WO2021178432A1 - Rna-guided genome recombineering at kilobase scale - Google Patents

Rna-guided genome recombineering at kilobase scale Download PDF

Info

Publication number
WO2021178432A1
WO2021178432A1 PCT/US2021/020513 US2021020513W WO2021178432A1 WO 2021178432 A1 WO2021178432 A1 WO 2021178432A1 US 2021020513 W US2021020513 W US 2021020513W WO 2021178432 A1 WO2021178432 A1 WO 2021178432A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
sequence
aptamer
nucleic acid
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/020513
Other languages
English (en)
French (fr)
Other versions
WO2021178432A9 (en
Inventor
Le Cong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Leland Stanford Junior University
Original Assignee
Leland Stanford Junior University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Leland Stanford Junior University filed Critical Leland Stanford Junior University
Priority to EP21764351.9A priority Critical patent/EP4114845A4/en
Priority to CA3173526A priority patent/CA3173526A1/en
Priority to IL296057A priority patent/IL296057A/en
Priority to AU2021231769A priority patent/AU2021231769A1/en
Priority to MX2022010835A priority patent/MX2022010835A/es
Priority to JP2022552549A priority patent/JP2023515670A/ja
Priority to KR1020227033540A priority patent/KR20220151175A/ko
Priority to BR112022017196A priority patent/BR112022017196A2/pt
Priority to US17/905,457 priority patent/US20230091242A1/en
Priority to CN202180033011.8A priority patent/CN115667283A/zh
Publication of WO2021178432A1 publication Critical patent/WO2021178432A1/en
Publication of WO2021178432A9 publication Critical patent/WO2021178432A9/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/245Escherichia (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/305Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
    • C07K14/31Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/115Aptamers, i.e. nucleic acids binding a target molecule specifically and with high affinity without hybridising therewith ; Nucleic acids binding to non-nucleic acids, e.g. aptamers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • C12N15/625DNA sequences coding for fusion proteins containing a sequence coding for a signal sequence
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/09Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/16Aptamers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/35Nature of the modification
    • C12N2310/351Conjugate
    • C12N2310/3519Fusion with another nucleic acid
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/80Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites

Definitions

  • the present invention relates to RNA-guided recombmeering- editing systems using phage recombination enzymes as well as methods, vectors, nucleic acid compositions, and kits thereof.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • systems comprising a protein, a nucleic acid molecule comprising a guide RNA sequence that is complementary to a target DN A sequence, and a microbial recombination protein.
  • the microbial recombination protein may be, for example, ReeE, RecT, lambda exonuclease (Exo), Bet protein (betA, redB), exonuclease gp6, single-stranded DNA-bmding protein gp2.5, or a derivative or variant thereof.
  • the system further comprises donor DNA.
  • the target DNA sequence is a genomic DNA sequence in a host cell.
  • the system further comprises a recruitment system comprising at least one aptamer sequence and an aptamer binding protein functionally linked to the microbial recombination protein as part of a fusion protein.
  • the aptamer sequence is an RNA aptamer sequence or a peptide aptamer sequence.
  • the RN A aptamer sequence is part of the nucleic acid molecule in some embodiments, the nucleic acid molecule comprises two RNA aptamer sequences.
  • the microbial recombination protein is functionally linked to the aptamer binding protein as a fusion protein.
  • the binding protein comprises a MS2. coat protein, a lambda N22 peptide, or a functional derivative, fragment, or variant thereof.
  • the fusion protein further comprises a linker and/or a nuclear localization sequence.
  • compositions comprising a nucleic acid sequence encoding a fusion protein comprising a microbial recombination protein functionally linked to an aptamer binding protein.
  • the microbial recombination protein may be RecE, RecT, lambda exonuclease (Exo), Bet protein (betA, redB), exonuclease gp6, single-stranded DNA-bmdmg protein gp2.5, or a derivative or variant thereof.
  • compositions may further comprise one or both of a polynucleotide comprising a nucleic acid sequence encoding a Gas protein and a nucleic acid molecule comprising a guide RNA sequence that is complementary to a target DNA sequence.
  • the nucleic acid molecule further comprises at least one RNA aptamer sequence.
  • the polynucleotide comprising a nucleic acid sequence encoding a Cas protein further comprises a sequence encoding at least one peptide aptamer sequence.
  • vectors comprising a nucleic acid sequence encoding a fusion protein comprising a microbial recombination protein functionally linked to an aptamer binding protein.
  • the microbial recombination protein may be RecE, RecT, lambda exonuclease (Exo), Bet protein (betA, redB), exonuclease gp6, single-stranded DNA-bmdmg protein gp2.5 or a derivative or variant thereof.
  • the vectors may further comprise one or both of a polynucleotide comprising a nucleic acid sequence encoding a Cas protein and a nucleic acid molecule comprising a guide RNA sequence that is complementary to a target DNA sequence.
  • the nucleic acid molecule further comprises at least one RN A aptamer sequence in some embodiments, the polynucleotide comprising a nucleic acid sequence encoding a Cas protein further comprises a sequence encoding at least one peptide aptamer sequence.
  • the RecE and RecT recombination protein is derived from E. co!i.
  • the RecE, or derivative or variant thereof comprises an ammo acid sequence with at least 70% similarity to amino acid sequences selected from the group consisting of SEQ ID NOs: 1-8.
  • the RecT, or derivative or variant thereof comprises an ammo acid sequence with at least 70% similarity to amino acid sequences selected from the group consisting of SEQ ID NO: 9.
  • the Cas protein is Cas9 or Cast 2a. In some embodiments, the Cas protein is a cataiyticai!y dead. In some embodiments, the Cas9 protein is wild-type Streptococcus pyogenes Cas9 or a wild-type Staphylococcus aureus Cas9. In some embodiments, the Cas9 protein is a Cas9 nickase (e.g., wild-type Streptococcus pyogenes Cas9 with an ammo acid substation at position 10 ofDlOA).
  • Cas9 nickase e.g., wild-type Streptococcus pyogenes Cas9 with an ammo acid substation at position 10 ofDlOA.
  • a eukaryotic cell comprising the systems or vectors disclosed herein.
  • the methods comprise contacting the systems, compositions, or vectors described herein with a target DNA sequence (e.g., introducing the systems, compositions, or vectors described herein into a host cell comprising a target genomic DNA sequence).
  • Kits containing one or more reagents or other components useful, necessary', or sufficient for practicing any of the methods are also disclosed herein.
  • FIG. 1A and FIG. IB are the reconstructed RecE (FIG. 1A) and RecT (FIG. IB) phylogenetic trees with eukaryotic recombination enzymes from yeast and human.
  • FIG. 2A is a phylogenetic tree and length distribution of RecE/RecT homologs.
  • FIG. 2B is the metagenomics distribution of RecE/T
  • FIG. 2C is a schematic showing central models disclosed herein.
  • FIG. 2D are graphs of the genome knock-in efficiency of RecE/T homologs.
  • FIG. 3 A and 3 B are graphs of the high-throughput sequencing (HT8) reads of homology directed repair (HDR) &t the EMXJ (FIG. 3 A) locus and the VEGFA (FIG. 3B) locus.
  • FIGS. 3C-3D are graphs of the mKate knock-in efficiency at HSP90AA1 (FIG. 3C), DYNLT1 (FIG. 3D), and AAVS1 (FIG. 3E) loci in HEK293T cells.
  • FIG. 3F is images of mKate knock-in efficiency in HEK293T cells with RecT.
  • FIG. 3G is a schematic of an exemplary AA VS1 knock-in strategy and chromatogram trace from RecT knock-in group.
  • FIG. 3H is schematics and graphs of the recruitment control experiment and corresponding knock-in efficiency. All results are normalized to NR. (NC, no cutting; NR, no recombinator).
  • FIGS. 4A-4C are graphs of the relative mKate knock-in efficiencies to the NE group at HSP90AA1 (FIG. 4A), DYNLT1 (FIG. 4B), dAAVSl (FIG. 4C) loci in HEK293T cells.
  • NC no cutting control group.
  • NR no recombinator control group.
  • FIG. 4D is an image of an exemplar ⁇ ' agarose gel of j unction PCR that validates mKate knock-in atAAVSJ locus.
  • FIG. 4E and 4F are graphs of the absolute and (FIG. 4E) and relative (FIG. 4F) LOV knock-in efficiencies atAAVSl locus.
  • FIGS. 5A-5D are graphs of the genomic knock-in efficiencies at different loci across ceil lines A549 (FIG. 5A), HepG2 (FIG. 5B), HeLa (FIG. 5C), and hESCs (H9) (FIG 5D).
  • FIG. 5E is images of mKate knock-ins in hESCs.
  • FIG. 5F and 5G are genomic-wide off-target site (OTS) counts (FIG. 5F) and OTS chromosomal distribution (FIG. 5G) of REDITvl tools.
  • OTS off-target site
  • FIGS. 6A-6D are graphs of the relative mKate knock-in efficiency at the .1 iCS7 locus and the DYNT1 locus in A549 cell line (FIG. 6A), the DYNLTl locus and the HSP90AA1 locus in HepG2 cell line (FIG. 6B), the DYNLTl locus and the HSP90AAI locus in i Ida cell line (FIG 6C), and the HSP90A4I locus and the OCT 4 locus in hES-H9 cell line (FIG 6D).
  • NC no cutting control group NR, no recombinator control group. All data normalized to NR group.
  • FIG 6E is representative FACS results of HSP90AA1 mKate knock-in in hES-H9 cells.
  • FIGS. 7A-7D are graphs of the absolute mKate knock-in efficiencies of different homology arm lengths at the DYNLTl (FIG. 7 A) and HSP90AA1 (FIG 7B) loci and the no recombinator controls for DYNLTl (FIG. 7C) andHSP90AAl (FIG. 7D).
  • FIGS. 8A-8E are graphs of the indel rates of the top 3 predicted off-target loci associated with sgEMXl (FIGS. 8A-8C) or sgVEGFA (FIGS. 8D-8E) in the REDITvl system.
  • FIG. 9A is a schematic of select embodiments of REDITvZN and corresponding knock-in efficiencies in HEK293T cells.
  • FIG. 9B and 9C are graphs of genomic-wide off-target site (OTS) counts (FIG. 9B) and OTS chromosomal distribution (FIG. 9C) comparing REDITv2N against REDITvl.
  • FIG. 9D is a schematic of select embodiments of REDITv2D and corresponding knock-in efficiencies.
  • FIG. 9E is a graph of editing efficiency of REDITvl, REDITv2N, and REDITv2D under serum starvation conditions.
  • FIG. 9F is the knock-in efficiencies ofREDITv3 in hESCs.
  • FIG. 9A is a schematic of select embodiments of REDITvZN and corresponding knock-in efficiencies in HEK293T cells.
  • FIG. 9B and 9C are graphs of genomic-wide off-target site (OTS) counts (FIG. 9
  • FIG. 10A and 10B are schematics and graphs of the relative mKate knock-in efficiencies of select embodiments of REDITv2N (FIG. 10 A) and REDITv2D (FIG. 10B) at the DYNLTl locus and the HSP90AA1 locus.
  • FIGS. 11 A-l ID are images of agarose gels showing junction PCR of mKate knock-in at the DYNLT1 locus and the HSP90AA1 locus for a select REDITV2N system.
  • FIG. 12A and 12B are graphs of the genomic distribution of detected off-target cleavages of select embodiments of REDITv2 (FIG. 12A) and REDITV2N (FIG. 12B).
  • a pileup includes alignments that have two or more reads overlapping with each other. Flanking pairs include alignments that show up on opposite strands within 200bp upstream of each other.
  • Target matched includes alignments that match to a treated target in the upstream sequence (up to 6 mismatches, including 1 mismatch m the PAM, are allowed in the target sequence).
  • FIG. 12C is a graph of the FITS HDR and indel reads at EA4X1 locus for REDITv2N system.
  • FIG. 13 A is an image of an agarose gel showing junction PCR of mKate knock-ins at the
  • FIGS. 14A-14C are graphs of the mKate knock-in efficiencies at the HSP90AA1 locus in REDITv-2 (FIG. 14A), REDITv2N (FIG. 14B) and REVTTv2D (FIG. 14C) when treated with different FBS concentrations.
  • FIGS. 14D-14F are graphs of the mKate knock-in efficiencies at the HSP90AA1 locus in REDITv2 (FIG 14D), REDITv2N (FIG. 14E) and REYITv2D (FIG. 14F) when treated with different serum FBS concentrations.
  • FIG. 15 is images of the nuclear localization of RecE_587 and RecT following EGFP fusion to the REDITv! systems. Nuclei were stained with NucBlue Live Ready Probes Reagent.
  • FIG. 16A and 16B are the relative mKate knock-in efficiencies at HSP90AA /and DYNIJT1 loci following fusion of different nuclear localization sequences to either the N- or C-terminus of RecT and RecE_587.
  • FIG. 16C and 16D are graphs of the absolute mKate knock-in efficiencies of the constructs from locus (FIG. 16C) and the HSP90AA1 locus (FIG. 16D).
  • FIGS. 17A-17D are graphs of the relative (FIGS. 17 A and 17B) and absolute (FIGS. 17C and 17D) mKate knock-in efficiencies for the DYNLT1 locus (FIGS. 17A and 17C) and the HSP90AA1 locus (FIGS. 17B and 17D) following fusion newNLS sequences as well as optimal linkers to REDITv2 and REDITvS variants.
  • the REDITv2 versions using REDITv2N (D10A or H840A) and REDITV2D (dCas9) are indicated in the horizonal axis, along with the number of guides used. The different colors represent the different control groups and REDIT versions.
  • FIG. 18 is a graph of the relative editing efficiency of REDITv3N system at HSP90AA1 locus in hES-H9 cells.
  • FIG. 19A is a diagram of an exemplary saCas9 expression vector.
  • FIGS. 19B-19D are graphs of the relative mKate knock-in efficiencies at the AAVSI locus (FIG. 19C) and HSP90AA1 locus (FIG. 19D) of different effectors in saCas9 system and the respective absolute efficiencies (FIG. 19A and 19B, respectively).
  • NC no cutting control group.
  • NR no recombinator control group.
  • FIG. 20A is a schematic of RecT truncations.
  • FIGS. 20B and 20C are graphs of the relative mKate knock-in efficiencies at the DYNLT1 locus for wild-type Streptococcus pyogenes Cas9 and Streptococcus pyogenes Cas9n(DlGA) with single- and double-nicking.
  • FIG. 21A is a schematic of RecE 587 truncations.
  • FIGS. 21B and 21C are graphs of the relative mKate knock-in efficiencies at the DYNLTi locus for wild-type Streptococcus pyogenes Cas9 and Streptococcus pyogenes Cas9n(D10A) with single- and double-nicking.
  • FIGS. 22 A and 22B are graphs of comparison of efficiency to perform recombineering-based editing with various exonucleases (FIG. 22A) and single-strand DNA annealing protein (SSAP) (FIG. 22B) from naturally occurring recombineering systems, including NR (no recombinator) as negative control.
  • FIGS. 23A-23E show a compact recruitment system using boxB and N22.
  • the REDIT recombinator proteins were fused to N22 peptide and within the sgRNA was hoxB, the short cognizant sequence of N22 peptide (FIG. 23A).
  • FIGS. 23B-23E are graphs of the gene-editing efficiency using mKate knock-in assay, with wildtype SpCas9, with side-by-side comparisons to the MS2-MCP recruitment system.
  • FIGS. 23B and 23D are absolute mKate knock-in efficiency at DYNLTI, HSP90AA1 loci and
  • FIGS. 23 C and 23E are relative efficiencies. The data shown are percentage of successful mKate knock-in using HEK293 human cells, each experiments were performed in triplicate (n :::: 3).
  • FIGS. 24A-24C show a SunTag recruitment system.
  • the REDIT recombinator proteins were fused to scFV antibody and the GCN4 peptide in tandem fashion (10 copies of GCN4 peptide separated by linkers) was fused to the Cas9 protein (FIG 24A).
  • An mKate knock-in experiment (FIG. 24B) with the DYNLTI locus was used to measure the gene-editing knock-in efficiency (FIG. 24C). All data are measurements of gene-editing efficiency using mKate knock-in assay, with wildtype SpCas9.
  • FIGS. 25A and 25B exemplify REDIT with a Casl2A system.
  • a Cpfl/Casl2a based REDIT system via the SunTag recruitment design was created (FIG. 25A) for two different Cpfl/Casl2a proteins.
  • the efficiencies at two endogenous loci were measured.
  • FIGS. 27A and 27B is a schematic showing the SunTag-based recruitment of SSAP RecT to Cas9-gRNA complex for gene-editing (FIG. 27 A) and a graph quantifying the editing efficiencies of SunTag compared to MS2-based strategies (FIG. 27B).
  • FIGS. 28A-28C show' comparisons of REDIT with alternative HDR-enhancing gene-editing approaches
  • FIG. 28A is schematics showing alternative HDR-enhancing approaches via fusing functional domains, CtIP or Gemimn (Gem), to Cas9 protein (left) and when combined with REDIT (right).
  • FIG. 28A is schematics showing alternative HDR-enhancing approaches via fusing functional domains, CtIP or Gemimn (Gem), to Cas9 protein (left) and when combined with REDIT (right).
  • FIG. 28B is an alternative small-molecule HDR-enhancing approach through cell cycle control. Nocodazole was used to synchronize cells at the G2/M boundary (left) according to the timeline shown (right).
  • FIG. 28C is comparisons of gene-editing efficiencies using REDIT and alternative HDR-enhancing tools, Cas9-HE (CtIP fusion), Cas9-Gem (Geminin fusion), and Nocodazole (noc), along with combination of REDIT with these methods (Cas9-HE/Cas9-Gem/noct-REDIT).
  • Donor DNAs have 200 + 400 bp ( DYNLTl ) or 200 + 200bp (HSP90AA 1) of HAs. All assays performed with no donor, NTC and Cas9 (no enhancement) controls. #P ⁇ 0.05, compared to REDIT; ##P ⁇ 0.01, compared to REDIT.
  • FIGS. 29A-29D show template design guideline, junction precision, and capacity of REDIT gene-editing methods.
  • FIG. 29A is graphs of a homology arm (HA) length test comparing different template designs of HDR donors (longer HAs) or NHEJ/MMEJ donors (zero/shorter HAs) using REDIT and Cas9 references. Top and bottom are two genomic loci tested using mKate knock-in assay.
  • FIG. 29B is a design of an exemplary junction profiling assay through isolation of knock-in clones, followed by genomic PCR using primers (fwd, rev) binding outside donor to avoid template amplification.
  • FIG. 29C is a graph of the percentage of colonies with indicated junction profiles from the Sanger sequencing of knock-in clones as m FIG. 29B. Editing methods and donor DNA are listed at the bottom (HA lengths indicated m bracket).
  • FIG. 29D is a graph of knock-in efficiencies using a 2-kb cassette to insert dual-GFP/mKate tags to validate REDIT methods with Cas9. HA lengths of donor DNAs indicated at the bottom.
  • FIGS. 30A-30C show GISseq results indicating that REDIT is an efficient method with the ability to insert kilobase-length sequences with less unwanted editing events.
  • FIG. 30A is a schematic showing the design, procedures, and analysis steps for GIS-seq to measure genome-wide insertion sites of the knock-in cassettes. High-molecular-weight (HMW) genomic DNA purification was needed to remove potential contamination from donor DNAs. Donor DNAs had 200 bp HAs each side.
  • FIG. 30B is representative GIS-seq results showing plus ininus reads at on-target locus DYNLT1.
  • FIG. 30C is a summary' of top GIS-seq insertion sites comparing Cas9dn and REDITdn groups, showing the expected on-target insertion site (highlighted) and reduced number of identified off-target insertion sites when using REDITdn. (Left) DYNLTl and (Right) ACTS loci with MLE calculated from the distribution of filtered and trimmed GIS-seq reads.
  • FIGS. 31 A-31F show the dependence of REDIT gene-editing on endogenous DNA repair and applying REDIT methods for human stem cell engineering.
  • FIG. 31 A is a model showing the editing process and major repair pathways involved when using REDIT or Cas9 for gene-editing, the HDR pathway are highlighted for chemical perturbation (inhibition of RADS 1). Donor DNAs with 200 + 200 bp HAs are used for all inhibitor experiments.
  • FIGS. 3 IB and 31C are graphs showing the relative knock- inefficiency of REDIT tools compared with Cas9 reference treated with RAD51 inhibitor B02 and RI-1, or vehicle-treated, for the wtCas9-based REDIT and Cas9 (FIG.
  • FIG. 3 IB are graphs of knock-in efficiencies in hESCs (H9) using REDIT and REDITdn tested across three genomic loci, compared with corresponding Cas9 and Cas9dn references.
  • FIGS. 3 IE and 3 IF are flow cytometry plots of mKate knock-in results in hESCs using REDIT, REDlTdn with Cas9, Cas9dn, and NTC controls. Donor DNAs in the hESC experiments have 200 + 200 bp HAs across all loci tested.
  • FIGS. 32A-32B show chemical perturbations to dCas9 REDIT. Gene editing efficiencies were determined when treated with mammalian DNA repair pathway inhibitors (Mirin, RI-1, and B02) with (FIG. 32A) and without (FIG. 32B) cell cycle inhibitor (Thy, doubly Thymidine) blocking. Statistical analyses are from t-test results with 1% FDR via a two-stage step-up method.
  • FIGS. 33A and 33B are schematics of the DNA components (gene-editing vectors and template DNA) and tail vein injection of mice, respectively.
  • FIGS. 34A-34C are results from the tail vein injection of mice with gene-editing vectors.
  • FIG. 34A is a schematic and gel electrophoresis of PCR analysis of liver hepatocytes from the injected mice.
  • FIG. 34B is the Sanger sequencing results of the PCR amplicon (SEQ ID NO: 162).
  • FIG. 34C is a schematic of next-generation sequencing and a graph of the quantification of knock-in junction errors.
  • FIGS. 35A and 35B are schematics of the DNA components (gene-editing and control vector) and adeno-associated virus (AAV) treatment, respectively.
  • FIG. 35C is fluorescent images of lungs from A AV treated mice and graphs of corresponding quantitation of tumor number.
  • the present disclosure is directed to a system and the components for DNA editing.
  • the disclosed system based on CRISPR targeting and homology directed repair by phage recombination enzymes.
  • the system results in superior recombination efficiency and accuracy at a kilobase scale.
  • the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
  • complementary and complementarity refer to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base-paring or other non-traditional types of pairing.
  • the degree of complementarity between two nucleic acid sequences can be indicated by the percentage of nucleotides in a nucleic acid sequence which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 50%, 60%, 70%, 80%, 90%, and 100% complementary).
  • Two nucleic acid sequences are “perfectly complementary” if all the contiguous nucleotides of a nucleic acid sequence will hydrogen bond with the same number of contiguous nucleotides in a second nucleic acid sequence.
  • Two nucleic acid sequences are “substantially complementary'” if the degree of complementarity between the two nucleic acid sequences is at least 60% (e.g., 65%, 70%, 75%, 80%, 85%, 90%, 95%.
  • nucleic acid sequences hybridize under at least moderate, preferably high, stringency conditions.
  • Exemplary moderate stringency conditions include overnight incubation at 37° C m a solution comprising 20% formamide, 5 SSC (150 rnMNaCl, 15 rnM trisodium citrate), 50 mM sodium phosphate (pH 7.6), SxDenhardt’s solution, 10% dextran sulfate, and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in 1 xSSC at about 37-50° C, or substantially similar conditions, e.g., the moderately stringent conditions described in Sambrook et al., infra.
  • High stringency conditions are conditions that use, for example (1) low ionic strength and high temperature for washing, such as 0.015 M sodium chloride/0.0015 M sodium citrate/0.1 % sodium dodecyl sulfate (SDS) at 50° C, (2) employ a denaturing agent during hybridization, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin (BSA)/0.1% Ficoll/0.1% polyvinylpyrrolidone (PVPySO niM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride and 75 mM sodium citrate at 42° C., or (3) employ 50% formamide, 5xSSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5xDenhardt’s solution, sonicated salmon sperm DNA (50 pg/ml), 0.1% SDS, and 10% dextran sulf
  • a cell has been “genetically modified,” “transformed,” or “transfected” by exogenous DNA, e.g., a recombinant expression vector, when such DNA has been introduced inside the cell.
  • exogenous DNA e.g., a recombinant expression vector
  • the presence of the exogenous DNA results in permanent or transient genetic change.
  • the transforming DNA may or may not be integrated (covalently linked) into the genome of the cell.
  • the transforming DNA may be maintained on an episomal element such as a plasmid.
  • a stably transformed cell is one in which the transforming DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication.
  • a “clone” is a population of ceils derived from a single ceil or common ancestor by mitosis.
  • a “cell line” is a clone of a primary ceil that is capable of stable growth in vitro for many generations.
  • nucleic acid or a “nucleic acid sequence” refers to a polymer or oligomer of pyrimidine and/or purine bases, preferably cytosine, thymine, and uracil, and adenine and guanine, respectively.
  • the present technology contemplates any deoxyribonucleotide, ribonucleotide, or peptide nucleic acid component, and any chemical variants thereof, such as methylated, hydroxymethylated, or glycosylated forms of these bases, and the like.
  • the polymers or oligomers may be heterogenous or homogenous in composition and may be isolated from naturally occurring sources or may be artificially or synthetically produced.
  • nucleic acids may be DN A or RNA, or a mixture thereof, and may exist permanently or transitionally in single-stranded or double-stranded form, including homoduplex, heteroduplex, and hybrid states.
  • a nucleic acid or nucleic acid sequence composes other kinds of nucleic acid structures such as, for instance, a DNA/RNA helix, peptide nucleic acid (PNA), morpholino nucleic acid (see, e.g., Braasch and Corey, Biochemistry, 41(14): 4503-4510 (2002)) and U.S. Pat. No.
  • LNA locked nucleic acid
  • cyclohexenyi nucleic acids see Wang, j. Am. Chem. Soc., 122: 8595-8602 (2000), incorporated herein by reference
  • a ribozyme see Wang, j. Am. Chem. Soc., 122: 8595-8602 (2000), incorporated herein by reference
  • nucleic acid or “nucleic acid sequence” may also encompass a chain comprising non-natural nucleotides, modified nucleotides, and/or non- nucleotide building blocks that can exhibit the same function as natural nucleotides (e.g., “nucleotide analogs”); further, the term “nucleic acid sequence” as used herein refers to an oligonucleotide, nucleotide or polynucleotide, and fragments or portions thereof, and to DNA or RNA of genomic or synthetic origin, which may be single or double-stranded, and represent the sense or antisense strand.
  • nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • a “peptide” or “polypeptide” is a linked sequence of two or more amino acids linked by peptide bonds.
  • the peptide or polypeptide can be natural, synthetic, or a modification or combination of natural and synthetic.
  • Polypeptides include proteins such as binding proteins, receptors, and antibodies. The proteins may be modified by the addition of sugars, lipids or other moieties not included m the amino acid chain.
  • the terms “polypeptide” and “protein,” are used interchangeably herein.
  • percent sequence identity refers to the percentage of nucleotides or nucleotide analogs in a nucleic acid sequence, or amino acids m an amino acid sequence, that is identical with the corresponding nucleotides or amino acids in a reference sequence after aligning the two sequences and introducing gaps, if necessary, to achieve the maximum percent identity.
  • m case a nucleic acid according to the technology is longer than a reference sequence, additional nucleotides m the nucleic acid, that do not align with the reference sequence, are not taken into account for determining sequence identity.
  • Methods and computer programs for alignment are well known in the art, including BLAST, Align 2, and FASTA.
  • a “vector” or “expression vector” is a replicon, such as plasmid, phage, virus, or cosmid, to which another DNA segment, e.g., an “insert,” may be attached or incorporated so as to bring about the replication of the attached segment m a cell.
  • wild-type refers to a gene or a gene product that has the characteristics of that gene or gene product when isolated from a naturally occurring source. A wild-type gene is that which is most frequently observed in a population and is thus arbitrarily designated the “normal” or “wild-type” form of the gene.
  • mutant refers to a gene or gene product that displays modifications in sequence and or functional properties fe.g., altered characteristics) when compared to the wild-type gene or gene product. It is noted that naturally occurring mutants can be isolated; these are identified by the fact that they have altered characteristics when compared to the wild- type gene or gene product.
  • CRISPR/Cas systems provide immunity by incorporating fragments of invading phage, virus, and plasmid DNA into CRISPR loci and using corresponding CRISPR RNAs (“crRNAs”) to guide the degradation of homologous sequences.
  • crRNAs CRISPR RNAs
  • Each CRISPR locus encodes acquired “spacers” that are separated by repeat sequences. Transcription of a CRISPR locus produces a “pre- crRNA,” which is processed to yield crRNAs containing spacer- repeat fragments that guide effector nuclease complexes to cleave dsDNA sequences complementary to the spacer.
  • CRISPR systems Three different types are known, type I, type II, or type III, and classified based on the Cas protein type and the use of a proto-spacer-adjacent motif (PAM) for selection of proto-spacers m invading DNA.
  • the endogenous type II systems comprise the Cas9 protein and two noncoding crRNAs: trans-activating crRNA (tracrRNA) and a precursor crRNA (pre-crRNA) array containing nuclease guide sequences (also referred to as “spacers”) interspaced by identical direct repeats (DRs).
  • tracrRNA is important for processing the pre-crRNA and formation of the Cas9 complex.
  • First traerRNAs hybridize to repeat regions of the pre-crRNA.
  • each mature complex locates a target double stranded DNA (dsDNA) sequence and cleaves both strands using the nuclease activity of Cas9.
  • dsDNA target double stranded DNA
  • CRISPR/Cas gene editing systems have been developed to enable targeted modifications to a specific gene of interest in eukaryotic cells.
  • CRISPR/Cas gene editing systems are commonly based on the RNA-guided Cas9 nuclease from the type II prokaryotic clustered regularly interspaced short palindromic repeats (CRISPR) adaptive immune system.
  • Engineering CRISPR/Cas systems for use in eukaryotic cells typically involves reconstitution of the crRNA -tracrRNA -Cas9 complex.
  • the Cas9 amino acid sequence may be codon-optimized and modified to include an appropriate nuclear localization signal, and the crRNA and tracrRNA sequences may be expressed individually or as a single chimeric molecule via an RNA polymerase 11 promoter.
  • the crRNA and tracrRN A sequences are expressed as a chimera and are referred to collectively as “guide RNA” (gR A) or single guide RNA (sgRNA).
  • guide RNA single guide RNA
  • synthetic guide RNA are used interchangeably herein and refer to a nucleic acid sequence comprising a tracrRNA and a pre-crRNA array containing a guide sequence.
  • guide sequence refers to the about 20 nucleotide sequence within a guide RN A that specifies the target site.
  • the guide RNA contains an approximate 20- nucleotide guide sequence followed by a protospacer adjacent motif (PAM) that directs Cas9 via Watson- Crick base pairing to a target sequence.
  • PAM protospacer adjacent motif
  • the disclosure provides a system for RNA-guided recombmeering utilizing tools from CRISPRgene editing systems.
  • the system comprises: a Cas protein, a nucleic acid molecule comprising a guide RNA sequence that is complementary to a target DNA sequence and a microbial recombination protein.
  • Cas protein families are described in further detail in, e.g., Haft et al. , PLoS CompuL Biol.,
  • the Cas protein may be any Cas endonucleases.
  • the Cas protein is Cas9 or Cas 12a, otherwise referred to as Cpfl.
  • the Cas9 protein is a wild-type Cas9 protein.
  • the Cas9 protein can be obtained from any suitable microorganism, and a number of bacteria express Cas9 protein orthologs or variants.
  • the Cas9 is from Streptococcus pyogenes or Staphylococcus aureus.
  • Cas9 proteins of other species are known in the art (see, e.g., U.S. Patent Application Publication 2017/0051312, incorporated herein by reference) and may be used m connection with the present disclosure.
  • the amino acid sequences of Cas proteins from a variety of species are publicly available through the GenBank and UniProt databases.
  • the Cas9 protein is a Cas9 nickase (Cas9n).
  • Wild-type Cas9 has two catalytic nuclease domains facilitating double-stranded DNA breaks.
  • a Cas9 mckase protein is typically engineered through inactivating point mutation(s) in one of the cataly tic nuclease domains causing Cas9 to nick or enzymatically break only one of the two DNA strands using the remaining active nuclease domain.
  • Cas9 nickases are known in the art (see, e.g., U.S.
  • the Cas9 nickase is Streptococcus pyogenes Cas9n (D10A).
  • the Cas protein is a catalytically dead Cas.
  • catalytically dead Cas9 is essentially a DNA-binding protein due to, typically, two or more mutations within its catalytic nuclease domains which renders the protein with very little or no catalytic nuclease activity .
  • Streptococcus pyogenes Cas9 may be rendered catalytically dead by mutations of DIO and at least one of E762, H840, N854, N863, or D986, typically H840 and/or N863 (see, e.g., U.S. Patent Application Publication 2017/0051312, incorporated herein by reference). Mutations in corresponding orthologs are known, such as N580 in Staphylococcus aureus Cas9. Oftentimes, such mutations cause catalytically dead Cas proteins to possess no more than 3% of the normal nuclease activity'.
  • the system comprises a nucleic acid molecule comprising a guide RNA sequence complementary to a target DNA sequence.
  • the guide RNA sequence specifies the target site with an approximate 20-nucleotide guide sequence followed by a protospacer adjacent motif (PA/M) that directs Cas9 via Watson-Cnek base pairing to a target sequence.
  • PA/M protospacer adjacent motif
  • target DNA sequence refers to a polynucleotide (nucleic acid, gene, chromosome, genome, etc.) to which a guide sequence (e.g., a guide RNA) is designed to have complementarity, wherein hybridization between the target sequence and a guide sequence promotes the formation of a Cas9/CRISPR complex, provided sufficient conditions for binding exist.
  • the target sequence is a genomic DNA sequence.
  • genomic refers to a nucleic acid sequence (e.g., a gene or locus) that is located on a chromosome in a cell.
  • a target sequence may comprise any polynucleotide, such as DNA or RNA.
  • Suitable DNA/RNA binding conditions include physiological conditions normally present in a cell.
  • Other suitable DNA/RNA binding conditions e.g., conditions in a cell-free system are known in the art; see, e.g., Sambrook, referenced herein and incorporated by reference.
  • the strand of the target DNA that is complementary to and hybridizes with the DNA- targeting RNA is referred to as the “complementary strand” and the strand of the target DNA that is complementary to the “complementary strand” (and is therefore not complementary to the DNA-targeting RNA) is referred to as the “noncomplementary strand” or “non-complementary strand.”
  • the target genomic DNA sequence may encode a gene product.
  • gene product refers to any biochemical product resulting from expression of a gene.
  • Gene products may be RNA or protein.
  • RNA gene products include non-coding RNA, such as ⁇ RNA, rRNA, micro RNA (tniRNA), and small interfering RNA (siRNA), and coding RNA, such as messenger RNA (mRNA).
  • mRNA messenger RNA
  • the target genomic DNA sequence encodes a protein or polypeptide.
  • two nucleic acid molecules comprising a guide RNA sequence may be utilized.
  • the two nucleic acid molecules may have the same or different guide RNA sequences, thus complementary to the same or different target DNA sequence.
  • the guide RN A sequences of the two nucleic acid molecules are complementary to a target DNA sequences at opposite ends (e.g., 3’ or 5’) and/or on opposite strands of the insert location.
  • the system further comprises a recruitment system comprising at least one aptamer sequence and an aptamer binding protein functionally linked to the microbial recombination protein as part of a fusion protein.
  • the aptamer sequence is an RNA aptamer sequence.
  • the nucleic acid molecule comprising the guide RNA also comprises one or more RN A aptamers, or distinct RNA secondary structures or sequences that can recruit and bind another molecular species, an adaptor molecule, such as a nucleic add or protein.
  • the RNA aptamers can be naturally occurring or synthetic oligonucleotides that have been engineered through repeated rounds of m vitro selection or SELEX (systematic evolution of ligands by exponential enrichment) to bind to a specific target molecular species.
  • the nucleic acid comprises two or more aptamer sequences.
  • the aptamer sequences may be the same or different and may target the same or different adaptor proteins.
  • the nucleic acid comprises two aptamer sequences.
  • RNA aptamer/ aptamer binding protein pair known may be selected and used in connection with the present disclosure (see, e.g., Jayasena, S.D., Clinical Chemistry, 1999. 45(9): p. 1628- 1650; Gelinas, et af, Current Opinion in Structural Biology, 2016. 36: p. 122-132, and Hasegawa, II, Molecules, 2016; 21(4): p. 421, incorporated herein by reference).
  • RNA aptamer binding, or adaptor, proteins exist, including a diverse array of bacteriophage coat proteins.
  • coat proteins include but are not limited to: MS2, Q[3, F2, GA, fr, JP501, M12, R17, BZ13, JP34, JP500, KU1, Mil, MX1, TW18, VK, SP, FI, ID2, NIAS, TW19, AP205, c
  • the RNA aptamer binds MS2 bacteriophage coat protein or a functional derivative, fragment or variant thereof.
  • MS2 binding RNA aptamers commonly have a simple stem-loop structure, classically defined by a 19 nucleotide RNA molecule with a single bulged adenine on the 5’ leg of the stem (Witherall G.W., et al, (1991) Prog. Nucleic Acid Res. Mol. Biol., 40, 185-220, incorporated herein by reference).
  • MS2 coat protein Parrott AM, et al., Nucleic Acids Res. 2000;28(2):489-497, Buenrostro ID, et al. Natura Biotechnology 2014; 32, 562-568, and incorporated herein by reference).
  • the MS2 RNA aptamer sequence comprises: AACAUGAGGAUCACCCAUGUCUGCAG (SEQ ID NO: 145), AGCAUGAGGAUCACCCAUGUCUGCAG (SEQ ID NO: 146), or AGCGUGAGGAUCACCCAUGCCUGCAG (SEQ ID NO: 147).
  • N-proteins (Nut-utilization site proteins) of bacteriophages contain arginine-rich conserved RN A recognition motifs of ⁇ 20 amino acids, referred to as N peptides.
  • the RNA aptamer may bind a phage N peptide or a functional derivative, fragment or variant thereof.
  • the phage N peptide is the lambda or P22 phage N peptide or a functional derivative, fragment or variant thereof.
  • the N peptide is lambda phage N22 peptide, or a functional derivative, fragment or variant thereof.
  • the N22 peptide comprises an amino acid sequence with at least 70% similarity to the ammo acid sequence GNARTRRRERRAEKQAQWKAAN (SEQ ID NO: 149).
  • N22 peptide, the 22 amino acid RNA-binding domain of the l bacteriophage antiterminator protein N (lN-(1-22) or lN peptide) is capable of specifically binding to specific stem-loop structures, including but not limited to the BoxB stem-loop. See, for example Gilley and Williamson, RNA 1997;
  • the N22 peptide RNA aptamer sequence comprises a nucleotide sequence with at least 70% similarity to an RNA sequence selected from the group consisting of GCCCUGAAAAAGGGC (SEQ ID NO: 150), GCCCUGAAGAAGGGC (SEQ ID NO: 151), GCGCUGAAAAAGCGC (SEQ ID NO: 152), GCCCU GAC AAAGGGC (SEQ ID NO: 153), and GCGCUGACAAAGCGC (SEQ ID NO: 154).
  • the N22 peptide RNA aptamer sequence is selected from the group consisting of SEQ ID NQs: 150-154.
  • the N peptide is the P22 phage N peptide, or a functional derivative, fragment or variant thereof
  • a number of different BoxB stem-loop primary sequences are known to bind the P22 phage N peptide and variants thereof and any of those may be utilized in connection with the present disclosure. See, for example Cocozaki, Ghattas, and Smith, Journal of Bacteriology 2008;
  • the P22 phage N peptide comprises an amino acid sequence with at least 70% similarity to the ammo acid sequence GNAKTRRHERRRKLAIERDn (SEQ ID NO: 155).
  • the P22 phage N peptide RNA aptamer sequence comprises a sequence with at least 70% similarity to an RNA sequence selected from the group consisting of GCGCUGACAAAGCGC (SEQ ID NO: 156) and CCGCCGACAACGCGG (SEQ ID NO: 157).
  • the P22 phage N peptide RNA aptamer sequence is selected from the group consisting of SEQ ID NOs: 156-157, UGCGCUGACAAAGCGCG (SEQ ID NO: 158) or ACCGCCGACAACCCGGU (SEQ ID NO: 159).
  • the aptamer sequence is a peptide aptamer sequence.
  • the peptide aptamers can be naturally occurring or synthetic peptides that are specifically recognized by an affinity agent.
  • Such aptamers include, but are not limited to, a c-Myc affinity tag, an HA affinity tag, a His affinity' tag, an S affinity' tag, a methionine-His affinity tag, an RGD-His affinity tag, a 7x His tag, a FLAG Qctapeptide, a strep tag or strep tag II, a V5 tag, or a VSV-G epitope.
  • Corresponding aptamer binding proteins are well-known in the art and include, for example, primary antibodies, biotin, affimers, single domain antibodies, and antibody mimetics.
  • An exemplary peptide aptamer includes a GCN4 peptide (Tanenbaum et al., Cell 2014; 159(3):635-646, incorporated herein by reference).
  • Antibodies, or GCN4 binding protein can be used as the aptamer binding proteins.
  • the peptide aptamer sequence is conjugated to the Cas protein.
  • the peptide aptamer sequence may be fused to the Cas m any orientation (e.g., N-termmus to C-termmus, C- terminus to N-termmus, N-termmus to N- term in us).
  • the peptide aptamer is fused to the C-terminus of the Cas protein.
  • between 1 and 24 peptide aptamer sequences may be conjugated to the Cas protein.
  • the aptamer sequences may he the same or different and may target the same or different aptamer binding proteins.
  • 1 to 24 tandem repeats of the same peptide aptamer sequence are conjugated to the Cas protein.
  • between 4 and 18 tandem repeats are conjugated to the Cas protein.
  • the individual aptamers may be separated by a linker region. Suitable linker regions are known in the art. The linker may be flexible or configured to allow' the binding of affinity agents to adjacent aptamers without or with decreased steric hindrance.
  • the linker sequences may provide an unstructured or linear region of the polypeptide, for example, with the inclusion of one or more glycine and/or serine residues.
  • the linker sequences can be at least about 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids in length.
  • the fusion protein comprises a microbial recombination protein functionally linked to an aptamer binding protein.
  • the microbial recombination protein may be RecE, ReeT, lambda exonuclease (Exo), Bet protein (betA, redB), exonuclease gp6, single-stranded DNA- bindmg protein gp2.5, or a derivative or variant thereof.
  • the microbial recombination protein is RecE or ReeT, or a derivative or variant thereof.
  • Derivatives or variants of RecE and ReeT are functionally equivalent proteins or polypeptides which possess substantially similar function to wild type RecE and ReeT.
  • RecE and ReeT derivatives or variants include biologically active ammo acid sequences similar to the wild-type sequences but differing due to amino acid substitutions, additions, deletions, truncations, post- translational modifications, or other modifications.
  • the derivatives may improve translation, purification, biological half-life, activity, or eliminate or lessen any undesirable side effects or reactions.
  • the derivatives or variants may be naturally occurring polypeptides, synthetic or chemically synthesized polypeptides or genetically engineered peptide polypeptides.
  • RecE and ReeT bioactivities are known to, and easily assayed by, those of ordinary' skill in the art, and include, for example exonuclease and single-stranded nucleic acid binding, respectively.
  • the RecE or ReeT may be from a number of microbial organisms, including Escherichia coii, Pantoea breeneri, Type-F symbiont of Plautia stall , Providencia sp. MGF0I4, Shigella sonnei, Pseudobacteriovorax anti!!ogorgiico!a, among others.
  • the RecE and ReeT protein is derived from Escherichia coli.
  • the fusion protein comprises RecE, or a derivative or variant thereof.
  • the RecE, or derivative or variant thereof may comprise an amino acid sequence selected from the group consisting of 8EQ ID NOs: 1-8.
  • the RecE, or derivative or variant thereof may comprise an ammo acid sequences with at least 70% (e.g., 75%., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) similarity to amino acid sequences selected from the group consisting of SEQ ID NOs: 1- 8.
  • the RecE, or derivative or variant thereof comprises an amino acid sequences with at least 90% similarity to amino acid sequences selected from the group consisting of SEQ ID NOs: 1-8. In exemplary embodiments, the RecE, or derivative or variant thereof, comprises an amino acid sequences with at least 90% similarity to amino acid sequences selected from the group consisting of SEQ ID NOs: 1-3.
  • the fusion protein comprises ReeT, or a derivative or variant thereof
  • the ReeT, or derivative or variant thereof may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 9-14.
  • the RecT, or derivative or variant thereof may comprise an ammo acid sequences with at least 70% (e.g., 75%., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) similarity to amino acid sequences selected from the group consisting of SEQ ID NOs: 9- 14.
  • the RecT, or derivative or variant thereof comprises an amino acid sequences with at least 90% similarity to amino acid sequences selected from the group consisting of SEQ ID NOs: 9-14. In exemplary embodiments, the RecT, or derivative or variant thereof, comprises an amino acid sequences with at least 90% similarity to amino acid sequences selected from the group consisting of SEQ ID NO: 9.
  • Truncations may be from either the C-terminai or N-terminal ends, or both.
  • a diverse set of truncations from either end or both provided a functional product.
  • one or more (2, 3, 4, 5, 10, 20, 30, 40, 50, 60, 100, 120 or more) amino acids may be truncated from the C-terminal, N-terminal ends as compared to the wild-type sequence.
  • the microbial recombination protein may be linked to either terminus of the aptamer binding protein in any orientation (e.g., N-terminus to C-terminus, C-terminus to N-terminus, N-terminus to N-terminus).
  • the microbial recombination protein N-terminus is linked to the aptamer binding protein C-terminus.
  • the overall fusion protein from N ⁇ to C-terminus comprises the aptamer binding protein (N ⁇ to C-terminus) linked to the microbial recombination protein (N- to C-terminus).
  • the fusion protein further comprises a linker between the microbial recombination protein and the aptamer binding protein.
  • the linkers may comprise any amino acid sequence of any length.
  • the linkers may be flexible such that they do not constrain either of the two components they link together in any particular orientation.
  • the linkers may essentially act as a spacer.
  • the linker links the C-terminus of the microbial recombination protein to the N- terminus of the aptamer binding protein in select embodiments, the linker comprises the amino acid sequence of the 16-residue XTEN linker, SGSETPGTSES ATPES (8EQ ID NO: 15) or the 37-residue EXTEN linker, SASGGSSGGSSGSETPGTSESATPESSGGSSGGSGGS (SEQ ID NO: 148).
  • the fusion protein further comprises a nuclear localization sequence (NLS).
  • the nuclear localization sequence may be at any location within the fusion protein (e.g., C- terminal of the aptamer binding protein, N-terminal of the aptamer binding protein, C-terminal of the microbial recombination protein) in select embodiments, the nuclear localization sequence is linked to the C-terminus of the microbial recombination protein.
  • a number of nuclear localization sequences are known m the art (see, e.g., Lange, A., et al., J Biol (Them. 2007; 282(8): 5101-5105, incorporated herein by reference) and may be used in connection with the present disclosure.
  • the nuclear localization sequence may be the SV40 NLS, PKKKRKV (SEQ ID NO: 16); the Tyl NLS, NSKKRSLEDNEIEIKVSRDTWNTKNMRSLEPPRSKKRIH (SEQ ID NO: 17); the c-Myc NLS, PAAKRVKLD (SEQ ID NO: 18); the biSV40 NLS, KRTADGSEFESPKKKRKV (SEQ ID NO: 19); and the Mut NLS, PEKKRRRPSGSVPVLARPSPPKAGKSSCI (SEQ ID NO: 20).
  • the nuclear localization sequence is the SV40 NLS, PKKKRKV (SEQ ID NO: 16).
  • the Cas protein and the fusion protein are desirably included in a single composition alone, in combination with each other, and/or the polynucleotide(s) (e.g., a vector) comprising the guide RNA sequence and the aptamer sequence.
  • the Cas protein and/or the fusion protein may or may not be physically or chemically bound to the polynucleotide.
  • the Cas protein and/or the microbial recombination protein can be associated with a polynucleotide using any suitable method for protein-protein linking or protein-virus linking known in the art.
  • compositions and vectors comprising a polynucleotide comprising a nucleic acid sequence encoding a fusion protein comprising a microbial recombination protein functionally linked to an RNA aptamer binding protein.
  • compositions or vectors may further comprise at least one or both of a polynucleotide comprising a nucleic acid sequence encoding a Cas protein and a nucleic acid molecule comprising a guide RNA sequence that is complementary to a target DNA sequence.
  • the nucleic acid molecule comprising a guide RNA sequence further comprises at least one RNA aptamer sequence.
  • the polynucleotide comprising a nucleic acid sequence encoding a Cas protein further comprises a sequence encoding at least one peptide aptamer sequence.
  • nucleic acid molecule comprising a guide RNA sequence, the aptamer sequences, the Cas proteins, the microbial recombination proteins, and the aptamer binding proteins set forth above in connection with the inventive system also are applicable to the polynucleotides of the recited compositions and vectors.
  • the nucleic acid sequence encoding the Cas protein and/or the nucleic acid sequence encoding a fusion protein comprising a microbial recombination protein functionally linked to an aptamer binding protein can be provided to a cell on the same vector (e.g., in cis) as the nucleic acid molecule comprising the guide RN A sequence and/or the RNA aptamer sequence.
  • a unidirectional promoter can be used to control expression of each nucleic acid sequence.
  • a combination of bidirectional and unidirectional promoters can be used to control expression of multiple nucleic acid sequences.
  • a nucleic acid sequence encoding the Cas protein, the nucleic acid sequence encoding a fusion protein comprising a microbial recombination protein functionally linked to an aptamer binding protein, and the nucleic acid molecule comprising the guide RNA sequence and/or the RNA aptamer sequence can be provided to a cell on separate vectors (e.g., in trims).
  • Each of the nucleic acid sequences in each of the separate vectors can comprise the same or different expression control sequences.
  • the separate vectors can be provided to cells simultaneously or sequentially.
  • the vector(s) comprising the nucleic acid sequences encoding the Cas protein and encoding a fusion protein comprising a microbial recombination protein functionally linked to an aptamer binding protein can be introduced into a host cell that is capable of expressing the polypeptide encoded thereby, including any suitable prokaryotic or eukaryotic ceil.
  • a host cell capable of expressing the polypeptide encoded thereby, including any suitable prokaryotic or eukaryotic ceil.
  • the disclosure provides an isolated cell comprising the vector or nucleic acid sequences disclosed herein.
  • Preferred host cells are those that can be easily and reliably grown, have reasonably fast growth rates, have well characterized expression systems, and can be transformed or transfected easily and efficiently.
  • suitable prokaryotic cells include, but are not limited to, cells from the genera Bacillus (such as Bacillus suhtilis and Bacillus brevis), Escherichia (such as A. coll), Pseudomonas , Streptomyces, Salmonella, and Envinia.
  • Suitable eukaryotic cells are known in the art and include, for example, yeast cells, insect cells, and mammalian ceils.
  • suitable yeast cells include those from the genera Kluyveromyces, Pichia, Rhino- sporidiurn, Saccharomyces, and Schizosaccharomyces.
  • Exemplary insect cells include Sf-9 and HIS (Invitrogen, Carlsbad, Calif.) and are described in for example, Kitts et al., Biotechniques, 14: 810-817 (1993); Luckiow, Curr. Opin. Biolechnol., 4: 564-572 (1993); and Lucklow et al., J. Virol., 67: 4566- 4579 (1993), incorporated herein by reference.
  • the host cell is a mammalian cell, and in some embodiments, the host cell is a human ceil.
  • a number of suitable mammalian and human host ceils are known in the art, and many are available from the American Type Culture Collection (ATCC, Manassas, Va.).
  • suitable mammalian cells include, but are not limited to, Chinese hamster ovary cells (CHO) (ATCC No. CCL61), CHO DHFR-cells (Urlaub et al., Proc. Natl. Acad. Sci. USA, 97: 4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), and 3T3 ceils (ATCC No. CCL92).
  • CHO Chinese hamster ovary cells
  • CHO DHFR-cells Urlaub et al., Proc. Natl. Acad. Sci. USA, 97: 4216-4220 (1980)
  • human embryonic kidney (HEK) 293 or 293T cells ATCC No. CRL1573)
  • 3T3 ceils ATCC No. CCL92.
  • Other suitable mammalian cell lines are the monkey COS-1 (ATCC No. CRL1650) and COS-7 cell lines (ATCC No. CITE 16
  • mammalian host cells include primate, rodent, and human cell lines, including transformed cell lines. Normal diploid cells, cell strains derived from in vitro culture of primar tissue, as well as primary explants, are also suitable.
  • Other suitable mammalian cell lines include, hut are not limited to, mouse neuroblastoma N2A cells, HeLa, HEK, A549, HepG2, mouse L-929 cells, and BHK or HaK hamster ceil lines. Methods for selecting suitable mammalian host cells and methods for transformation, culture, amplification, screening, and purification of cells are known in the art.
  • the disclosure also provides a method of altering a target DNA.
  • the method alters genomic DNA sequence in a cell, although any desired nucleic acid may be modified.
  • the method comprises introducing the systems, compositions, or vectors described herein into a cell comprising a target genomic DNA sequence.
  • Descriptions of the nucleic acid molecule comprising a guide RNA sequence, the Cas proteins, the microbial recombination proteins, the recruitment systems, and polynucleotides encoding thereof, the cell, the target genomic DNA sequence, and components thereof, set forth above in connection with the inventive system are also applicable to the method of altering a target genomic DNA sequence in a cell.
  • the systems, composition or vectors may be introduced in any manner known in the art including, but not limited to, chemical transfection, electroporation, microinjection, bioiistie delivery via gene guns, or magnetic- assisted transfection, depending on the cell type.
  • the guide RNA sequence binds to the target genomic DNA sequence m the cell genome
  • the Cas protein associates with the guide RNA and may induce a double strand break or single strand nick in the target genomic DNA sequence and the aptamer recruits the microbial recombination proteins to the target genomic DNA sequence through the aptamer binding protein of the fusion protein, thereby altering the target genomic DNA sequence in the cell.
  • the nucleic acid molecule comprising a guide RNA sequence, the Cas9 protein and the fusion protein are first expressed in the cell.
  • the cell is in an organism or host, such that introducing the disclosed systems, compositions, vectors into the cell comprises administration to a subject.
  • the method may comprise providing or administering to the subject, in vivo, or by transplantation of ex vivo treated cells, systems, compositions, vectors of the present system.
  • a “subject” may be human or non-human and may include, for example, animal strains or species used as “model systems” for research purposes, such a mouse model as described herein.
  • subject may include either adults or juveniles fe.g., children).
  • subject may mean any living organism, preferably a mammal (e.g., human or non-human) that may benefit from the administration of compositions contemplated herein.
  • mammals include, but are not limited to, any member of the Mammalian class: humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, sw e; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like.
  • non-mammals include, but are not limited to, birds, fish, and the like.
  • the mammal is a human.
  • the terms “providing”, “administering,” “introducing,” are used interchangeably herein and refer to the placement of the systems of the disclosure into a subject by a method or route which results in at least partial localization of the system to a desired site.
  • the systems can be administered by any appropriate route which results m delivery to a desired location in the subject.
  • altering a DNA sequence refers to modifying at least one physical feature of a DNA sequence of interest DNA alterations include, for example, single or double strand DNA breaks, deletion, or insertion of one or more nucleotides, and other modifications that affect the structural integrity or nucleotide sequence of the DNA sequence.
  • the modifications of a target sequence in genomic DNA may lead to, for example, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, gene mutation, gene knock-down, and the like.
  • the systems and methods described herein may be used to correct one or more defects or mutations in a gene (referred to as “gene correction”).
  • the target genomic DNA sequence encodes a defective version of a gene, and the system further comprises a donor nucleic acid molecule which encodes a wild-type or corrected version of the gene.
  • the target genomic DNA sequence is a “disease-associated” gene.
  • disease-associated gene refers to any gene or polynucleotide whose gene products are expressed at an abnormal level or in an abnormal form in ceils obtained from a disease-affected individual as compared with tissues or cells obtained from an individual not affected by the disease.
  • a disease-associated gene may he expressed at an abnormally high level or at an abnormally low level, where the altered expression correlates with the occurrence and/or progression of the disease.
  • a disease-associated gene also refers to a gene, the mutation or genetic variation of which is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
  • genes responsible for such “single gene” or “monogenic” diseases include, but are not limited to, adenosine deaminase, a-1 antitrypsin, cystic fibrosis transmembrane conductance regulator (CFTR), b-hemoglobin (EBB), oculocutaneous albinism II (OCA2), Huntmgtin (HTT), dystrophia myotonica-protein kinase (DMPK), low-density lipoprotein receptor (LDLR), apolipoprotein B (APGB), neurofibromm 1 (NF1), polycystic kidney disease 1 (PKD1), polycystic kidney disease 2 (PKD2), coagulation factor VIII (F8), dystrophin (DMD), phosphate regulating endopeptidase homologue, X-linked (PIIEX), methyl-CpG-b ding protein 2 (MECP2), and ubiquitin-specifie peptidase 9Y, Y-linked
  • the target genomic DNA sequence can comprise a gene, the mutation of which contributes to a particular disease in combination with mutations in other genes.
  • Diseases caused by the contribution of multiple genes which lack simple (e.g., Mendelian) inheritance patterns are referred to in the art as a “multifactorial” or “polygenic” disease.
  • multifactorial or polygenic diseases include, but are not limited to, asthma, diabetes, epilepsy, hypertension, bipolar disorder, and schizophrenia.
  • Certain developmental abnormalities also can be inherited in a multifactorial or polygenic pattern and include, for example, cleft hp/palate, congenital heart defects, and neural tube defects.
  • the method of altering a target genomic DNA sequence can be used to delete nucleic acids from a target sequence m a cell by cleaving the target sequence and allowing the cell to repair the cleaved sequence in the absence of an exogenously provided donor nucleic acid molecule.
  • Deletion of a nucleic acid sequence in this manner can be used in a variety of applications, such as, for example, to remove disease-causing trinucleotide repeat sequences in neurons, to create gene knock-outs or knock-downs, and to generate mutations for disease models in research.
  • donor nucleic acid molecule refers to a nucleotide sequence that is inserted into the target DNA (e.g., genomic DNA).
  • the donor DNA may include, for example, a gene or part of a gene, a sequence encoding a tag or localization sequence, or a regulating element.
  • the donor nucleic acid molecule may be of any length. In some embodiments, the donor nucleic acid molecule is between 10 and 10,000 nucleotides in length.
  • nucleotides in length between about 100 and 5,000 nucleotides in length, between about 200 and 2,000 nucleotides in length, between about 500 and 1,000 nucleotides in length, between about 500 and 5,000 nucleotides in length, between about 1,000 and 5,000 nucleotides in length, or between about 1,000 and 10,000 nucleotides in length,
  • the disclosed systems and methods overcome challenges encountered during conventional gene editing, including low efficiency and off-target events, particularly with kilobase-scale nucleic acids in some embodiments, the disclosed systems and methods improve the efficiency of gene editing.
  • the disclosed systems and methods can have a 2- to 10-fold increase in efficiency over conventional CRISPR-Cas9 systems and methods, as shown in Examples 2, 3, and 5.
  • the improvement in efficiency is accompanied by a reduction in off-target events.
  • the off- target events may be reduced by greater than 50% compared to conventional CRISPR-Cas9 systems and methods, for example, a reduction of off-target events by about 90% is shown in Example 3.
  • Another aspect of increasing the overall accuracy of a gene editing system is reducing the on- target insertion- deletions (indels), a byproduct of HDR editing.
  • the disclosed systems and methods reduce the on-target indels by greater than 90% compared to conventional CRISPR-Cas9 systems and methods, as shown in Example 3.
  • kits containing one or more reagents or other components useful, necessary', or sufficient for practicing any of the methods described herein.
  • kits may include CRISPR reagents (Cas protein, guide ENA, vectors, compositions, etc.), reeombineering reagents (recombination protein-apta er binding protein fusion protein, the aptamer sequence, vectors, compositions, etc.) transfection or administration reagents, negative and positive control samples (e.g., ceils, template DNA), cells, containers housing one or more components (e.g., microcentrifuge tubes, boxes), detectable labels, detection and analysis instruments, software, instructions, and the like.
  • CRISPR reagents Cas protein, guide ENA, vectors, compositions, etc.
  • reeombineering reagents recombination protein-apta er binding protein fusion protein, the aptamer sequence, vectors, compositions, etc.
  • negative and positive control samples e.g.,
  • RecE/T Homolog Screening RefSeq non-redundant protein database was downloaded from NCBI on October 29, 2019. The database was searched with E. coli Rac prophage RecT (NP 415865.1) and RecE (NP 415866.1) as queries using position-specific iterated (PSl)-BLAST ’1 to retrieve protein homologs. Hits -were clustered with CD-HIT2 and representative sequences were selected from each cluster for multiple alignment with MUSCLE 3 . Then, FastTree4 was used for maximum likelihood tree reconstruction with default parameters. A diverse set of RecET homologs were selected, synthesized by GenScript, and cloned into pMPHJMCP vectors for testing.
  • PSl position-specific iterated
  • Plasmids construction pX33Q, pMPH and pU6-(BbsI) CBh-Cas9-T2A-BFP plasmids were obtained from Addgene. Tested effector DNA fragments were ordered from IDT, Genewiz, and GenScript. The fragments were Gibson assembled into the backbones using NEBuilder HiFi DNA Assembly Master Mix (New' England BioLabs). All sgRNAs (Table 1) were inserted into backbones using Golden Gate cloning. All constructs w'ere sequence-verified with Sanger sequencing of prepped plasmids.
  • HEK Cell culture Human Embryonic Kidney 293T, HeLa and HepG2 were maintained in Dulbecco’s Modified Eagle’s Medium (DMEM, Life Technologies), with 10% fetal bovine serum (FBS, HyClone), 100 U/mL penicillin, and 100 pg/mL streptomycin (Life Technologies) at 37 °C with 5% CO2.
  • DMEM Modified Eagle’s Medium
  • FBS fetal bovine serum
  • streptomycin Life Technologies
  • hES-H9 cells were maintained in mTeSRl medium (Stem Cell Technologies) at 37 °C with 5% CO2. Culture plates were pre-coated with Matrigel (Coming) 12 hours prior to use, and cells were supplemented with 10 pM Y27632 (Sigma) for the first 24 hours after passaging. Culture media was changed every' 24 hours.
  • Transfection HEK293T cells were seeded into 96- well plates (Corning) 12-24 hours prior to transfection at a density of 30,000 cells/well, and 250 ng of total DNA was transfected per well.
  • HeLa and HepG2 cells were seeded into 48-well plates (Corning) one day prior to transfection at a density of 50,000 and 30,000 cells/well respectively, and 400 ng of total DNA was transfected per well. Transfections were performed with Lipofectamine 3000 (Life Technologies) following the manufacturer’s instructions.
  • Fluorescence-activated cell sorting (FACS) mKate knock-in efficiency was analyzed on a
  • CytoFLEX flow' cytometer (Beckman Coulter; Stanford Stem Cell FACS Core). 72 hours after transfection, cells were washed once with PBS and dissociated with TrypLE Express Enzyme (Thermo Fisher Scientific). Cell suspension w3 ⁇ 4s then transferred to a 96-well U-bottom plate (Thermo Fisher Scientific) and centrifuged at 300xG for 5 minutes. After removing the supernatant, pelleted cells were resuspended with 50 m ⁇ 4% FBS in PBS, and cells were sorted within 30 minutes of preparation
  • RFLP H ⁇ K293T cells were transfected with plasmid DNA and PCR templates and harvested after 72 hours for genomic DNA using the QuickExtract DNA Extraction Solution (Biosearch Technologies) following the manufacturer’s protocol.
  • the target genomic region was amplified using specific primers outside of the homology arms of the PCR template.
  • PCR products were purified with Monarch PCR & DNA Cleanup Kit (New England BioLabs). 300 ng of purified product was digested with BsrGI (EMXl, New England BioLabs) or Xhal (VEGFA, NEB), and the digested products were analyzed on a 5% Mini-PROTEAN TBE gel (Bio-Rad).
  • HEK293T ceils were transfected in 20uL Lonza SF Cell Line Nucleofector Solution on a Lonza Nucleofector 4-D with program DS-150 according to the manufacturer’s instructions.
  • gRNA-Cas9 plasmids 300ng of gRNA-Cas9 plasmids (or 150ng of each gRNACas9n plasmid for the double niekase), 150ng of the effector plasmids, and 5pmol of double stranded oligonucleotides (dsODN) were transfected. Ceils were harvested after 72hrs for genomic DNA using Agencourt DNAdvance reagent kit. 400ng of purified gDNA which was then fragmented to an average of 500bp and ligated with adaptors using NEBNext Ultra II FS DNA Library Prep kit following manufacturer’s instructions.
  • TWO rounds of nested anchored PCR from the oiigo tag to the ligated adaptor sequence were performed to amplify targeted DNA, and the amplified library w3 ⁇ 4s purified, size-selected, and sequenced using Illumina Miseq V2 PE300. Sequencing data w3 ⁇ 4s analyzed using the published iGUIDE pipeline, with the addition of a downsampling step which ensures an unbiased comparison across samples.
  • recombineermg-edit tools are available for bacteria, e.g., the phage lambda Red and RecE/T.
  • Microbial recombmeering has two major steps: template DNA is chew'ed back by exonucleases (Exo), then the single-strand annealing protein (SSAP) supports homology directed repair by the template, optionally facilitated by nuclease inhibitor.
  • SSAP single-strand annealing protein
  • a system for RNA-guided targeting of RecE/T recombmeering activities was developed and achieved kilobase (kb) human gene editing without DNA cutting.
  • the top 12 candidates were codon-optimized and MS2 coat protein (MCP) fusions were constructed to recruit these RecE/T homologs, hereafter termed “recomhmator”, to wild-ty pe Streptococcus pyogenes Cas9 (wtCas9) via MS2 RNA aptamers.
  • MCP MS2 coat protein
  • RecE is only 269 ammo acid (AA) long
  • RecE was truncated from AA587 (RecE 587) and the earboxy terminus domain (RecE _CTD) based on functional studies (Muyrers, J.P., Genes Dev. (2000); 14, 1971-1982, incorporated herein by reference).
  • HDR homology directed repair
  • RecE had activities without recruitment, whereas RecT showed efficiency increases in a recruitment-dependent manner (FIG. 3 PI). Without being bound by- theory, this may be explained by RecE exonuclease activity acting promiscuously (FIG. 2C).
  • the RecE/T recombineering-edi t (REDIT) tools was termed as REDITvl , with REDITvl _RecT as the preferred variant.
  • REDITvl performed efficient kilobase editing using HA length as short as 200hp total, with longer HA supporting higher efficiency. It achieved up to 10% efficiency (without selection) for kb-scale knock-in, a 5-fold increase over Cas9-HDR and significantly higher than the 1 ⁇ 2% typical efficiency (FIG. 7). Lastly, the accuracy of REDITv 1 accuracy was determined using deep sequencing of predicted off-target sites (QTSs) and GUIDE-seq. Although REDITv 1 did not increase off-target effects, detectable OTSs remained at previously reported sites for EMX1 and VEGFA (FIGS. 5F-G, FIG. 8). In short, REDITv 1 showcased ki!obase-scale genome recombineering but retained the off-target issues, with REDITv 1 RecT having the highest efficiency .
  • GUIDE-seq Concepts from GUIDE-seq, LAM-PCR, and TLA were used to develop an NGS-based assay to identify genome-wide insertion sites (GIS), or GIS-seq (FIG. 30A).
  • GIS-seq NGS read clusters/peaks representing knock-in insertion sites were obtained (FIG. 3 OB), showing representative reads from the on-target site).
  • GIS-seq was applied to DYNLTl and ACTS loci to measure the knock-in accuracy. Sequencing results indicated that, when considering sites with high confidence based on maximum likelihood estimation, REDIT had less off-target insertion sites identified compared with Cas9 (FIG. 30C).
  • REDITv2D has lower efficiency than REDIT v2N, it achieved programmable DNA-damage-free editing at kilobase-scale with 1-2% efficiency and no selection (FIG. 9D, FIG. lOB). It was hypothesized that tW 'O processes could be contributing to the REDHV2D recombineering. One possibility was via dCas9 unwinding. If dCas9 could unwind DNA as it induces sequence-specific formation of loop, a double-binding with two dCas9s would be expected to promote genome accessibility to RecE/T.
  • FIG. 15 Microscopy analysis revealed incomplete nuclei -targeting of REDITV1, particularly REDITv 1 RecT (FIG. 15). Hence, different designs of protein linkers and nuclear localization signals (NLSs) were tested (FIG. 15A). The extended XTEN-linker with C-terminal SV40-NLS was identified as a preferred configuration, termed REDITv 3 (FIG. 16). REDHV3 further achieved a 2- to 3- fold increase of HDR efficiencies over REDITv2 across genome targets and Cas9 variants (wtCas9, Cas9n, dCas9) (FIG. 17).
  • REDITvS was utilized in hESCs to engineer kilobase knock-in alleles in human stem cells.
  • REDITvSN single- and double-nicking designs resulted in 5-fold and 20-fold increased HDR efficiencies over no-recombinator controls, respectively (FIG. 9F).
  • the efficacy and fidelity were confirmed via a combination of assays described for previous REDIT versions (FIGS. 9F-G, FIG 18).
  • REDHV3 works effectively with Staphylococcus aureus Cas9 (SaCas9), a compact CRISPR system suitable for in vivo delivery (FIG. 19).
  • RecT and RecE 587 variants both RecT and RecE 587 were truncated at various lengths as shown in FIG. 20 A and FIG. 21 A, respectively.
  • the resulting efficiencies were measured using an mKate knock-in assay, with both wildtype SpCas9 and Cas9n(D10A) with single- and double-nicking at the DYNLTl locus (FIGS. 20B-C and FIGS. 21B-C, respectively). Efficiencies of the no recombination group are shown as the control.
  • the truncated versions of both RecT and RecE 587 retained significant recombineering activity when used with different Cas9s.
  • the new truncated versions such as RecT(93-264aa) are over 30% smaller yet they preserved essentially the full activities of RecT in stimulating recombination m eukaryotic cells.
  • truncated versions such as RecE_587(120-221 aa) and RecE_587(120-209aa) are over 60% smaller but still retained high recombination activities in human cells.
  • REDIT harnessed the specificity of CRISPR genome-targeting with the efficiency of RecE/RecT recombineering.
  • the disclosed high-efficiency, low-error system makes a powerful addition to existing CRISPR toolkits.
  • the balanced efficiency and accuracy of REDITvS N makes it an attractive therapeutic option for knock-in of large cassette m immune and stem cells.
  • exonuclease proteins were used: the exonuclease from phage Lambda, the RecE587 core domain of E. cob RecE protein, and the exonuclease (gene name gp6) from phage T7 (FIG. 22A).
  • the gene-editing activity was measured using mKate knock-in assay at genomic loci (DYNLT1 and HSP90AA1).
  • SSAPs single-strand DNA annealing proteins
  • exonucleases showed - -3-fold higher recombination efficiency (up to 4% mKate genome knock-in) when compared with no-recombinator controls.
  • the single-strand annealing proteins (SSAP) showed higher activities, with 4-fold to 8-fold higher gene-editing activities over the control groups. This demonstrated the general applicability and validity' that microbial recombination proteins in the exonuclease and SSAP families could be engineered via the Cas9 ⁇ based fusion protein system to achieve highly efficient genome recombination in mammalian cells.
  • niKate knock-in experiments were used to measure the editing efficiencies at the DYNLT1 locus and the HSP90AA1 locus, respectively.
  • This SunTag-based REDIT system demonstrated significant increase of gene-editing knock-in efficiency at the DYNLT1 genomic sites tested.
  • the SunTag design significantly increased HRD efficiencies to 2-fold better than Cas9 but did not achieve increases as high as the MS2 ⁇ aptamer.
  • Cpfl/Casl2a enzymes have different catalytic residues and DNA- recognition mechanisms from the Cas9 enzymes.
  • the REDIT recombination proteins exonucleases and single-strand annealing proteins
  • Cas9, Cpfl/Casl2a, and others could function independent from the specific choices of the CRiSPR enzyme components (Cas9, Cpfl/Casl2a, and others). This proved the generaiizahiiity of the REDIT system and open up possibility to use additional CRISPR enzymes (known and unknown) as components of REDIT system to achieve accurate genome editing in eukaryotic ceils.
  • RecT-based REDIT design was combined with three different approaches (conveniently through the MS2-aptamer) (FIG. 28A, right).
  • the RecT-based REDIT design could indeed further enhance the HDR-promoting activities of the tested tools (FIG. 28C).
  • EXAMPLE 12 The effect of template HA lengths on the editing efficiency of REDIT was quantified when using the canonical HDR donor bearing HAs of at least 100 bp on each side (FIG. 29A, left). Higher HDR rates were observed for both Cas9 and RecT groups with increasing HA lengths, and REDIT effectively stimulated HDR over Cas9 using HA lengths as short as ⁇ 100bp each side. When supplied with a longer template bearing 600-800 bp total HA, RecT achieved over 10% HDR efficiencies for kb-scale knock-in without selection, significantly higher than the 2-3% efficiency when only using Cas9.
  • the knock-in cells were clonally isolated and the target genomic region was amplified using primers binding completely outside of the donor DNAs for colony Sanger sequencing (FIG. 29B. Junction sequencing analysis ( ⁇ 48 colonies per gene per condition) revealed varying degrees of indels at the 5’- and 3’- knock-injunctions, including at single or both junctions (FIG. 29C). Overall, HDR donors had better precision than MMEJ donors, and REDIT modestly improved the knock-in yield compared with Cas9, though j unction indels w3 ⁇ 4re still observed.
  • next-generation sequencing was used to quantify the editing events. Comparable levels of indels were observed between Cas9 and REDIT with improved HDR efficiencies using REDIT.
  • Mifin a potent chemical inhibitor of DSB repair, which has also been shown to prevent MRN complex formation, MRN-dependent ATM activation, and inhibit Mrel 1 exonuclease activity was also used.
  • Mrining only the editing efficiencies of Cas9 reference experiments were affected by the Miring treatment, whereas the REDIT versions were essentially the same as vehicle- treated groups across all genomic targets (FIG. 32A).
  • REDIT was applied in human embryonic stem cells (hESCs) to test their ability to engineer long sequences in non-transform ed human cells.
  • Robust stimulation of HDR was observed across all three genomic sites (HSP90AAI , ACTS, OCT 4/POU5F1) using REDIT and REDITdn (FIGS. 3 ID and 3 IE).
  • REDIT and REDITdn editing used donor DNAs with 200-bp HAs on each side and achieved up to over 5% efficiency for kb-scale gene-editing without selection compared with ⁇ 1% efficiency using non-REDIT methods.
  • REDIT improved knoek-in efficiencies in A549 (lung-derived), HepG2 (liver-derived), and HeLa (cervix- derived) cells, demonstrating up to ⁇ 15% kb-scale genomic knock-in without selection. This improvement was up to 4-fold higher than the Cas9 groups, supporting the potential of using REDIT methods in different cell types.
  • FIG. 33A A gene editing vector (60 gg) and template DNA (60 gg) were injected via hydrodynamic tail vein injection to deliver the components to the mouse. Successful gene editing of liver hepatocytes was monitored by transgene-encoded protein expression from the albumin locus.
  • FIG. 33B A schematic of the experimental procedure is shown in FIG. 33B.
  • LTC mice include three genome alleles: 1) Lkbl (flox/flox) allele allows Lkbl-KO when expressing Cre; 2) R26(LSL-TdTom) allele allows detection of AAV-transduced cells via TdTom red fluorescent protein; and 3) H11(LSL-Cas9) allele allows expression of Cas9 in AAV-transduced cells.
  • Schematics of the REDI gene editing vector and Cas9 control vectors are shown in FIG. 35 A.
  • successful gene editing using the gene editing vector leads to Kras alleles that drive tumor growth in the lung of the treated mice.
  • Pantoea brenneri RecE amino add sequence (SEQ ID NO:4):
  • Pantoea brenneri RecT amino add sequence (SEQ ID NO: 10):
  • PAAKRVKLD biSV40 NLS amino add sequence (SEQ ID NO: 19): KRTAD GSEFE SPKKKRKV
  • Template DNA sequences (underlining marks the replaced or inserter editing sequences)
  • VEGFA IIDR template sequence (SEQ ID NO:80):
  • HSP90AA1 HDR template sequence (SEQ lit NO:82):
  • OCT4 HDR template sequence (SEQ ID NO: 84):
  • Pantoea stewartii RecT DNA (SEQ ID NO; 85):
  • Pantoea stewartii RecE DNA SEQ ID NO:86:
  • Pantoea brenneri Red DNA SEQ ID NO:87:
  • Pantoea brenneri RecE DNA SEQ ID NO:88:
  • Pantoea dispersa Red DNA (5EQ ID NO:89):
  • Pantoea dispersa RecE DNA SEQ ID NO:90:
  • Type-F symbiont of Plautia stali RecE DNA (5EQ ID NO:92):
  • Shigella sonnei RecE DNA (SEQ ID NO: 102): GATCGCGGCCTGCTGACAAAGGAGTGGAGGAAGGGAAACCGGGTGAGCCGGATCACCAGG
  • Salmonella enteriea RecT DNA SEQ ID NO: 103:
  • Salmonella enterica RecE DNA SEQ ID NO: 1044:
  • Acetobacter RecT DNA SEQ ID NO: 1057
  • Acetobacter RecE DNA SEQ ID NO: 1036:
  • Salmonella enterica subsp. enteriea serovar Javiana str. 10721 RecT DNA SEQ ID NO: 107):
  • Salmonella enteriea subsp. enterica serovar Javiana str. 10721 RecE DNA SEQ ID NO: 108
  • Photobacterium sp. JCM 19050 RecT DNA (SEQ ID NOrlll): AACACCGACATGATCGCCATGCCCCCTTCTCCAGCCATCAGCATGCTGGACACAAGCAAGCT
  • Pantoea stewartii RecT Protein 8EQ ID NO:115:
  • Pantoea dispersa RecE Protein (SEQ ID NO:120): MEPGIYYDISNEAYHSGPGISKSQLDDIARSPAIFQWRKDAPVDTEKTKALDLGTDFHCAVLEPER FADMYRVGPEVNRRTTAGKAEEKEFFEKCEKDGAVPITHDDARKVELMRGSVMAHPIAKQMIA AQGHAEASIYWHDESTGNLCRCRPDKFIPDWNWIVDVKTTADMKKFRREFYDLRYHVQDAFYT DGY A AQFGERPTF VF V VTSTTIDCGRYPTE YFFLDEETKAAGRSE Y QSNLVT Y SECLSRNEWPGI ATLSLPHWAKELRNV
  • Type-F symbiont of Plautia stall RecE Protein (SEQ ID NO: 122):
  • Salmonella enterica RecT Protein SEQ ID NO: 1383:
  • Salmonella enterica RecE Protein SEQ ID NO: 1344:

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Saccharide Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/US2021/020513 2020-03-03 2021-03-02 Rna-guided genome recombineering at kilobase scale Ceased WO2021178432A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
EP21764351.9A EP4114845A4 (en) 2020-03-03 2021-03-02 Rna-guided genome recombineering at kilobase scale
CA3173526A CA3173526A1 (en) 2020-03-03 2021-03-02 Rna-guided genome recombineering at kilobase scale
IL296057A IL296057A (en) 2020-03-03 2021-03-02 Ribonucleic acid-guided genome recombination engineering at the scale of thousands of bases
AU2021231769A AU2021231769A1 (en) 2020-03-03 2021-03-02 RNA-guided genome recombineering at kilobase scale
MX2022010835A MX2022010835A (es) 2020-03-03 2021-03-02 Recombinacion del genoma guiada por arn en escala de kilobase.
JP2022552549A JP2023515670A (ja) 2020-03-03 2021-03-02 キロ塩基スケールでのrnaガイドゲノムリコンビニアリング
KR1020227033540A KR20220151175A (ko) 2020-03-03 2021-03-02 킬로베이스 스케일에서 rna-가이드된 게놈 재조합
BR112022017196A BR112022017196A2 (pt) 2020-03-03 2021-03-02 Recombinação genômica guiada por rna na escala de kilobase
US17/905,457 US20230091242A1 (en) 2020-03-03 2021-03-02 Rna-guided genome recombineering at kilobase scale
CN202180033011.8A CN115667283A (zh) 2020-03-03 2021-03-02 Rna指导的千碱基规模基因组重组工程

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202062984618P 2020-03-03 2020-03-03
US62/984,618 2020-03-03
US202163146447P 2021-02-05 2021-02-05
US63/146,447 2021-02-05

Publications (2)

Publication Number Publication Date
WO2021178432A1 true WO2021178432A1 (en) 2021-09-10
WO2021178432A9 WO2021178432A9 (en) 2021-10-28

Family

ID=77614129

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/020513 Ceased WO2021178432A1 (en) 2020-03-03 2021-03-02 Rna-guided genome recombineering at kilobase scale

Country Status (11)

Country Link
US (1) US20230091242A1 (cg-RX-API-DMAC7.html)
EP (1) EP4114845A4 (cg-RX-API-DMAC7.html)
JP (1) JP2023515670A (cg-RX-API-DMAC7.html)
KR (1) KR20220151175A (cg-RX-API-DMAC7.html)
CN (1) CN115667283A (cg-RX-API-DMAC7.html)
AU (1) AU2021231769A1 (cg-RX-API-DMAC7.html)
BR (1) BR112022017196A2 (cg-RX-API-DMAC7.html)
CA (1) CA3173526A1 (cg-RX-API-DMAC7.html)
IL (1) IL296057A (cg-RX-API-DMAC7.html)
MX (1) MX2022010835A (cg-RX-API-DMAC7.html)
WO (1) WO2021178432A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023034925A1 (en) * 2021-09-01 2023-03-09 The Board Of Trustees Of The Leland Stanford Junior University Rna-guided genome recombineering at kilobase scale
WO2023154892A1 (en) * 2022-02-10 2023-08-17 Possible Medicines Llc Rna-guided genome recombineering at kilobase scale
WO2024168253A1 (en) * 2023-02-10 2024-08-15 Possible Medicines Llc Delivery of an rna guided recombination system
WO2024168265A1 (en) * 2023-02-10 2024-08-15 Possible Medicines Llc Aav delivery of rna guided recombination system
EP4476333A4 (en) * 2022-02-10 2026-02-25 Univ Leland Stanford Junior KILOBASE-SIZED RNA-GUIDED GENOME RECOMBINATION

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN120555441B (zh) * 2025-05-29 2026-04-17 西北农林科技大学 基于CtIP蛋白提高CRISPR/Cas9介导的外源基因整合效率的DNA适配体及其应用

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160319260A1 (en) * 2015-03-03 2016-11-03 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with Altered PAM Specificity
US20180312824A1 (en) * 2015-06-18 2018-11-01 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation
US20180327784A1 (en) * 2015-07-15 2018-11-15 Rutgers, The State University Of New Jersey Nuclease-Independent Targeted Gene Editing Platform and Uses Thereof
WO2019089910A1 (en) * 2017-11-01 2019-05-09 Ohio State Innovation Foundation Highly compact cas9-based transcriptional regulators for in vivo gene regulation
US20190185883A1 (en) * 2014-07-30 2019-06-20 President And Fellows Of Harvard College Cas9 proteins including ligand-dependent inteins
WO2019123014A1 (en) * 2017-12-22 2019-06-27 G+Flas Life Sciences Chimeric genome engineering molecules and methods

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6509156B1 (en) * 1997-12-05 2003-01-21 Europaisches Laboratorium Fur Molekularoiologie (Embl) DNA cloning method relying on the E. coli recE/recT recombination system
US9322037B2 (en) * 2013-09-06 2016-04-26 President And Fellows Of Harvard College Cas9-FokI fusion proteins and uses thereof
MX2024002482A (es) * 2021-09-01 2024-09-19 Univ Leland Stanford Junior Recombinacion del genoma guiada por arn en escala de kilobase.

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190185883A1 (en) * 2014-07-30 2019-06-20 President And Fellows Of Harvard College Cas9 proteins including ligand-dependent inteins
US20160319260A1 (en) * 2015-03-03 2016-11-03 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases with Altered PAM Specificity
US20180312824A1 (en) * 2015-06-18 2018-11-01 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation
US20180327784A1 (en) * 2015-07-15 2018-11-15 Rutgers, The State University Of New Jersey Nuclease-Independent Targeted Gene Editing Platform and Uses Thereof
WO2019089910A1 (en) * 2017-11-01 2019-05-09 Ohio State Innovation Foundation Highly compact cas9-based transcriptional regulators for in vivo gene regulation
WO2019123014A1 (en) * 2017-12-22 2019-06-27 G+Flas Life Sciences Chimeric genome engineering molecules and methods

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
HUANG ET AL.: "Development of a RecE/T-Assisted CRISPR-Cas9 Toolbox for Lactobacillus", BIOTECHNOL J, vol. 14, e1800690, 20 May 2019 (2019-05-20), pages 1 - 12, XP055856041 *
See also references of EP4114845A4 *
ZHOU ET AL.: "CRISPR/Cas9-Assisted Seamless Genome Editing in Lactobacillus plantarum and Its Application in N-Acetylglucosamine Production", APPL ENVIRON MICROBIOL, vol. 85, 16 October 2019 (2019-10-16), pages 1 - 11, XP055856038 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023034925A1 (en) * 2021-09-01 2023-03-09 The Board Of Trustees Of The Leland Stanford Junior University Rna-guided genome recombineering at kilobase scale
WO2023154892A1 (en) * 2022-02-10 2023-08-17 Possible Medicines Llc Rna-guided genome recombineering at kilobase scale
EP4476333A4 (en) * 2022-02-10 2026-02-25 Univ Leland Stanford Junior KILOBASE-SIZED RNA-GUIDED GENOME RECOMBINATION
WO2024168253A1 (en) * 2023-02-10 2024-08-15 Possible Medicines Llc Delivery of an rna guided recombination system
WO2024168265A1 (en) * 2023-02-10 2024-08-15 Possible Medicines Llc Aav delivery of rna guided recombination system

Also Published As

Publication number Publication date
AU2021231769A1 (en) 2022-09-29
BR112022017196A2 (pt) 2022-10-25
WO2021178432A9 (en) 2021-10-28
EP4114845A1 (en) 2023-01-11
CA3173526A1 (en) 2021-09-10
EP4114845A4 (en) 2024-03-06
US20230091242A1 (en) 2023-03-23
KR20220151175A (ko) 2022-11-14
JP2023515670A (ja) 2023-04-13
MX2022010835A (es) 2022-09-29
IL296057A (en) 2022-10-01
CN115667283A (zh) 2023-01-31

Similar Documents

Publication Publication Date Title
JP7605852B2 (ja) クラスiiのv型crispr系
EP4114845A1 (en) Rna-guided genome recombineering at kilobase scale
US11795442B2 (en) CRISPR DNA targeting enzymes and systems
KR102839528B1 (ko) 연장된 단일 가이드 rna 및 그 용도
CN113831407B (zh) 用于使用多个引导rna来破坏免疫耐受性的方法
US20230265404A1 (en) Engineered mad7 directed endonuclease
JP2024543042A (ja) セリンリコンビナーゼ
KR20240110603A (ko) 엔도뉴클레아제 시스템
WO2023154892A1 (en) Rna-guided genome recombineering at kilobase scale
US20190218533A1 (en) Genome-Scale Engineering of Cells with Single Nucleotide Precision
JP2024501892A (ja) 新規の核酸誘導型ヌクレアーゼ
WO2024044329A1 (en) Crispr base editor
JP2025502107A (ja) Cas12aエンドヌクレアーゼ変異体および使用方法
US20250059568A1 (en) Class ii, type v crispr systems
WO2025235388A1 (en) Transgene genomic identification by nuclease-mediated long read sequencing
HK40115229A (zh) 使用来自螟蛾属的转座酶将核酸构建体转座入真核基因组
HK40038501B (zh) 使用来自青鱂属的转座酶将核酸构建体整合入真核细胞
HK40021189A (en) Method for manufacturing dna-edited eukaryotic cell, and kit used in method

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21764351

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3173526

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022552549

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022017196

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20227033540

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021231769

Country of ref document: AU

Date of ref document: 20210302

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021764351

Country of ref document: EP

Effective date: 20221004

ENP Entry into the national phase

Ref document number: 112022017196

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220826

WWW Wipo information: withdrawn in national office

Ref document number: 2022125449

Country of ref document: RU