Prophylactically effective amount,” as used herein, is intended to include the amount of an agent or composition or cells that, when administered to a subject who does not yet experience or display symptoms of a FOXP3-associated disease, but who may be predisposed to a FOXP3-associated disease, is sufficient to prevent or delay the development or progression of the disease or one or more symptoms of the disease for a clinically significant period of time.
  • the “prophylactically effective amount” may vary depending on the agent or composition, how it is administered, the degree of risk of disease, and the history, age, weight, family history, genetic makeup, the types of preceding or concomitant treatments, if any, and other individual characteristics of the patient to be treated.
  • prevention or “preventing,” when used in reference to a disease, disorder or condition thereof, that would benefit from an activation in expression of a FOXP3 gene or production of FOXP3 protein refers to a reduction in the likelihood that a subject will develop a symptom associated with such a disease, disorder, or condition, e.g., a sign or symptom of Tregs or FOXP3 gene dysfunction.
  • a “therapeutically-effective amount” or “prophylactically effective amount” also includes an amount of an agent or composition or cells that produces some desired local or systemic effect at a reasonable benefit/risk ratio applicable to any treatment. Agents and compositions or cells employed in the methods of the present invention may be administered in a sufficient amount to produce a reasonable benefit/risk ratio applicable to such treatment. In some embodiments, a therapeutically effective amount or prophylactically effect amount is administered in a single dose; in some embodiments, multiple unit doses are required to deliver a therapeutically or prophylactically effective amount. As used herein, the phrase “symptoms are reduced” may be used when one or more symptoms of a particular disease, disorder or condition is reduced in magnitude (e.g., intensity, severity, etc.) and/or frequency.
  • a delay in the onset of a particular symptom is considered one form of reducing the frequency of that symptom.
  • the composition or cells can be administered by any means known in the art including, but not limited to oral, intraperitoneal, or parenteral routes, including intracranial (e.g., intraventricular, intraparenchymal, and intrathecal), intravenous, intramuscular, subcutaneous, transdermal, airway (aerosol), nasal, rectal, and topical (including buccal and sublingual) administration.
  • the compositions are administered by intravenous infusion or injection.
  • the compositions are administered by subcutaneous injection.
  • FOXP3-associated disease includes a disease, disorder or condition that would benefit from a modulation, e.g., an increase, in FOXP3 gene expression, replication, or protein activity, such as an autoimmune disease or a disease that is associated with a Treg dysfunction.
  • Non-limiting examples of FOXP3-associated diseases include autoimmune diseases, for example, IPEX syndrome (IPEX), Type 1 diabetes, Multiple sclerosis, Systemic lupus erythematosus (SLE), Rheumatoid arthritis (RA), Achalasia, Addison’s disease, Adult Still's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome, Autoimmune angioedema, Autoimmune dysautonomia, Autoimmune encephalomyelitis, Autoimmune hepatitis, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune orchitis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune urticaria, Axonal & neuro
  • a FOXP3-associated disease is selected from the group consisting of IPEX syndrome (IPEX), Type 1 diabetes, Multiple sclerosis, Systemic lupus erythematosus (SLE), and Rheumatoid arthritis (RA). Further details regarding signs and symptoms of the various diseases or conditions are provided herein and are well known in the art (see, e.g., ghr.nlm.nih.gov) Administration of the agents or compositions or cells of the invention according to the methods of the invention may result in a reduction of the severity, signs, symptoms, or markers of a FOXP3- associated disease or disorder in a patient with a FOXP3-associated disease or disorder.
  • IPEX IPEX syndrome
  • SLE Systemic lupus erythematosus
  • RA Rheumatoid arthritis
  • reduction in this context is meant a statistically significant decrease in such level.
  • the reduction can be, for example, at least about 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or to below the level of detection of the assay used.
  • Administration of the agents or compositions or cells according to the methods of the invention may stably or transiently modulating expression of a target gene, or may stably or transiently increase the amount or the activation level of Tregs.
  • a modulation of expression persists for at least about 1 hr to about 30 days, or at least about 2 hrs, 6 hrs, 12 hrs, 18 hrs, 24 hrs, 2 days, 3, days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, or longer or any time therebetween.
  • a modulation of expression persists for no more than about 30 mins to about 7 days, or no more than about 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 13 hrs, 14 hrs, 15 hrs, 16 hrs, 17 hrs, 18 hrs, 19 hrs, 20 hrs, 21 hrs, 22 hrs, 24 hrs, 36 hrs, 48 hrs, 60 hrs, 72 hrs, 4 days, 5 days, 6 days, 7 days, or any time therebetween.
  • the amount of Tregs may increase by about at least 5% to about 10 fold, or at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, or more or any time therebetween.
  • the percentage of activated Tregs e.g., Tregs characterized by increased expression of FOXP3, may increase by about at least 5% to about 10 fold, or at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, or more or any time therebetween.
  • the expression of FOXP3 in a Tregs, or in a population of Tregs may increase by about at least 5% to about 10 fold, or at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, or more or any time therebetween.
  • the agents or compositions or cells may be administered once to the subject or, alternatively, multiple administrations may be performed over a period of time. For example, two, three, four, five, or more administrations may be given to the subject during one treatment or over a period of time.
  • administering may be given to the subject during one treatment or over a period of time as a treatment regimen.
  • administrations may be given as needed, e.g., for as long as symptoms associated with the disease, disorder or condition persist.
  • repeated administrations may be indicated for the remainder of the subject's life.
  • Treatment periods may vary and could be, e.g., one day, two days, three days, one week, two weeks, one month, two months, three months, six months, a year, or longer.
  • Efficacy of treatment or prevention of disease can be assessed, for example by measuring disease progression, disease remission, symptom severity, reduction in pain, quality of life, dose of a medication required to sustain a treatment effect, level of a disease marker, or any other measurable parameter appropriate for a given disease being treated or targeted for prevention. It is well within the ability of one skilled in the art to monitor efficacy of treatment or prevention by measuring any one of such parameters, or any combination of parameters. As discussed herein, the specific parameters to be measured depend on the autoimmune disease or FOXP3-associated disease that the subject is suffering from. Comparisons of the later readings with the initial readings provide a physician an indication of whether the treatment is effective.
  • a favorable change of at least 10% in a measurable parameter of disease can be indicative of effective treatment.
  • Efficacy for a given agent or composition can also be judged using an experimental animal model for the given disease as known in the art. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant reduction in a marker or symptom is observed. Alternatively, the efficacy can be measured by a reduction in the severity of disease as determined by one skilled in the art of diagnosis based on a clinically accepted disease severity grading scale. Any positive change resulting in e.g., lessening of severity of disease measured using the appropriate scale, represents adequate treatment using an agent or composition as described herein.
  • the terms “treating” or “treatment” refer to a beneficial or desired result including, but not limited to, alleviation or amelioration of one or more signs or symptoms associated with an autoimmune disease or reduction in FOXP3 gene expression or FOXP3 protein production. "Treatment” can also mean prolonging survival as compared to expected survival in the absence of treatment.
  • D. Combination Methods The present invention further provides combination methods to activate Treg cells.
  • in vitro or ex vivo differentiation or activation of Tregs by FOXP3 activation can be combined with stimulation by TGF ⁇ , for example, by including TGF ⁇ in the growth medium used when culturing cells in vitro or ex vivo, as described herein.
  • TGF ⁇ is an important growth factor in T-cell differentiation and known for triggering FOXP3 activation.
  • the present invention is next described by means of the following examples. However, the use of these and other examples anywhere in the specification is illustrative only, and in no way limits the scope and meaning of the invention or of any exemplified form. The invention is not limited to any particular preferred embodiments described herein. Many modifications and variations of the invention may be apparent to those skilled in the art and can be made without departing from its spirit and scope. The contents of all references, patents and published patent applications cited throughout this application, including the figures, are incorporated herein by reference.
  • FOXP3 activation in Jurkat Cells This example describes activation of FOXP3 expression in Jurkat cells, as measured by the increase of FOXP3 mRNA level and protein level, using a site-specific FOXP3 disrupting agent, comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, i.e., a sgRNA, and an effector comprising dCas9, dCas9 and p300, or dCas9 and VPR.
  • a site-specific FOXP3 disrupting agent comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, i.e., a sgRNA, and an effector comprising dCas9, dCas9 and p300, or dCas9 and VPR.
  • Jurkat cells that are human leukemic T-cell line were transfected with either dCas9- or dCas9-p300- or dCas9-VPR- encoding mRNA along with sgRNA targeting different regions around and upstream of the transcription start site (TSS) with Lipofectamine Messeger Max according to manufacturer’s recommendations.
  • TSS transcription start site
  • Pools of three guide RNAs were used and one pool was found to activate FOXP3 mRNA with both p300 (9 fold) and VPR (100 fold) ( Figure 1A).
  • a pool of sgRNAs was found to induce FOXP3 protein production in combination with a VPR protein.
  • FOXP3 activation in na ⁇ ve T-cells This example describes activation of FOXP3 expression in na ⁇ ve T-cells, as measured by the increase of FOXP3 mRNA level and protein level, using a site-specific FOXP3 disrupting agent, comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, i.e., a sgRNA, and an effector comprising dCas9, dCas9 and p300, or dCas9 and VPR.
  • a site-specific FOXP3 disrupting agent comprising a site-specific FOXP3 targeting moiety which targets a FOXP3 expression control region, i.e., a sgRNA, and an effector comprising dCas9, dCas9 and p300, or dCas9 and VPR.
  • Table 2 Site-Specific FOXP3 Targeting Moieties – The first 20 nucleotides in each moiety below comprise the targeting portion of the moiety.
  • Table 3 Site-Specific FOXP3 Targeting Moieties – Nucleotide Sequences of FOXP3 Guides Used in Examples 1 and 2 and Complementary Target Sequence in the Genome Note: *: All single guides were 100 nucleotide long. The indicated 20mer targeting region was part of the SpCas9 PAM single guide RNA having the following 80 nt sequence for dCas9 binding: 5’- #: Pool numbers are the same as those in Figures 1A and 1B.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Transplantation (AREA)
  • Virology (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Particle Formation And Scattering Control In Inkjet Printers (AREA)
  • Ink Jet (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2021/021825 2020-03-11 2021-03-11 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression Ceased WO2021183720A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
JP2022554320A JP2023517326A (ja) 2020-03-11 2021-03-11 フォークヘッドボックスp3(foxp3)遺伝子発現をモジュレートするための組成物および方法
EP21715725.4A EP4118207A1 (en) 2020-03-11 2021-03-11 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression
AU2021234302A AU2021234302A1 (en) 2020-03-11 2021-03-11 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression
CA3173528A CA3173528A1 (en) 2020-03-11 2021-03-11 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression
CN202180034263.2A CN116096886A (zh) 2020-03-11 2021-03-11 用于调节叉头框p3(foxp3)基因表达的组合物和方法
US17/929,828 US20230114151A1 (en) 2020-03-11 2022-09-06 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202062988044P 2020-03-11 2020-03-11
US62/988,044 2020-03-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/929,828 Continuation US20230114151A1 (en) 2020-03-11 2022-09-06 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression

Publications (2)

Publication Number Publication Date
WO2021183720A1 true WO2021183720A1 (en) 2021-09-16
WO2021183720A8 WO2021183720A8 (en) 2021-10-21

Family

ID=75302656

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/021825 Ceased WO2021183720A1 (en) 2020-03-11 2021-03-11 Compositions and methods for modulating forkhead box p3 (foxp3) gene expression

Country Status (7)

Country Link
US (1) US20230114151A1 (enExample)
EP (1) EP4118207A1 (enExample)
JP (1) JP2023517326A (enExample)
CN (1) CN116096886A (enExample)
AU (1) AU2021234302A1 (enExample)
CA (1) CA3173528A1 (enExample)
WO (1) WO2021183720A1 (enExample)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023081787A3 (en) * 2021-11-04 2023-09-28 Prime Medicine, Inc. Genome editing compositions and methods for treatment of fanconi anemia
WO2024197058A3 (en) * 2023-03-21 2024-10-31 Lung Biotechnology Pbc Methods for creating regulatory t cells (tregs) using genome engineering

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2020352552A1 (en) 2019-09-23 2022-03-17 Omega Therapeutics, Inc. Compositions and methods for modulating hepatocyte nuclear factor 4-alpha (HNF4α) gene expression
WO2025019742A1 (en) * 2023-07-19 2025-01-23 Omega Therapeutics, Inc. Methods and compositions for modulating ctnnb1 expression

Citations (127)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994002595A1 (en) 1992-07-17 1994-02-03 Ribozyme Pharmaceuticals, Inc. Method and reagent for treatment of animal diseases
WO2000022113A1 (en) 1998-10-09 2000-04-20 Ingene, Inc. ENZYMATIC SYNTHESIS OF ssDNA
WO2000022114A1 (en) 1998-10-09 2000-04-20 Ingene, Inc. PRODUCTION OF ssDNA $i(IN VIVO)
US6054299A (en) 1994-04-29 2000-04-25 Conrad; Charles A. Stem-loop cloning vector and method
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7013219B2 (en) 1999-01-12 2006-03-14 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
WO2008042973A2 (en) 2006-10-03 2008-04-10 Alnylam Pharmaceuticals, Inc. Lipid containing formulations
US7404969B2 (en) 2005-02-14 2008-07-29 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
WO2008103276A2 (en) 2007-02-16 2008-08-28 Merck & Co., Inc. Compositions and methods for potentiated activity of biologicaly active molecules
US7427605B2 (en) 2005-03-31 2008-09-23 Calando Pharmaceuticals, Inc. Inhibitors of ribonucleotide reductase subunit 2 and uses thereof
WO2010005740A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles
WO2010005723A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US20100036115A1 (en) 1997-07-23 2010-02-11 Sirna Therapeutics, Inc. Novel Compositions for the Delivery of Negatively Charged Molecules
WO2010021865A1 (en) 2008-08-18 2010-02-25 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
WO2010030763A2 (en) 2008-09-10 2010-03-18 Bind Biosciences, Inc. High throughput fabrication of nanoparticles
WO2010075072A2 (en) 2008-12-15 2010-07-01 Bind Biosciences Long circulating nanoparticles for sustained release of therapeutic agents
WO2010080724A1 (en) 2009-01-12 2010-07-15 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
US20100251757A1 (en) 2006-10-25 2010-10-07 Panasonic Corporation Refrigeration cycle apparatus and fluid machine used for the same
WO2010129709A1 (en) 2009-05-05 2010-11-11 Alnylam Pharmaceuticals, Inc. Lipid compositions
US20100324120A1 (en) 2009-06-10 2010-12-23 Jianxin Chen Lipid formulation
US7893302B2 (en) 2005-02-14 2011-02-22 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
WO2011022460A1 (en) 2009-08-20 2011-02-24 Merck Sharp & Dohme Corp. Novel cationic lipids with various head groups for oligonucleotide delivery
WO2011043913A2 (en) 2009-10-08 2011-04-14 Merck Sharp & Dohme Corp. Novel cationic lipids with short lipid chains for oligonucleotide delivery
US20110117125A1 (en) 2008-01-02 2011-05-19 Tekmira Pharmaceuticals Corporation Compositions and methods for the delivery of nucleic acids
WO2011072218A2 (en) 2009-12-11 2011-06-16 Bind Biosciences Stable formulations for lyophilizing therapeutic particles
WO2011076807A2 (en) 2009-12-23 2011-06-30 Novartis Ag Lipids, lipid compositions, and methods of using them
WO2011090965A1 (en) 2010-01-22 2011-07-28 Merck Sharp & Dohme Corp. Novel cationic lipids for oligonucleotide delivery
WO2011127255A1 (en) 2010-04-08 2011-10-13 Merck Sharp & Dohme Corp. Preparation of lipid nanoparticles
US20110262491A1 (en) 2010-04-12 2011-10-27 Selecta Biosciences, Inc. Emulsions and methods of making nanocarriers
WO2011149733A2 (en) 2010-05-24 2011-12-01 Merck Sharp & Dohme Corp. Novel amino alcohol cationic lipids for oligonucleotide delivery
US20110294717A1 (en) 2009-12-15 2011-12-01 Ali Mir M Therapeutic Polymeric Nanoparticle Compositions with High Glass Transition Temperature or High Molecular Weight Copolymers
WO2011153120A1 (en) 2010-06-04 2011-12-08 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
US8084599B2 (en) 2004-03-15 2011-12-27 City Of Hope Methods and compositions for the specific inhibition of gene expression by double-stranded RNA
WO2012006378A1 (en) 2010-07-06 2012-01-12 Novartis Ag Liposomes with lipids having an advantageous pka- value for rna delivery
WO2012013501A1 (de) 2010-07-29 2012-02-02 Fujitsu Technology Solutions Intellectual Property Gmbh Computersystem, verfahren zum programmieren einer echtzeituhr und computerprogrammprodukt
WO2012030901A1 (en) 2010-08-31 2012-03-08 Novartis Ag Small liposomes for delivery of immunogen-encoding rna
WO2012031046A2 (en) 2010-08-31 2012-03-08 Novartis Ag Lipids suitable for liposomal delivery of protein-coding rna
WO2012031043A1 (en) 2010-08-31 2012-03-08 Novartis Ag Pegylated liposomes for delivery of immunogen-encoding rna
WO2012040184A2 (en) 2010-09-20 2012-03-29 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012044638A1 (en) 2010-09-30 2012-04-05 Merck Sharp & Dohme Corp. Low molecular weight cationic lipids for oligonucleotide delivery
WO2012054365A2 (en) 2010-10-21 2012-04-26 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012054923A2 (en) 2010-10-22 2012-04-26 Bind Biosciences, Inc. Therapeutic nanoparticles with high molecular weight copolymers
WO2012061259A2 (en) 2010-11-05 2012-05-10 Merck Sharp & Dohme Corp. Novel low molecular weight cyclic amine containing cationic lipids for oligonucleotide delivery
US20120177724A1 (en) 2010-03-19 2012-07-12 Massachusetts Institute Of Technology Lipid vesicle compositions and methods of use
US20120201859A1 (en) 2002-05-02 2012-08-09 Carrasquillo Karen G Drug Delivery Systems and Use Thereof
US20120202871A1 (en) 2009-07-01 2012-08-09 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
US8241670B2 (en) 2004-04-15 2012-08-14 Chiasma Inc. Compositions capable of facilitating penetration across a biological barrier
US20120207845A1 (en) 2005-01-04 2012-08-16 Hsing-Wen Sung Pharmaceutical composition of nanoparticles
US20120244222A1 (en) 2011-03-25 2012-09-27 Selecta Biosciences, Inc. Osmotic mediated release synthetic nanocarriers
US8283333B2 (en) 2009-07-01 2012-10-09 Protiva Biotherapeutics, Inc. Lipid formulations for nucleic acid delivery
WO2012149282A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers for generating cd8+regulatory t cells
US8318211B2 (en) 2008-06-16 2012-11-27 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising vinca alkaloids and methods of making and using same
WO2012170889A1 (en) 2011-06-08 2012-12-13 Shire Human Genetic Therapies, Inc. Cleavable lipids
US8349809B2 (en) 2008-12-18 2013-01-08 Dicerna Pharmaceuticals, Inc. Single stranded extended dicer substrate agents and methods for the specific inhibition of gene expression
US20130017223A1 (en) 2009-12-18 2013-01-17 The University Of British Columbia Methods and compositions for delivery of nucleic acids
US20130064894A1 (en) 2011-08-31 2013-03-14 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
US20130102545A1 (en) 2009-12-16 2013-04-25 Magforce Ag Temperature dependent activation of catalytic nucleic acids for controlled active substance release
WO2013063530A2 (en) 2011-10-28 2013-05-02 Presage Biosciences, Inc. Methods for drug delivery
WO2013063468A1 (en) 2011-10-27 2013-05-02 Massachusetts Institute Of Technology Amino acid derivates functionalized on the n- terminal capable of forming drug incapsulating microspheres
WO2013059922A1 (en) 2011-10-25 2013-05-02 The University Of British Columbia Limit size lipid nanoparticles and related methods
US8440431B2 (en) 2009-12-10 2013-05-14 Regents Of The University Of Minnesota TAL effector-mediated DNA modification
US8440614B2 (en) 2000-12-29 2013-05-14 Aphios Corporation Polymer microspheres/nanospheres and encapsulating therapeutic proteins therein
US20130123338A1 (en) 2010-05-12 2013-05-16 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
US20130129785A1 (en) 2010-05-10 2013-05-23 Alnylam Pharmaceuticals, Inc Methods and compositions for delivery of active agents
WO2013086354A1 (en) 2011-12-07 2013-06-13 Alnylam Pharmaceuticals, Inc. Biodegradable lipids for the delivery of active agents
WO2013086373A1 (en) 2011-12-07 2013-06-13 Alnylam Pharmaceuticals, Inc. Lipids for the delivery of active agents
US8466122B2 (en) 2010-09-17 2013-06-18 Protiva Biotherapeutics, Inc. Trialkyl cationic lipids and methods of use thereof
WO2013090601A2 (en) 2011-12-16 2013-06-20 Massachusetts Institute Of Technology Compact nanoparticles for biological applications
US20130172406A1 (en) 2007-09-28 2013-07-04 Bind Biosciences, Inc. Cancer Cell Targeting Using Nanoparticles
US20130177634A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
WO2013105101A1 (en) 2012-01-13 2013-07-18 Department Of Biotechnology Solid lipid nanoparticles entrapping hydrophilic/ amphiphilic drug and a process for preparing the same
WO2013110028A1 (en) 2012-01-19 2013-07-25 The Johns Hopkins University Nanoparticle formulations with enhanced mucosal penetration
US20130195967A1 (en) 2009-12-01 2013-08-01 Shire Human Genetic Therapies, Inc. Liver specific delivery of messenger rna
WO2013116126A1 (en) 2012-02-01 2013-08-08 Merck Sharp & Dohme Corp. Novel low molecular weight, biodegradable cationic lipids for oligonucleotide delivery
US8513207B2 (en) 2008-12-18 2013-08-20 Dicerna Pharmaceuticals, Inc. Extended dicer substrate agents and methods for the specific inhibition of gene expression
WO2013126803A1 (en) 2012-02-24 2013-08-29 Protiva Biotherapeutics Inc. Trialkyl cationic lipids and methods of use thereof
US20130236533A1 (en) 2007-10-12 2013-09-12 Massachusetts Institute Of Technology Vaccine Nanotechnology
US20130243848A1 (en) 2012-03-14 2013-09-19 The Board Of Trustees Of The Leland Stanford Junior University Nanoparticles, nanoparticle delivery methods, and systems of delivery
US8563041B2 (en) 2008-12-12 2013-10-22 Bind Therapeutics, Inc. Therapeutic particles suitable for parenteral administration and methods of making and using same
US20130303587A1 (en) 2010-06-30 2013-11-14 Protiva Biotherapeutics, Inc. Non-liposomal systems for nucleic acid delivery
US8613951B2 (en) 2008-06-16 2013-12-24 Bind Therapeutics, Inc. Therapeutic polymeric nanoparticles with mTor inhibitors and methods of making and using same
WO2014008334A1 (en) 2012-07-06 2014-01-09 Alnylam Pharmaceuticals, Inc. Stable non-aggregating nucleic acid lipid particle formulations
US20140039032A1 (en) 2011-12-12 2014-02-06 Kyowa Hakko Kirin Co., Ltd. Lipid nano particles comprising cationic lipid for drug delivery system
WO2014028487A1 (en) 2012-08-13 2014-02-20 Massachusetts Institute Of Technology Amine-containing lipidoids and uses thereof
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8883203B2 (en) 2006-04-07 2014-11-11 Merrion Research Iii Limited Solid oral dosage form containing an enhancer
US8889356B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8906616B2 (en) 2012-12-12 2014-12-09 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US8993233B2 (en) 2012-12-12 2015-03-31 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US9051567B2 (en) 2009-06-15 2015-06-09 Tekmira Pharmaceuticals Corporation Methods for increasing efficacy of lipid formulated siRNA
US9139554B2 (en) 2008-10-09 2015-09-22 Tekmira Pharmaceuticals Corporation Amino lipids and methods for the delivery of nucleic acids
WO2015162422A1 (en) * 2014-04-22 2015-10-29 Mina Therapeutics Limited Sarna compositions and methods of use
US20150344912A1 (en) 2012-10-23 2015-12-03 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
US20160038612A1 (en) 2013-03-14 2016-02-11 Moderna Therapeutics, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
US20160138008A1 (en) 2012-05-25 2016-05-19 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US20160208243A1 (en) 2015-06-18 2016-07-21 The Broad Institute, Inc. Novel crispr enzymes and systems
US20170027658A1 (en) 2014-04-09 2017-02-02 Arbutus Medical Inc. Drill cover and chuck mechanism
US9687550B2 (en) 2009-12-07 2017-06-27 Arbutus Biopharma Corporation Compositions for nucleic acid delivery
WO2018031762A1 (en) * 2016-08-10 2018-02-15 Duke University Compositions, systems and methods for programming immune cell function through targeted gene regulation
WO2018049073A1 (en) 2016-09-07 2018-03-15 Flagship Pioneering, Inc. Methods and compositions for modulating gene expression
US9938236B2 (en) 2012-12-27 2018-04-10 Drexel University Antiviral agents against HBV infection
WO2018081480A1 (en) 2016-10-26 2018-05-03 Acuitas Therapeutics, Inc. Lipid nanoparticle formulations
WO2018107026A1 (en) 2016-12-09 2018-06-14 Sangamo Therapeutics, Inc. Delivery of target specific nucleases
WO2018191719A1 (en) 2017-04-13 2018-10-18 Acuitas Therapeutics, Inc. Lipid delivery of therapeutic agents to adipose tissue
US20180303925A1 (en) 2015-04-27 2018-10-25 The Trustees Of The University Of Pennsylvania Nucleoside-Modified RNA For Inducing an Adaptive Immune Response
WO2018200943A1 (en) 2017-04-28 2018-11-01 Acuitas Therapeutics, Inc. Novel carbonyl lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20190022247A1 (en) 2015-12-30 2019-01-24 Acuitas Therapeutics, Inc. Lipids and lipid nanoparticle formulations for delivery of nucleic acids
WO2019036008A1 (en) 2017-08-16 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICULAR FORMULATIONS
WO2019036030A1 (en) 2017-08-17 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICLE FORMULATIONS
WO2019036028A1 (en) 2017-08-17 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICULAR FORMULATIONS
WO2019089828A1 (en) 2017-10-31 2019-05-09 Acuitas Therapeutics, Inc. Lamellar lipid nanoparticles
US20190240354A1 (en) 2016-06-30 2019-08-08 Arbutus Biopharma Corporation Compositions and methods for delivering messenger rna
US20190274968A1 (en) 2016-10-27 2019-09-12 The Trustees Of The University Of Pennsylvania Nucleoside-modified rna for inducing an adaptive immune response
US20190314524A1 (en) 2015-10-28 2019-10-17 Acuitas Therapeutics, Inc. Novel lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20190359556A1 (en) 2015-06-29 2019-11-28 Acuitas Therapeutics, Inc. Lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20200046838A1 (en) 2017-04-13 2020-02-13 Acuitas Therapeutics, Inc. Lipids for delivery of active agents
WO2020081938A1 (en) 2018-10-18 2020-04-23 Acuitas Therapeutics, Inc. Lipids for lipid nanoparticle delivery of active agents
WO2020097520A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Cationic lipids containing silicon
WO2020097493A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Negatively charged peg-lipid conjugates
WO2020097548A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Lipid nanoparticle formulations
WO2020097540A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Lipid nanoparticle formulations
US20200163878A1 (en) 2016-10-26 2020-05-28 Curevac Ag Lipid nanoparticle mrna vaccines
US20200172472A1 (en) 2017-08-17 2020-06-04 Acuitas Therapeutics, Inc. Lipids for use in lipid nanoparticle formulations
WO2020146805A1 (en) 2019-01-11 2020-07-16 Acuitas Therapeutics, Inc. Lipids for lipid nanoparticle delivery of active agents
US10723692B2 (en) 2014-06-25 2020-07-28 Acuitas Therapeutics, Inc. Lipids and lipid nanoparticle formulations for delivery of nucleic acids

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10378027B2 (en) * 2013-03-15 2019-08-13 The General Hospital Corporation RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci
KR101884278B1 (ko) * 2016-02-15 2018-08-01 충남대학교 산학협력단 Foxp3 및 CD200 수용체 활성화제를 포함하는 발작성 질환 예방 또는 치료용 약학적 조성물
WO2017181026A1 (en) * 2016-04-15 2017-10-19 Translate Bio Ma, Inc. Selective modulation of foxp3 expression
AU2017296195A1 (en) * 2016-07-11 2019-01-24 Translate Bio Ma, Inc. Nucleic acid conjugates and uses thereof
AU2016427822B2 (en) * 2016-10-31 2025-01-23 Seattle Children's Hospital (dba Seattle Children's Research Institute) Method for treating autoimmune disease using CD4 T-cells with engineered stabilization of expression of endogennous FOXP3 gene

Patent Citations (205)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994002595A1 (en) 1992-07-17 1994-02-03 Ribozyme Pharmaceuticals, Inc. Method and reagent for treatment of animal diseases
US6054299A (en) 1994-04-29 2000-04-25 Conrad; Charles A. Stem-loop cloning vector and method
US20100036115A1 (en) 1997-07-23 2010-02-11 Sirna Therapeutics, Inc. Novel Compositions for the Delivery of Negatively Charged Molecules
WO2000022113A1 (en) 1998-10-09 2000-04-20 Ingene, Inc. ENZYMATIC SYNTHESIS OF ssDNA
WO2000022114A1 (en) 1998-10-09 2000-04-20 Ingene, Inc. PRODUCTION OF ssDNA $i(IN VIVO)
US6979539B2 (en) 1999-01-12 2005-12-27 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6933113B2 (en) 1999-01-12 2005-08-23 Sangamo Biosciences, Inc. Modulation of endogenous gene expression in cells
US7013219B2 (en) 1999-01-12 2006-03-14 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US7163824B2 (en) 1999-01-12 2007-01-16 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6607882B1 (en) 1999-01-12 2003-08-19 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6534261B1 (en) 1999-01-12 2003-03-18 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US6824978B1 (en) 1999-01-12 2004-11-30 Sangamo Biosciences, Inc. Regulation of endogenous gene expression in cells using zinc finger proteins
US8440614B2 (en) 2000-12-29 2013-05-14 Aphios Corporation Polymer microspheres/nanospheres and encapsulating therapeutic proteins therein
US20120201859A1 (en) 2002-05-02 2012-08-09 Carrasquillo Karen G Drug Delivery Systems and Use Thereof
US8084599B2 (en) 2004-03-15 2011-12-27 City Of Hope Methods and compositions for the specific inhibition of gene expression by double-stranded RNA
US8241670B2 (en) 2004-04-15 2012-08-14 Chiasma Inc. Compositions capable of facilitating penetration across a biological barrier
US20120207845A1 (en) 2005-01-04 2012-08-16 Hsing-Wen Sung Pharmaceutical composition of nanoparticles
US7893302B2 (en) 2005-02-14 2011-02-22 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
US7404969B2 (en) 2005-02-14 2008-07-29 Sirna Therapeutics, Inc. Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules
US7427605B2 (en) 2005-03-31 2008-09-23 Calando Pharmaceuticals, Inc. Inhibitors of ribonucleotide reductase subunit 2 and uses thereof
US8883203B2 (en) 2006-04-07 2014-11-11 Merrion Research Iii Limited Solid oral dosage form containing an enhancer
WO2008042973A2 (en) 2006-10-03 2008-04-10 Alnylam Pharmaceuticals, Inc. Lipid containing formulations
US20100251757A1 (en) 2006-10-25 2010-10-07 Panasonic Corporation Refrigeration cycle apparatus and fluid machine used for the same
WO2008103276A2 (en) 2007-02-16 2008-08-28 Merck & Co., Inc. Compositions and methods for potentiated activity of biologicaly active molecules
US20130251816A1 (en) 2007-03-30 2013-09-26 Bind Therapeutics, Inc. Cancer cell targeting using nanoparticles
US20130251817A1 (en) 2007-03-30 2013-09-26 Bind Therapeutics, Inc. Cancer cell targeting using nanoparticles
US20130251766A1 (en) 2007-09-28 2013-09-26 Bind Therapeutics, Inc. Cancer cell targeting using nanoparticles
US20130172406A1 (en) 2007-09-28 2013-07-04 Bind Biosciences, Inc. Cancer Cell Targeting Using Nanoparticles
US20130236533A1 (en) 2007-10-12 2013-09-12 Massachusetts Institute Of Technology Vaccine Nanotechnology
US20110117125A1 (en) 2008-01-02 2011-05-19 Tekmira Pharmaceuticals Corporation Compositions and methods for the delivery of nucleic acids
WO2010005723A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US8206747B2 (en) 2008-06-16 2012-06-26 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US20130236500A1 (en) 2008-06-16 2013-09-12 Bind Biosciences, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US8293276B2 (en) 2008-06-16 2012-10-23 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US8617608B2 (en) 2008-06-16 2013-12-31 Bind Therapeutics, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US8652528B2 (en) 2008-06-16 2014-02-18 Bind Therapeutics, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
WO2010005740A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles
US20130243827A1 (en) 2008-06-16 2013-09-19 Bind Therapeutics, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20100104645A1 (en) 2008-06-16 2010-04-29 Bind Biosciences, Inc. Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles
US8623417B1 (en) 2008-06-16 2014-01-07 Bind Therapeutics, Inc. Therapeutic polymeric nanoparticles with mTOR inhibitors and methods of making and using same
US8613954B2 (en) 2008-06-16 2013-12-24 Bind Therapeutics, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
WO2010005721A2 (en) 2008-06-16 2010-01-14 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US20110274759A1 (en) 2008-06-16 2011-11-10 Greg Troiano Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US8613951B2 (en) 2008-06-16 2013-12-24 Bind Therapeutics, Inc. Therapeutic polymeric nanoparticles with mTor inhibitors and methods of making and using same
US20130251757A1 (en) 2008-06-16 2013-09-26 Bind Biosciences, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20100068286A1 (en) 2008-06-16 2010-03-18 Greg Troiano Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20100068285A1 (en) 2008-06-16 2010-03-18 Zale Stephen E Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US8609142B2 (en) 2008-06-16 2013-12-17 Bind Therapeutics, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US20130230567A1 (en) 2008-06-16 2013-09-05 Bind Therapeutics, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20130280339A1 (en) 2008-06-16 2013-10-24 Bind Therapeutics, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US8318208B1 (en) 2008-06-16 2012-11-27 Bind Biosciences, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US8318211B2 (en) 2008-06-16 2012-11-27 Bind Biosciences, Inc. Therapeutic polymeric nanoparticles comprising vinca alkaloids and methods of making and using same
US20120288541A1 (en) 2008-06-16 2012-11-15 Zale Stephen E Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US20130302433A1 (en) 2008-06-16 2013-11-14 Bind Therapeutics, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
US8603534B2 (en) 2008-06-16 2013-12-10 Bind Therapeutics, Inc. Drug loaded polymeric nanoparticles and methods of making and using same
US20130302432A1 (en) 2008-06-16 2013-11-14 Bind Therapeutics, Inc. Drug Loaded Polymeric Nanoparticles and Methods of Making and Using Same
WO2010021865A1 (en) 2008-08-18 2010-02-25 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
WO2010030763A2 (en) 2008-09-10 2010-03-18 Bind Biosciences, Inc. High throughput fabrication of nanoparticles
US20100087337A1 (en) 2008-09-10 2010-04-08 Bind Biosciences, Inc. High Throughput Fabrication of Nanoparticles
US20130123351A1 (en) 2008-09-10 2013-05-16 Bind Biosciences, Inc. High throughput fabrication of nanoparticles
US9139554B2 (en) 2008-10-09 2015-09-22 Tekmira Pharmaceuticals Corporation Amino lipids and methods for the delivery of nucleic acids
US8563041B2 (en) 2008-12-12 2013-10-22 Bind Therapeutics, Inc. Therapeutic particles suitable for parenteral administration and methods of making and using same
US20110217377A1 (en) 2008-12-15 2011-09-08 Zale Stephen E Long Circulating Nanoparticles for Sustained Release of Therapeutic Agents
WO2010075072A2 (en) 2008-12-15 2010-07-01 Bind Biosciences Long circulating nanoparticles for sustained release of therapeutic agents
US20100216804A1 (en) 2008-12-15 2010-08-26 Zale Stephen E Long Circulating Nanoparticles for Sustained Release of Therapeutic Agents
US8349809B2 (en) 2008-12-18 2013-01-08 Dicerna Pharmaceuticals, Inc. Single stranded extended dicer substrate agents and methods for the specific inhibition of gene expression
US8513207B2 (en) 2008-12-18 2013-08-20 Dicerna Pharmaceuticals, Inc. Extended dicer substrate agents and methods for the specific inhibition of gene expression
WO2010080724A1 (en) 2009-01-12 2010-07-15 Merck Sharp & Dohme Corp. Novel lipid nanoparticles and novel components for delivery of nucleic acids
WO2010129709A1 (en) 2009-05-05 2010-11-11 Alnylam Pharmaceuticals, Inc. Lipid compositions
US20100324120A1 (en) 2009-06-10 2010-12-23 Jianxin Chen Lipid formulation
US9051567B2 (en) 2009-06-15 2015-06-09 Tekmira Pharmaceuticals Corporation Methods for increasing efficacy of lipid formulated siRNA
US20130122104A1 (en) 2009-07-01 2013-05-16 Protiva Biotherapeutics, Inc. Novel lipid formulations for delivery of therapeutic agents to solid tumors
US20120202871A1 (en) 2009-07-01 2012-08-09 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
US8283333B2 (en) 2009-07-01 2012-10-09 Protiva Biotherapeutics, Inc. Lipid formulations for nucleic acid delivery
US8569256B2 (en) 2009-07-01 2013-10-29 Protiva Biotherapeutics, Inc. Cationic lipids and methods for the delivery of therapeutic agents
WO2011022460A1 (en) 2009-08-20 2011-02-24 Merck Sharp & Dohme Corp. Novel cationic lipids with various head groups for oligonucleotide delivery
WO2011043913A2 (en) 2009-10-08 2011-04-14 Merck Sharp & Dohme Corp. Novel cationic lipids with short lipid chains for oligonucleotide delivery
US20130195967A1 (en) 2009-12-01 2013-08-01 Shire Human Genetic Therapies, Inc. Liver specific delivery of messenger rna
US9687550B2 (en) 2009-12-07 2017-06-27 Arbutus Biopharma Corporation Compositions for nucleic acid delivery
US8450471B2 (en) 2009-12-10 2013-05-28 Regents Of The University Of Minnesota TAL effector-mediated DNA modification
US8440431B2 (en) 2009-12-10 2013-05-14 Regents Of The University Of Minnesota TAL effector-mediated DNA modification
US8440432B2 (en) 2009-12-10 2013-05-14 Regents Of The University Of Minnesota Tal effector-mediated DNA modification
US20130230568A1 (en) 2009-12-11 2013-09-05 Bind Therapeutics, Inc. Stable Formulations for Lyophilizing Therapeutic Particles
US8211473B2 (en) 2009-12-11 2012-07-03 Bind Biosciences, Inc. Stable formulations for lyophilizing therapeutic particles
WO2011072218A2 (en) 2009-12-11 2011-06-16 Bind Biosciences Stable formulations for lyophilizing therapeutic particles
US20120140790A1 (en) 2009-12-15 2012-06-07 Ali Mir M Therapeutic Polymeric Nanoparticle Compositions with High Glass Transition Termperature or High Molecular Weight Copolymers
US20110294717A1 (en) 2009-12-15 2011-12-01 Ali Mir M Therapeutic Polymeric Nanoparticle Compositions with High Glass Transition Temperature or High Molecular Weight Copolymers
US20140030351A1 (en) 2009-12-15 2014-01-30 Bind Therapeutics, Inc. Therapeutic Polymeric Nanoparticle Compositions with High Glass Transition Temperature or High Molecular Weight Copolymers
US20130102545A1 (en) 2009-12-16 2013-04-25 Magforce Ag Temperature dependent activation of catalytic nucleic acids for controlled active substance release
US20160317676A1 (en) 2009-12-18 2016-11-03 Tekmira Pharmaceuticals Corporation Methods and compositions for delivery of nucleic acids
US20130017223A1 (en) 2009-12-18 2013-01-17 The University Of British Columbia Methods and compositions for delivery of nucleic acids
WO2011076807A2 (en) 2009-12-23 2011-06-30 Novartis Ag Lipids, lipid compositions, and methods of using them
US20110200582A1 (en) 2009-12-23 2011-08-18 Novartis Ag Lipids, lipid compositions, and methods of using them
WO2011090965A1 (en) 2010-01-22 2011-07-28 Merck Sharp & Dohme Corp. Novel cationic lipids for oligonucleotide delivery
US20120177724A1 (en) 2010-03-19 2012-07-12 Massachusetts Institute Of Technology Lipid vesicle compositions and methods of use
WO2011127255A1 (en) 2010-04-08 2011-10-13 Merck Sharp & Dohme Corp. Preparation of lipid nanoparticles
US20130177637A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130183372A1 (en) 2010-04-09 2013-07-18 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130183375A1 (en) 2010-04-09 2013-07-18 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130183373A1 (en) 2010-04-09 2013-07-18 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130177633A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130177638A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130177636A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130177635A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20130177634A1 (en) 2010-04-09 2013-07-11 Pacira Pharmaceuticals, Inc. Method for formulating large diameter synthetic membrane vesicles
US20110262491A1 (en) 2010-04-12 2011-10-27 Selecta Biosciences, Inc. Emulsions and methods of making nanocarriers
US20130129785A1 (en) 2010-05-10 2013-05-23 Alnylam Pharmaceuticals, Inc Methods and compositions for delivery of active agents
US20130123338A1 (en) 2010-05-12 2013-05-16 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
WO2011149733A2 (en) 2010-05-24 2011-12-01 Merck Sharp & Dohme Corp. Novel amino alcohol cationic lipids for oligonucleotide delivery
US20130150625A1 (en) 2010-05-24 2013-06-13 Brian W. Budzik Novel Amino Alcohol Cationic Lipids for Oligonucleotide Delivery
WO2011153120A1 (en) 2010-06-04 2011-12-08 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
US20130303587A1 (en) 2010-06-30 2013-11-14 Protiva Biotherapeutics, Inc. Non-liposomal systems for nucleic acid delivery
WO2012006378A1 (en) 2010-07-06 2012-01-12 Novartis Ag Liposomes with lipids having an advantageous pka- value for rna delivery
WO2012013501A1 (de) 2010-07-29 2012-02-02 Fujitsu Technology Solutions Intellectual Property Gmbh Computersystem, verfahren zum programmieren einer echtzeituhr und computerprogrammprodukt
WO2012030901A1 (en) 2010-08-31 2012-03-08 Novartis Ag Small liposomes for delivery of immunogen-encoding rna
WO2012031043A1 (en) 2010-08-31 2012-03-08 Novartis Ag Pegylated liposomes for delivery of immunogen-encoding rna
US20130189351A1 (en) 2010-08-31 2013-07-25 Novartis Ag Lipids suitable for liposomal delivery of protein coding rna
WO2012031046A2 (en) 2010-08-31 2012-03-08 Novartis Ag Lipids suitable for liposomal delivery of protein-coding rna
US20130195969A1 (en) 2010-08-31 2013-08-01 Novartis Ag Small liposomes for delivery of immunogen encoding rna
US20130202684A1 (en) 2010-08-31 2013-08-08 Lichtstrasse Pegylated liposomes for delivery of immunogen encoding rna
US8466122B2 (en) 2010-09-17 2013-06-18 Protiva Biotherapeutics, Inc. Trialkyl cationic lipids and methods of use thereof
US20130178541A1 (en) 2010-09-20 2013-07-11 Matthew G. Stanton Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012040184A2 (en) 2010-09-20 2012-03-29 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012044638A1 (en) 2010-09-30 2012-04-05 Merck Sharp & Dohme Corp. Low molecular weight cationic lipids for oligonucleotide delivery
WO2012054365A2 (en) 2010-10-21 2012-04-26 Merck Sharp & Dohme Corp. Novel low molecular weight cationic lipids for oligonucleotide delivery
WO2012054923A2 (en) 2010-10-22 2012-04-26 Bind Biosciences, Inc. Therapeutic nanoparticles with high molecular weight copolymers
US20130225836A1 (en) 2010-11-05 2013-08-29 Merck Sharp & Dohme Corp. Novel low molecular weight cyclic amine containing cationic lipids for oligonucleotide delivery
WO2012061259A2 (en) 2010-11-05 2012-05-10 Merck Sharp & Dohme Corp. Novel low molecular weight cyclic amine containing cationic lipids for oligonucleotide delivery
US20120244222A1 (en) 2011-03-25 2012-09-27 Selecta Biosciences, Inc. Osmotic mediated release synthetic nanocarriers
WO2012149454A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers coupled to cd1d-restricted antigens and methods of use
WO2012149411A1 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Controlled release of immunosuppressants from synthetic nanocarriers
WO2012149252A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers
WO2012149268A1 (en) 2011-04-29 2012-11-01 Selecta Biociences, Inc. Tolerogenic synthetic nanocarriers for allergy therapy
WO2012149259A1 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers to reduce antibody responses
US8652487B2 (en) 2011-04-29 2014-02-18 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers for inducing regulatory B cells
WO2012149301A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers for inducing regulatory b cells
WO2012149265A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers to reduce cytotoxic t lymphocyte responses
WO2012149393A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers for antigen-specific deletion of t effector cells
WO2012149405A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers for regulating innate immune responses
WO2012149282A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers for generating cd8+regulatory t cells
WO2012149255A2 (en) 2011-04-29 2012-11-01 Selecta Biosciences, Inc. Tolerogenic synthetic nanocarriers to reduce immune responses to therapeutic proteins
WO2012170889A1 (en) 2011-06-08 2012-12-13 Shire Human Genetic Therapies, Inc. Cleavable lipids
US20130064894A1 (en) 2011-08-31 2013-03-14 Protiva Biotherapeutics, Inc. Novel cationic lipids and methods of use thereof
WO2013059922A1 (en) 2011-10-25 2013-05-02 The University Of British Columbia Limit size lipid nanoparticles and related methods
WO2013063468A1 (en) 2011-10-27 2013-05-02 Massachusetts Institute Of Technology Amino acid derivates functionalized on the n- terminal capable of forming drug incapsulating microspheres
WO2013063530A2 (en) 2011-10-28 2013-05-02 Presage Biosciences, Inc. Methods for drug delivery
WO2013086354A1 (en) 2011-12-07 2013-06-13 Alnylam Pharmaceuticals, Inc. Biodegradable lipids for the delivery of active agents
WO2013086373A1 (en) 2011-12-07 2013-06-13 Alnylam Pharmaceuticals, Inc. Lipids for the delivery of active agents
US20140039032A1 (en) 2011-12-12 2014-02-06 Kyowa Hakko Kirin Co., Ltd. Lipid nano particles comprising cationic lipid for drug delivery system
WO2013090601A2 (en) 2011-12-16 2013-06-20 Massachusetts Institute Of Technology Compact nanoparticles for biological applications
WO2013105101A1 (en) 2012-01-13 2013-07-18 Department Of Biotechnology Solid lipid nanoparticles entrapping hydrophilic/ amphiphilic drug and a process for preparing the same
WO2013110028A1 (en) 2012-01-19 2013-07-25 The Johns Hopkins University Nanoparticle formulations with enhanced mucosal penetration
WO2013116126A1 (en) 2012-02-01 2013-08-08 Merck Sharp & Dohme Corp. Novel low molecular weight, biodegradable cationic lipids for oligonucleotide delivery
WO2013126803A1 (en) 2012-02-24 2013-08-29 Protiva Biotherapeutics Inc. Trialkyl cationic lipids and methods of use thereof
US10561732B2 (en) 2012-02-24 2020-02-18 Arbutus Biopharma Corporation Trialkyl cationic lipids and methods of use thereof
US20130243848A1 (en) 2012-03-14 2013-09-19 The Board Of Trustees Of The Leland Stanford Junior University Nanoparticles, nanoparticle delivery methods, and systems of delivery
US20160138008A1 (en) 2012-05-25 2016-05-19 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
WO2014008334A1 (en) 2012-07-06 2014-01-09 Alnylam Pharmaceuticals, Inc. Stable non-aggregating nucleic acid lipid particle formulations
WO2014028487A1 (en) 2012-08-13 2014-02-20 Massachusetts Institute Of Technology Amine-containing lipidoids and uses thereof
US20150344912A1 (en) 2012-10-23 2015-12-03 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
US8945839B2 (en) 2012-12-12 2015-02-03 The Broad Institute Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8871445B2 (en) 2012-12-12 2014-10-28 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8932814B2 (en) 2012-12-12 2015-01-13 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8895308B1 (en) 2012-12-12 2014-11-25 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8993233B2 (en) 2012-12-12 2015-03-31 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US8999641B2 (en) 2012-12-12 2015-04-07 The Broad Institute Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
US8889356B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
US8889418B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8771945B1 (en) 2012-12-12 2014-07-08 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8906616B2 (en) 2012-12-12 2014-12-09 The Broad Institute Inc. Engineering of systems, methods and optimized guide compositions for sequence manipulation
US9938236B2 (en) 2012-12-27 2018-04-10 Drexel University Antiviral agents against HBV infection
US20160038612A1 (en) 2013-03-14 2016-02-11 Moderna Therapeutics, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
US20170027658A1 (en) 2014-04-09 2017-02-02 Arbutus Medical Inc. Drill cover and chuck mechanism
WO2015162422A1 (en) * 2014-04-22 2015-10-29 Mina Therapeutics Limited Sarna compositions and methods of use
US10723692B2 (en) 2014-06-25 2020-07-28 Acuitas Therapeutics, Inc. Lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20180303925A1 (en) 2015-04-27 2018-10-25 The Trustees Of The University Of Pennsylvania Nucleoside-Modified RNA For Inducing an Adaptive Immune Response
US20160208243A1 (en) 2015-06-18 2016-07-21 The Broad Institute, Inc. Novel crispr enzymes and systems
US20190359556A1 (en) 2015-06-29 2019-11-28 Acuitas Therapeutics, Inc. Lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20190314524A1 (en) 2015-10-28 2019-10-17 Acuitas Therapeutics, Inc. Novel lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20190022247A1 (en) 2015-12-30 2019-01-24 Acuitas Therapeutics, Inc. Lipids and lipid nanoparticle formulations for delivery of nucleic acids
US20190240354A1 (en) 2016-06-30 2019-08-08 Arbutus Biopharma Corporation Compositions and methods for delivering messenger rna
WO2018031762A1 (en) * 2016-08-10 2018-02-15 Duke University Compositions, systems and methods for programming immune cell function through targeted gene regulation
WO2018049073A1 (en) 2016-09-07 2018-03-15 Flagship Pioneering, Inc. Methods and compositions for modulating gene expression
WO2018081480A1 (en) 2016-10-26 2018-05-03 Acuitas Therapeutics, Inc. Lipid nanoparticle formulations
US20200163878A1 (en) 2016-10-26 2020-05-28 Curevac Ag Lipid nanoparticle mrna vaccines
US20190274968A1 (en) 2016-10-27 2019-09-12 The Trustees Of The University Of Pennsylvania Nucleoside-modified rna for inducing an adaptive immune response
WO2018107026A1 (en) 2016-12-09 2018-06-14 Sangamo Therapeutics, Inc. Delivery of target specific nucleases
US20180185516A1 (en) 2016-12-09 2018-07-05 Sangamo Therapeutics, Inc. Delivery of target specific nucleases
US20200046838A1 (en) 2017-04-13 2020-02-13 Acuitas Therapeutics, Inc. Lipids for delivery of active agents
WO2018191719A1 (en) 2017-04-13 2018-10-18 Acuitas Therapeutics, Inc. Lipid delivery of therapeutic agents to adipose tissue
WO2018200943A1 (en) 2017-04-28 2018-11-01 Acuitas Therapeutics, Inc. Novel carbonyl lipids and lipid nanoparticle formulations for delivery of nucleic acids
WO2019036008A1 (en) 2017-08-16 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICULAR FORMULATIONS
WO2019036028A1 (en) 2017-08-17 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICULAR FORMULATIONS
US20200172472A1 (en) 2017-08-17 2020-06-04 Acuitas Therapeutics, Inc. Lipids for use in lipid nanoparticle formulations
WO2019036030A1 (en) 2017-08-17 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICLE FORMULATIONS
WO2019089828A1 (en) 2017-10-31 2019-05-09 Acuitas Therapeutics, Inc. Lamellar lipid nanoparticles
WO2020081938A1 (en) 2018-10-18 2020-04-23 Acuitas Therapeutics, Inc. Lipids for lipid nanoparticle delivery of active agents
WO2020097520A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Cationic lipids containing silicon
WO2020097493A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Negatively charged peg-lipid conjugates
WO2020097548A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Lipid nanoparticle formulations
WO2020097540A1 (en) 2018-11-09 2020-05-14 Arbutus Biopharma Corporation Lipid nanoparticle formulations
WO2020146805A1 (en) 2019-01-11 2020-07-16 Acuitas Therapeutics, Inc. Lipids for lipid nanoparticle delivery of active agents

Non-Patent Citations (114)

* Cited by examiner, † Cited by third party
Title
"Genbank", Database accession no. NP _001120680.1
"GenBank", Database accession no. NP _001138610.1
8TH INTERNATIONAL JUDAH FOLKMAN CONFERENCE, 8 October 2010 (2010-10-08)
AIGNER, A., J. BIOMED. BIOTECHNOL., 2006, pages 71659
AKHTAR S.JULIAN RL., TRENDS CELL. BIOL., vol. 2, no. 5, 1992, pages 139 - 144
AKINC ET AL., MOL THER., vol. 17, 2009, pages 872 - 879
AKINC ET AL., NAT BIOTECHNOL., vol. 26, 2008, pages 561 - 569
ALEKU ET AL., CANCER RES., vol. 68, 2008, pages 9788 - 9798
ALVAREZ ET AL., HUM. GENE THER., vol. 5, 1997, pages 597 - 613
ARNOLD, AS ET AL., J. HYPERTENS., vol. 25, 2007, pages 197 - 205
BAE KH ET AL., NATURE BIOTECHNOLOGY, vol. 21, no. 3, 2003, pages 275 - 80
BARTEL, CELL, vol. 116, 2004, pages 281 - 297
BENOIT ET AL., BIOMACROMOLECULES, vol. 12, 2011, pages 2708 - 2714
BIRMINGHAM ET AL., NAT METHODS, vol. 3, 2006, pages 199 - 204
BOCH J, NATURE BIOTECHNOLOGY, vol. 29, no. 2, 2011, pages 135 - 6
BONNET ME. ET AL., PHARM. RES., 16 August 2008 (2008-08-16)
CHATURVEDI ET AL., EXPERT OPIN DRUG DELIV., vol. 8, 2011, pages 1455 - 1468
CHIEN, PY. ET AL., CANCER GENE THER., vol. 12, 2005, pages 321 - 328
CHO ET AL., ADV. FUNCT. MATER., vol. 19, 2009, pages 3112 - 3118
CHU ET AL., ACC CHERN RES., 13 January 2012 (2012-01-13)
CONG ET AL., SCIENCE, vol. 339, 2013, pages 819 - 823
CONVERTINE ET AL., BIOMACROMOLECULES, 1 October 2010 (2010-10-01)
COUTURE, A ET AL., TIG, vol. 12, 1996, pages 5 - 10
DAVIS, MOL PHARM., vol. 6, 2009, pages 659 - 668
DAVIS, NATURE, vol. 201, no. 0464, pages 1067 - 1070
DEFOUGEROLLES, HUM GENE THER., vol. 19, 2008, pages 125 - 132
DOENCH ET AL., GENES DEV, vol. 17, 2003, pages 438 - 442
DREIER B ET AL., JBC, vol. 276, no. 31, 2001, pages 29466 - 78
DREIER B ET AL., JBC, vol. 280, no. 42, 2005, pages 35588 - 97
FENSKECULLIS, EXPERT OPIN DRUG DELIV., vol. 20085, 2008, pages 309 - 319
FORSTNERIC VIDA ET AL: "CRISPRa-mediated FOXP3 gene upregulation in mammalian cells", CELL & BIOSCIENCE, vol. 9, no. 1, 21 November 2019 (2019-11-21), XP055804187, Retrieved from the Internet <URL:https://cellandbioscience.biomedcentral.com/track/pdf/10.1186/s13578-019-0357-0.pdf> DOI: 10.1186/s13578-019-0357-0 *
FOTIN-MLECZEK ET AL., J. IMMUNOTHER., vol. 34, 2011, pages 1 - 15
GAJ ET AL., TRENDS BIOTECHNOL., vol. 31.7, 2013, pages 397 - 405
GASSMANN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 1292
GEORGIEV PETER ET AL: "Regulatory T Cells: the Many Faces of Foxp3", JOURNAL OF CLINICAL IMMUNOLOGY, KLUWER ACADEMIC PUBLISHERS, NEW YORK, vol. 39, no. 7, 2 September 2019 (2019-09-02), pages 623 - 640, XP036887261, ISSN: 0271-9142, [retrieved on 20190902], DOI: 10.1007/S10875-019-00684-7 *
GERSBACH ET AL., SYNTHETIC ZINC FINGER PROTEINS: THE ADVENT OF TARGETED GENE REGULATION AND GENOME MODIFICATION TECHNOLOGIES
GUAN ET AL.: "Application of CRISPR-Cas system in gene therapy: Pre-clinical progress in animal model", DNA REPAIR, 30 July 2016 (2016-07-30)
GUTBIER ET AL., PULM PHARMACOL. THER., vol. 23, 2010, pages 334 - 344
GUTBIER ET AL., PULMPHARMACOL. THER., vol. 201023, pages 334 - 344
HENDEL ET AL., NATURE BIOTECHNOL., 2015, pages 985 - 991
HEYES ET AL., J CONTR REL., vol. 107, 2005, pages 276 - 287
HEYES ET AL., MOL THER., vol. 15, 2007, pages 713 - 720
JEFFRIES MATLOCK A ED - HEDRICH CHRISTIAN: "Epigenetic editing: How cutting-edge targeted epigenetic modification might provide novel avenues for autoimmune disease therapy", CLINICAL IMMUNOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 196, 6 February 2018 (2018-02-06), pages 49 - 58, XP085557478, ISSN: 1521-6616, DOI: 10.1016/J.CLIM.2018.02.001 *
JEFFS ET AL., PHARM RES., vol. 22, 2005, pages 362 - 372
JIA HAO ET AL: "The expression of FOXP3 and its role in human cancers", BBA - REVIEWS ON CANCER, vol. 1871, no. 1, 7 January 2019 (2019-01-07), pages 170 - 178, XP085582038, ISSN: 0304-419X, DOI: 10.1016/J.BBCAN.2018.12.004 *
JUDGE ET AL., J CLIN INVEST., vol. 119, 2009, pages 661 - 673
JUDGE ET AL., J CLINLNVEST., vol. 119, 2009, pages 661 - 673
KARL MARTIN ET AL: "Recruitment of Histone Methyltransferase Ehmt1 to Foxp3 TSDR Counteracts Differentiation of Induced Regulatory T Cells", JOURNAL OF MOLECULAR BIOLOGY, ACADEMIC PRESS, UNITED KINGDOM, vol. 431, no. 19, 27 July 2019 (2019-07-27), pages 3606 - 3625, XP085804069, ISSN: 0022-2836, [retrieved on 20190727], DOI: 10.1016/J.JMB.2019.07.031 *
KAUFMANN ET AL., MICROVASC RES, vol. 80, 2010, pages 286 - 293
KEARNS ET AL., GENE THER., vol. 9, 1996, pages 748 - 55
KIM ET AL., METHODS MOL BIOL., vol. 721, 2011, pages 339 - 353
KIM SH. ET AL., JOURNAL OF CONTROLLED RELEASE, vol. 129, no. 2, 2008, pages 107 - 116
KOLHATKAR ET AL., CURR DRUG DISCOV TECHNOL., vol. 8, 2011, pages 197 - 206
LAI ET AL., ADV DRUG DELIV REV., vol. 200961, no. 2, pages 158 - 171
LAI ET AL., PNAS, vol. 104, no. 5, 2007, pages 1482 - 487
LEUSCHNER ET AL., NAT BIOTECHNOL, vol. 29, 2011, pages 1005 - 101 0
LEUSCHNER ET AL., NAT BIOTECHNOL., vol. 200826, 2011, pages 1005 - 101 0
LIM ET AL., NATURE, vol. 433, 2005, pages 769 - 773
LIU, S., MOL. PHARM., vol. 3, 2006, pages 472 - 487
LOVE ET AL., PROC NATL ACAD SCI USA., vol. 107, 2010, pages 1864 - 1869
MAHON ET AL., BIOCONJUG CHEM., vol. 21, 2010, pages 1448 - 1454
MANGANIELLO ET AL., BIOMATERIALS, vol. 33, 2012, pages 2301 - 2309
MARUYAMA TAKASHI ET AL: "The molecular mechanisms of Foxp3 gene regulation", SEMINARS IN IMMUNOLOGY, vol. 23, no. 6, 12 July 2011 (2011-07-12), US, pages 418 - 423, XP055806168, ISSN: 1044-5323, Retrieved from the Internet <URL:https://www.sciencedirect.com/science/article/pii/S1044532311000546/pdfft?md5=283b046999754aba7730568d27985bd7&pid=1-s2.0-S1044532311000546-main.pdf> DOI: 10.1016/j.smim.2011.06.005 *
MASAHIRO OKADA ET AL: "Stabilization of Foxp3 expression by CRISPR-dCas9-based epigenome editing in mouse primary T cells", EPIGENETICS & CHROMATIN, BIOMED CENTRAL LTD, LONDON, UK, vol. 10, 8 May 2017 (2017-05-08), pages 1 - 17, XP002773366, ISSN: 1756-8935, DOI: 10.1186/S13072-017-0129-1 *
MORRISSEY ET AL., NAT BIOTECHNOL., vol. 23, 2005, pages 1002 - 1007
MOSCOU MJBOGDANOVE AJ, SCIENCE, vol. 326, no. 5959, 2009, pages 1501 - 12
MURUGAIAH ET AL., ANALYTICAL BIOCHEMISTRY, vol. 401, 2010, pages 61
MUSACCHIOTORCHILIN, FRONT BIOSCI., vol. 201116, pages 1388 - 1412
PAL, A. ET AL., INT J. ONCOL., vol. 26, 2005, pages 1087 - 1091
PASCOLO, EXPERT OPIN. BIOL. THER., vol. 4, pages 1285 - 1294
PATIL ET AL., CRIT REV THER DRUG CARRIER SYST., vol. 25, 2008, pages 1 - 61
PEER ET AL., PROC NATLACAD SCI USA, vol. 104, June 2007 (2007-06-01), pages 4095 - 4100
PEER ET AL., SCIENCE, vol. 319, 2008, pages 627 - 630
PEER, JCONTROL RELEASE, vol. 20, 2010, pages 63 - 68
PEERLIEBERMAN, GENE THER., vol. 18, 2011, pages 1127 - 1133
RAJEWSKY, NAT GENET, vol. 38, 2006, pages 8 - 13
RAN ET AL., CELL, vol. 154, 2013, pages 1380 - 1389
RAN ET AL., NATURE PROTOCOLS, vol. 8, 2013, pages 2281 - 2308
ROSENECKER ET AL., INFECTION, vol. 24, no. 1, 1996, pages 5 - 10
ROZEMA ET AL., PROC NATL ACAD SCI USA, vol. 104, 2007, pages 12982 - 12887
SANTEL ET AL., GENE THER, vol. 13, 2006, pages 1360 - 1370
SANTEL ET AL., GENE THER, vol. 200613, pages 1222 - 1234
SCHAFFERTWAGNER, GENE THER., vol. 16, 2008, pages 1131 - 1138
SCHROEDER ET AL., J INTERN MED., vol. 267, 2010, pages 9 - 21
SEMPLE ET AL., NATURE BIOTECH., vol. 28, 2010, pages 172 - 176
SHUKLA VK ET AL., NATURE, vol. 459, no. 7245, 2009, pages 437 - 41
SIEGWART ET AL., PROC NATL ACAD SCI USA., vol. 2011108, 2007, pages 12996 - 4100
SINGHA ET AL., NUCLEIC ACID THER., vol. 2, 2011, pages 133 - 147
SONG ET AL., NATURE BIOTECHNOL., vol. 23, 2005, pages 709 - 717
SORENSEN, DR. ET AL., J. MOL. BIOL, vol. 327, 2003, pages 761 - 766
SRINIVASAN ET AL., METHODS MOL BIOL., vol. 757, 2012, pages 497 - 507
STERMAN ET AL., HUM. GENE THER., vol. 7, no. 7, 1998, pages 1083 - 1089
STRUMBERG ET AL., INT J CLIN PHARMACOL THER, vol. 50, 2012, pages 76 - 78
SUBRAMANYA ET AL., MOL THER., vol. 18, 2010, pages 2028 - 2037
SULLIVAN ET AL., EXPERT OPIN DRUG DELIV., vol. 7, 2010, pages 1433 - 1446
TOMALIA, DA. ET AL., BIOCHEM. SOC. TRANS., vol. 35, 2007, pages 61 - 67
TOPF ET AL., GENE THER., vol. 5, 1998, pages 507 - 513
UI-TEI ET AL., FEBS LETTERS, vol. 479, 2000, pages 79 - 82
VERMA, UN. ET AL., CLIN. CANCER RES., vol. 9, 2003, pages 1291 - 1300
WAGNER ET AL., LANCET, vol. 351, 1998, pages 9117 1702 - 3
WEIDE ET AL., J IMMNNOTHER., vol. 31, 2008, pages 180 - 188
WEIDE ET AL., J IMMUNOTHER., vol. 32, 2009, pages 498 - 507
WELSH ET AL., HUM. GENE THER., vol. 2, 1995, pages 205 - 18
WHEELER ET AL., GENE THERAPY, vol. 6, 1999, pages 271 - 281
WHITEHEAD ET AL., MOL. THER., vol. 19, 2011, pages 2186 - 2200
WU ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 4034 - 4039
YOO, H. ET AL., PHARM. RES., vol. 16, 1999, pages 1799 - 1804
YU ET AL., MOL MEMBR BIOL., vol. 27, 2010, pages 286 - 298
ZENG ET AL., MOL CELL, vol. 9, 2002, pages 1327 - 1333
ZETSCHE ET AL., CELL, vol. 163, 2015, pages 759 - 771
ZHANG ET AL., ACS NANO, vol. 2, no. 8, 2008, pages 1696 - 1702
ZHANG ET AL., GENE THERAPY, vol. 19996, pages 1438 - 1447
ZHENG ET AL.: "Precise gene deletion and replacement using the CRISPR/Cas9 system in human cells", BIOTECHNIQUES, vol. 57, no. 3, September 2014 (2014-09-01), pages 115 - 124
ZIMMERMANN, TS. ET AL., NATURE, vol. 441, 2006, pages 111 - 114

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023081787A3 (en) * 2021-11-04 2023-09-28 Prime Medicine, Inc. Genome editing compositions and methods for treatment of fanconi anemia
WO2024197058A3 (en) * 2023-03-21 2024-10-31 Lung Biotechnology Pbc Methods for creating regulatory t cells (tregs) using genome engineering

Also Published As

Publication number Publication date
EP4118207A1 (en) 2023-01-18
JP2023517326A (ja) 2023-04-25
AU2021234302A1 (en) 2022-11-10
CN116096886A (zh) 2023-05-09
CA3173528A1 (en) 2021-09-16
WO2021183720A8 (en) 2021-10-21
US20230114151A1 (en) 2023-04-13

Similar Documents

Publication Publication Date Title
US11834649B2 (en) CRISPR/CAS-related methods and compositions for treating herpes simplex virus
US20250320491A1 (en) Crispr-cpf1-related methods, compositions and components for cancer immunotherapy
US20200299661A1 (en) Cpf1-related methods and compositions for gene editing
US20230114151A1 (en) Compositions and methods for modulating forkhead box p3 (foxp3) gene expression
US20240344061A1 (en) COMPOSITIONS AND METHODS FOR MODULATING HEPATOCYTE NUCLEAR FACTOR 4-ALPHA (HNF4alpha) GENE EXPRESSION
US20180119123A1 (en) Crispr/cas-related methods and compositions for treating hiv infection and aids
US20240254462A1 (en) Compositions and methods for modulating secreted frizzled receptor protein 1 (sfrp1) gene expression
WO2016198500A1 (en) Methods and compositions for rna-guided treatment of human cytomegalovirus (hcmv) infection
WO2022012531A1 (zh) 一种经修饰的免疫细胞的制备方法
JP2019517465A (ja) 溶菌および溶原ウイルスの処理の組成物および方法
US20220288237A1 (en) Compositions and methods for modulating apolipoprotein b (apob) gene expression
EP4716741A2 (en) Compositions and methods for reducing cxcl9, cxcl10, and cxcl11 gene expression
WO2026006558A2 (en) Compositions and methods for increasing cxcl9 and cxcl10 gene expression
Tucker Inborn Errors of Metabolism II

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21715725

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3173528

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022554320

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021715725

Country of ref document: EP

Effective date: 20221011

ENP Entry into the national phase

Ref document number: 2021234302

Country of ref document: AU

Date of ref document: 20210311

Kind code of ref document: A