WO2021171257A1 - Anti-axl antibodies and compositions - Google Patents
Anti-axl antibodies and compositions Download PDFInfo
- Publication number
- WO2021171257A1 WO2021171257A1 PCT/IB2021/051636 IB2021051636W WO2021171257A1 WO 2021171257 A1 WO2021171257 A1 WO 2021171257A1 IB 2021051636 W IB2021051636 W IB 2021051636W WO 2021171257 A1 WO2021171257 A1 WO 2021171257A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- nos
- antibody
- axl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- AXL also known as UFO, JTK11, Tyro7, or ARK
- UFO myeloid cells
- JTK11 is expressed on subsets of myeloid cells including macrophages and dendritic cells and is a member of the TAM (Tyro3-Axl-Mer) family of receptor tyrosine kinases (RTKs).
- TAM RTKs are phosphatidylserine-sensing receptors involved in uptake of apoptotic cells by phagocytic cells. These kinases are important for maintaining homeostasis of tissues and organs subject to continuous challenge and cellular turnover.
- the ligand for AXL is Growth Arrest Specific 6 (GAS6), which functions as a linker between phosphatidylserine on apoptotic cells and AXL and facilitates uptake of cellular debris in a process known as efferocytosis.
- GAS6 Growth Arrest Specific 6
- AXL-mediated efferocytosis has been shown to enter AXL- expressing cells into an immune-suppressive state with decreased ability to present antigens to T cells and to produce pro-inflammatory cytokines.
- GAS6-induced activation AXL provides a strong survival signal to tumor cells through the PI3K/AKT signaling pathway. Elevated expression of GAS6 and AXL is correlated with poor prognosis in cancer patients.
- the present invention is directed to novel recombinant antibodies targeting AXL, as well as pharmaceutical compositions comprising one or more of these antibodies, and use of the antibodies and pharmaceutical compositions for treatment of cancer.
- the antibodies and compositions described herein may be used in a method for treating cancer in a patient; may be used for the manufacture of a medicament for treating cancer in a patient; or may be for use in treating cancer in a patient. Compared to currently available treatments for such cancers, including antibody treatments, it is contemplated that the antibodies and compositions described herein may provide a superior clinical response either alone or in combination with another cancer therapeutic.
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof that competes or cross-competes for binding with or binds to the same epitope of human AXL as antibody 23203_1 , 23203_2, 23203_3, 23203_4, 22995, or 22883.
- the anti- AXL antibody or antigen-binding portion is defined by the amino acid sequences of the six CDRs, heavy and light chain variable domains, or heavy and light chains of said antibody.
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof, wherein a) the heavy chain of said antibody comprises: i) heavy chain complementarity determining regions (H-CDR)-1-3 comprising the amino acid sequences of SEQ ID NOs: 5-7, respectively; ii) a heavy chain variable domain (VH) comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 3; iii) a VH comprising the amino acid sequence of SEQ ID NO: 3; or iv) a heavy chain (HC) comprising the amino acid sequences of SEQ ID NOs: 3 and 61; and b) the light chain of said antibody comprises: i) light chain complementarity determining regions (L-CDR)-1-3 comprising the amino acid sequences of SEQ ID NOs: 8-10, respectively; ii) a light chain variable domain (VL) comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof, wherein a) the heavy chain of said antibody comprises: i) H-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 15- 17, respectively; ii) a VH comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 13; iii) a VH comprising the amino acid sequence of SEQ ID NO: 13; or iv) an HC comprising the amino acid sequences of SEQ ID NOs: 13 and 61; and b) the light chain of said antibody comprises: i) L-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 18- 20, respectively; ii) a VL comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 14; iii) a VL comprising the amino acid sequence of SEQ ID NO: 14; or iv) an LC comprising
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof, wherein a) the heavy chain of said antibody comprises: i) H-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 25- 27, respectively; ii) a VH comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 23; iii) a VH comprising the amino acid sequence of SEQ ID NO: 23; or iv) an HC comprising the amino acid sequences of SEQ ID NOs: 23 and 61; and b) the light chain of said antibody comprises: i) L-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 28- 30, respectively; ii) a VL comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 24; iii) a VL comprising the amino acid sequence of SEQ ID NO: 24; or iv) an LC comprising
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof, wherein a) the heavy chain of said antibody comprises: i) H-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 35- 37, respectively; ii) a VH comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 33; iii) a VH comprising the amino acid sequence of SEQ ID NO: 33; or iv) an HC comprising the amino acid sequences of SEQ ID NOs: 33 and
- the light chain of said antibody comprises: i) L-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 38- 40, respectively; ii) a VL comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 34; iii) a VL comprising the amino acid sequence of SEQ ID NO: 34; or iv) an LC comprising the amino acid sequences of SEQ ID NOs: 34 and
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof, wherein a) the heavy chain of said antibody comprises: i) H-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 45- 47, respectively; ii) a VH comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 43; iii) a VH comprising the amino acid sequence of SEQ ID NO: 43; or iv) an HC comprising the amino acid sequences of SEQ ID NOs: 43 and 61; and b) the light chain of said antibody comprises: i) L-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 48- 50, respectively; ii) a VL comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 44; iii) a VL comprising the amino acid sequence of SEQ ID NO: 44; or iv) an
- the present disclosure provides an anti-AXL antibody or an antigen-binding portion thereof, wherein a) the heavy chain of said antibody comprises: i) H-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 55- 57, respectively; ii) a VH comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 53; iii) a VH comprising the amino acid sequence of SEQ ID NO: 53; or iv) an HC comprising the amino acid sequences of SEQ ID NOs: 53 and 61; and b) the light chain of said antibody comprises: i) L-CDR-1-3 comprising the amino acid sequences of SEQ ID NOs: 58- 60, respectively; ii) a VL comprising an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 54; iii) a VL comprising the amino acid sequence of SEQ ID NO: 54; or iv)
- the present disclosure also provides isolated nucleic acid molecules, vectors, and host cells comprising nucleotide sequences that encode the heavy chain or an antigen-binding portion thereof, the light chain or an antigen-binding portion thereof, or both, of an anti-AXL antibody or antigen-binding portion described herein. Further, the present disclosure provides methods for producing an anti-AXL antibody or antigen-binding portion described herein by culturing said host cells, as well as methods for producing an antibody composition by admixing antibodies or antigen-binding portions described herein.
- FIG. 2 is a graph showing the proliferation of H1299 cells after treatment with anti-AXL antibodies. Boxed antibodies were selected for further characterization. Data were normalized to untreated controls (no GAS6), with proliferative response in the presence of GAS6 on the X axis and proliferative response in the absence of GAS6 on the Y axis. Dotted horizontal and vertical lines signify proliferation levels upon GAS6 addition as compared to controls without GAS6, normalized for each setup (+ or - GAS6) separately. Each datapoint represents the mean of three technical replicates for each axis.
- FIG. 4 is a graph showing the GAS6-induced uptake of liposomes by MDA- MB-468-AXL cells treated with the indicated antibodies. Data are normalized to GAS6-treated controls (dotted line) and presented as mean ⁇ SEM. Each datapoint represents the mean of three technical replicates.
- FIGS. 5A and 5B are a pair of graphs showing the effect of two AXL antibodies (22995 and 23203_2) or vehicle treatment on tumor growth in NOD.Scid mice engrafted with human breast cancer MDA-MB-231 cells. The grey area denotes the treatment period. Data are presented as mean ⁇ SEM. **** P ⁇ 0.0001.
- FIG. 6 is a table depicting cross-competition results for the indicated antibodies and the AXL ligand, GAS6, tested in a classical sandwich assay by SPR. Data were normalized to correct for differences in recombinant AXL-ECD binding capacities for each antibody on the surface. Sandwiching antibodies are shown as white and blocking antibodies are shown as grey.
- FIG. 7 is a table depicting Bio-Layer Interferometry (BLI) responses (nm) for binding of the indicated antibodies to captured human/mouse chimeric proteins, normalized to antibody binding to full-length human AXL-ECD for each antibody.
- BLI Bio-Layer Interferometry
- the mouse AXL sequence (“MoAXL”) was exchanged for human AXL sequence for domain Ig1, Ig2, Fn1, or Fn2 (“Hulgl,” “Hulg2,” “HuFnl,” and “HuFn2,” marked in bold). Grey color represents no binding response; negative responses are due to a slight dissociation of captured antigen from the Penta-His surface. Data are from one representative experiment.
- AXL refers to human AXL.
- a human AXL polypeptide sequence is available under UniProt Accession No. P30530 (UFO_HUMAN) (SEQ ID NO: 63), as shown below:
- antibody refers to a tetramer comprising two heavy (H) chains (about 50-70 kDa) and two light (L) chains (about 25 kDa) inter-connected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable domain (VH) and a heavy chain constant region (CH).
- Each light chain is composed of a light chain variable domain (VL) and a light chain constant region (CL).
- VH and VL domains can be subdivided further into regions of hypervariability, termed “complementarity determining regions” (CDRs), interspersed with regions that are more conserved, termed “framework regions” (FRs).
- CDRs complementarity determining regions
- FRs frame regions
- Each VH and VL is composed of three CDRs (H-CDR herein designates a CDR from the heavy chain; and L-CDR herein designates a CDR from the light chain) and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the assignment of amino acid numbers, and of FR and CDR regions, in the heavy or light chain may be in accordance with IMGT ® definitions (Eu numbering; Lefranc et al., Dev Comp Immunol 27(1):55-77 (2003)); or the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, MD (1987 and 1991)); Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987); Chothia et al., Nature 342:878-883 (1989); MacCallum et al., J. Mol. Biol. 262:732-745 (1996); or Honegger and Pluckthun, J. Mol. Biol. 309(3):657-70 (2001).
- the term “recombinant antibody” refers to an antibody that is expressed from a cell or cell line comprising the nucleotide sequence(s) that encode the antibody, wherein said nucleotide sequence(s) are not naturally associated with the cell.
- isolated protein refers to a protein, polypeptide or antibody that by virtue of its origin or source of derivation (1) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and/or (4) does not occur in nature.
- a polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
- a protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art.
- affinity refers to a measure of the attraction between an antigen and an antibody.
- the intrinsic attractiveness of the antibody for the antigen is typically expressed as the binding affinity equilibrium constant (KD) of a particular antibody-antigen interaction.
- KD binding affinity equilibrium constant
- An antibody is said to specifically bind to an antigen when the KD is £ 1 mM, e.g., £ mM, £ 100 nM, or £ 10 nM.
- a KD binding affinity constant can be measured, e.g., by surface plasmon resonance (e.g., BIAcoreTM) using the IBIS MX96 SPR system from IBIS Technologies or the Carterra LSA SPR platform, or by Bio-Layer Interferometry, for example using the OctetTM system from ForteBio.
- surface plasmon resonance e.g., BIAcoreTM
- IBIS MX96 SPR system from IBIS Technologies or the Carterra LSA SPR platform
- Bio-Layer Interferometry for example using the OctetTM system from ForteBio.
- epitope refers to a portion (determinant) of an antigen that specifically binds to an antibody or a related molecule such as a bi specific binding molecule.
- Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally have specific three-dimensional structural characteristics, as well as specific charge characteristics.
- An epitope may be “linear” or “conformational.” In a linear epitope, all of the points of interaction between a protein (e.g., an antigen) and an interacting molecule (such as an antibody) occur linearly along the primary amino acid sequence of the protein.
- an antibody to a linear epitope may be generated, e.g., by immunizing an animal with a peptide having the amino acid residues of the linear epitope.
- An antibody to a conformational epitope may be generated, e.g., by immunizing an animal with a mini-domain containing the relevant amino acid residues of the conformational epitope.
- An antibody to a particular epitope can also be generated, e.g., by immunizing an animal with the target molecule of interest (e.g., AXL) or a relevant portion thereof, then screening for binding to the epitope.
- the target molecule of interest e.g., AXL
- test antibody if the test antibody is not able to bind to AXL at the same time, then the test antibody binds to the same epitope, an overlapping epitope, or an epitope that is in close proximity to the epitope bound by the anti-AXL antibody of the present disclosure.
- This experiment can be performed using, e.g., ELISA, RIA, BIACORETM, SPR, Bio-Layer Interferometry or flow cytometry.
- Such cross-competition experiments may be performed, e.g., using an IBIS MX96 or Carterra LSA SPR instrument or the OctetTM system.
- human antibody refers to an antibody in which the variable domain and constant region sequences are derived from human sequences.
- the term encompasses antibodies with sequences that are derived from human genes but have been modified, e.g., to decrease immunogenicity, increase affinity, and/or increase stability. Further, the term encompasses antibodies produced recombinantly in nonhuman cells, which may impart glycosylation not typical of human cells.
- the term also encompasses antibodies produced in transgenic nonhuman organisms with human antibody genes (e.g., OmniRat ® rats).
- antibody portion refers to one or more portions or fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human AXL, or a portion thereof). It has been shown that certain fragments of a full-length antibody can perform the antigen-binding function of the antibody.
- binding fragments encompassed within the term “antigen-binding portion” include (i) a Fab fragment: a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment: a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment, which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) capable of specifically binding to an antigen.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
- the two domains of the Fv fragment, VL and VH are encoded by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH domains pair to form monovalent molecules (known as single chain Fv (scFv)).
- antigen-binding molecules comprising a VH and/or a VL.
- the molecule may also comprise one or more of a CH1, hinge, CH2, or CH3 region.
- Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
- Other forms of single chain antibodies, such as diabodies, are also encompassed.
- Diabodies are bivalent, bi-specific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen- binding sites.
- Antibody portions such as Fab and F(ab')2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion of whole antibodies. Moreover, antibodies, antibody portions and immunoadhesin molecules can be obtained using standard recombinant DNA techniques, e.g., as described herein.
- the class (isotype) and subclass of anti-AXL antibodies may be determined by any method known in the art.
- the class and subclass of an antibody may be determined using antibodies that are specific for a particular class and subclass of antibody. Such antibodies are available commercially.
- the class and subclass can be determined by ELISA or Western blot as well as other techniques.
- the class and subclass may be determined by sequencing all or a portion of the constant region of the heavy and/or light chains of the antibodies, comparing their amino acid sequences to the known amino acid sequences of various classes and subclasses of immunoglobulins, and determining the class and subclass of the antibodies.
- the present disclosure provides antibodies directed against AXL, and antigen-binding portions thereof.
- the antibodies disclosed herein are human antibodies generated from transgenic animals (e.g., rats) that are able to produce antibodies encoded by rearranged human antibody genes.
- the human antibodies may contain certain mutations, e.g., to change primer-derived mutations back to the germline sequence (see, e.g., the “Symplex-corrected” variant sequences in Table 1).
- the anti-AXL antibodies of the present disclosure have the “LALA” mutations (L234A/L235A) in the Fc region. These mutations hinder the antibodies’ binding to human FcyR (Fc gamma receptors). Such antibodies are advantageous because they have a low level of secondary effector functions and hence do not deplete effector T cells or target other non-malignant cells.
- the anti-AXL antibody or antigen-binding portion competes or cross-competes for binding to human AXL with, or binds to the same epitope of human AXL as, an antibody comprising: a) a heavy chain (HC) comprising the amino acid sequences of SEQ ID NOs: 3 and 61 and a light chain (LC) comprising the amino acid sequences of SEQ ID NOs: 4 and 62; b) an HC comprising the amino acid sequences of SEQ ID NOs: 13 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 14 and 62; c) an HC comprising the amino acid sequences of SEQ ID NOs: 23 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 24 and 62; d) an HC comprising the amino acid sequences of SEQ ID NOs: 33 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 34 and
- the anti-AXL antibody or antigen-binding portion has a heavy chain CDR3 (H-CDR3) amino acid sequence of SEQ ID NO: 7, 17, 27, 37, 47, or 57.
- the anti-AXL antibody or antigen-binding portion has heavy chain CDR1-3 (H-CDR1-3) comprising the amino acid sequences of SEQ ID NOs: 5-7, 15-17, 25-27, 35-37, 45-47, or 55-57, respectively.
- H-CDR1-3 heavy chain CDR1-3
- the anti-AXL antibody or antigen-binding portion has a heavy chain variable domain (VH) amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 3, 13, 23, 33, 43, or 53.
- VH heavy chain variable domain
- the anti-AXL antibody or antigen-binding portion has a VH comprising the amino acid sequence of SEQ ID NO: 3, 13, 23, 33, 43, or 53.
- the anti-AXL antibody has a VH amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 3, 13, 23, 33, 43, or 53; and a heavy chain constant region amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 61.
- the anti-AXL antibody comprises a VH amino acid sequence of SEQ ID NO: 3, 13, 23, 33, 43, or 53 and a heavy chain constant region amino acid sequence of SEQ ID NO: 61.
- the anti-AXL antibody or antigen-binding portion has a light chain CDR3 (L-CDR3) amino acid sequence of SEQ ID NO: 10, 20, 30, 40,
- the anti-AXL antibody or antigen-binding portion has light chain CDR1-3 (L-CDR1-3) comprising the amino acid sequences of SEQ ID NOs: 8-10, 18-20, 28-30, 38-40, 48-50, or 58-60, respectively.
- the anti-AXL antibody or antigen-binding portion has a light chain variable domain (VL) amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 4, 14, 24, 34, 44, or 54.
- VL light chain variable domain
- the anti-AXL antibody or antigen-binding portion has a VL comprising the amino acid sequence of SEQ ID NO: 4, 14, 24, 34, 44, or 54.
- the anti-AXL antibody has a VL amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 4, 14, 24, 34, 44, or 54; and a light chain constant region amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 62.
- the anti-AXL antibody comprises a VL amino acid sequence of SEQ ID NO: 4, 14, 24, 34, 44, or 54 and a light chain constant region amino acid sequence of SEQ ID NO: 62.
- the anti-AXL antibody comprises any one of the above-described heavy chains and any one of the above-described light chains.
- the anti-AXL antibody or antigen-binding portion of the present disclosure comprises the H-CDR1-3 and L-CDR1-3 amino acid sequences of: a) SEQ ID NOs: 5-10, respectively; b) SEQ ID NOs: 15-20, respectively; c) SEQ ID NOs: 25-30, respectively; d) SEQ ID NOs: 35-40, respectively; e) SEQ ID NOs: 45-50, respectively; or f) SEQ ID NOs: 55-60, respectively.
- the anti-AXL antibody or antigen-binding portion of the present disclosure comprises a VH and a VL that are 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical (e.g., 90% identical) to the amino acid sequences of: a) SEQ ID NOs: 3 and 4, respectively; b) SEQ ID NOs: 13 and 14, respectively; c) SEQ ID NOs: 23 and 24, respectively; d) SEQ ID NOs: 33 and 34, respectively; e) SEQ ID NOs: 43 and 44, respectively; or f) SEQ ID NOs: 53 and 54, respectively.
- the anti-AXL antibody or antigen-binding portion of the present disclosure comprises a VH and a VL that comprise the amino acid sequences of: a) SEQ ID NOs: 3 and 4, respectively; b) SEQ ID NOs: 13 and 14, respectively; c) SEQ ID NOs: 23 and 24, respectively; d) SEQ ID NOs: 33 and 34, respectively; e) SEQ ID NOs: 43 and 44, respectively; or f) SEQ ID NOs: 53 and 54, respectively.
- the anti-AXL antibody of the present disclosure comprises: a) an HC comprising the amino acid sequences of SEQ ID NOs: 3 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 4 and 62; b) an HC comprising the amino acid sequences of SEQ ID NOs: 13 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 14 and 62; c) an HC comprising the amino acid sequences of SEQ ID NOs: 23 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 24 and 62; d) an HC comprising the amino acid sequences of SEQ ID NOs: 33 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 34 and 62; e) an HC comprising the amino acid sequences of SEQ ID NOs: 43 and 61 and an LC comprising the amino acid sequences of SEQ ID NOs: 44 and
- the present disclosure also provides an anti-AXL antibody or an antigen- binding portion thereof that competes or cross-competes for binding with, or binds to the same epitope as, antibody 23203_1, 23203_2, 23203_3, 23203_4, 22995, or 22883.
- the anti-AXL antibody or antigen-binding portion of the present disclosure comprises the H-CDR1-3 and L-CDR1-3 amino acid sequences of antibody 23203_1, 23203_2, 23203_3, 23203_4, 22995, or 22883.
- the anti-AXL antibody or antigen-binding portion of the present disclosure comprises a VH and a VL that are at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical in amino acid sequence to the VH and VL, respectively, of antibody 23203_1, 23203_2, 23203_3, 23203_4, 22995, or 22883.
- the anti-AXL antibody or antigen-binding portion of the present disclosure comprises a VH and a VL that are the VH and VL, respectively, of antibody 23203_1 , 23203_2, 23203_3, 23203_4, 22995, or 22883.
- the anti-AXL antibody of the present disclosure is antibody 23203_1, 23203_2, 23203_3, 23203_4, 22995, or 22883, or an antibody with the same amino acid sequences as said antibody.
- said H-CDR3 may be replaced by a variant H-CDR3 where the serine (S) residue in position 2 in sequence CSSREYSSRWHFDYW (SEQ ID NO: 7) is replaced by an alanine (A), so that the H-CDR3 sequence is CASREYSSRWHFDYW (SEQ ID NO:
- H-FR3 may be replaced by a variant H-FR3 where the aspartate (D) residue in position 32 in sequence NYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYY (SEQ ID NO:
- H-FR3 sequence is NYNPSLKSRVTISVDTSKNQFSLKLSSVTAAGTAVYY (SEQ ID NO: 67).
- the variant residue is shown in bold/underlined.
- said sequence may be replaced by any human IGKV/IGKJ germline sequence.
- the replacement sequence may have L-CDR1, L-CDR2 and L-CDR3 of SEQ ID NOs: 48, 49, and 50, respectively, that are grafted into any human IGKV/IGKJ sequence, thereby replacing the original germline sequence.
- the class of an anti-AXL antibody obtained by the methods described herein may be changed or switched with another class or subclass.
- a nucleic acid molecule encoding VL or VH is isolated using methods well known in the art such that it does not include nucleic acid sequences encoding CL or CH, respectively.
- the nucleic acid molecules encoding VL or VH then are operatively linked to a nucleic acid sequence encoding a CL or CH, respectively, from a different class of immunoglobulin molecule. This may be achieved using a vector or nucleic acid molecule that comprises a CL or CH sequence, as described above.
- an anti-AXL antibody that was originally IgM may be class switched to IgG. Further, the class switching may be used to convert one IgG subclass to another, e.g., from IgGi to lgG2.
- a k light chain constant region can be changed, e.g., to a l light chain constant region, or vice- versa.
- An exemplary method for producing an antibody of the present disclosure with a desired Ig isotype comprises the steps of isolating a nucleic acid molecule encoding the heavy chain of an anti-AXL antibody and a nucleic acid molecule encoding the light chain of an anti-AXL antibody, obtaining the variable domain of the heavy chain, ligating a coding sequence for the variable domain of the heavy chain with a coding sequence for the constant region of a heavy chain of the desired isotype, expressing the light chain and the heavy chain encoded by the ligated sequence in a cell, and collecting the anti-AXL antibody with the desired isotype.
- the anti-AXL antibody of the present disclosure can be an IgG, an IgM, an IgE, an IgA, or an IgD molecule, but is typically of the IgG isotype, e.g., of IgG subclass IgGi, lgG2a or lgG2 b , lgG3 or IgG-t. In some embodiments, the antibody is of the isotype subclass IgGi.
- the anti-AXL antibody may comprise at least one mutation in the Fc region.
- a number of different Fc mutations are known, where these mutations alter the antibody’s effector function.
- the anti-AXL antibody comprises at least one mutation in the Fc region that reduces effector function, e.g., mutations at one or more of positions 228, 233, 234 and 235, where amino acid positions are numbered according to the IMGT ® numbering scheme.
- one or both of the amino acid residues at positions 234 and 235 may be mutated, for example from Leu to Ala (L234A/L235A). These mutations reduce effector function of the Fc region of IgGi antibodies.
- the amino acid positions are numbered according to the IMGT ® numbering scheme.
- the antibody may comprise the mutation S228P, where the amino acid position is numbered according to the IMGT ® numbering scheme. This mutation is known to reduce undesired Fab arm exchange.
- the anti-AXL antibody or antigen-binding portion binds to human AXL with a K D of about 5 x 10 s , 4 x 10 s , 3 x 10 s , 2 x 10 s , 1 x 10 s , 9 x 10- 9 , 8 x 10- 9 , 7 x 10- 9 , 6 x 10 9 , 5 x 10 9 , 4 x 10 9 , 3 x 10 9 , 2 x 10 9 , 1 x 10 9 , 9 x 10 10 , 8 x 10- 10 , 7 x 10- 10 , 6 x 10- 10 , or 5 x 10 10 M or less.
- the anti-AXL antibody or antigen-binding portion binds to cynomolgus AXL with a KD of about 9 x 10 s , 8 x 10 s , 7 x 10 s , 6 x 10 s , 5 x 10 s , 4 x 10 s , 3 x 10 s , 2 x 10 s , 1 x 10 s , 9 x 10 9 , 8 x 10 9 , 7 x 10 9 , 6 x 10 9 , or 5 x 10 9 or less.
- the anti-AXL antibody or antigen-binding portion inhibits proliferation of H1299 cells in vitro at a concentration of about 1, 5, 10, 15,
- GAS6 e.g., wherein the GAS6 is at a concentration of about 1 pg/mL.
- the anti-AXL antibody or antigen-binding portion does not exhibit agonistic activity, e.g., at a concentration of up to about 1, 5, 10, 15, 20, or 25 pg/mL, in the absence of GAS6.
- the anti-AXL antibody or antigen-binding portion inhibits GAS6-induced uptake of phosphatidylserine-containing liposomes, e.g., at a concentration of about 0.005, 0.01 , 0.05, 0.1 , 0.5, 1 , 2, 4, or 6 pg/mL or less, in MDA-MB-468-AXL cells stably expressing exogenous AXL.
- the anti-AXL antibody or antigen-binding portion inhibits tumor growth in vivo, e.g., at a concentration of about 10 mg/kg or 50 mg/kg. [0074] In some embodiments, the anti-AXL antibody or antigen-binding portion inhibits binding of GAS6 to human AXL.
- the anti-AXL antibody or antigen-binding portion recognizes a different epitope of human AXL than 10G5 and/or YW327.6S2.
- the anti-AXL antibody or antigen-binding portion does not bind to mouse AXL.
- the anti-AXL antibody or antigen-binding portion binds to the Ig1 domain of human AXL. In some embodiments, the anti-AXL antibody or antigen-binding portion binds to the Ig2 domain of human AXL.
- the present disclosure also contemplates an anti-AXL antibody or antigen binding portion described herein with any combination of the above properties.
- an anti-AXL antibody or antigen-binding portion described herein has at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, or all 9) of the following properties: a) binds to human AXL with a KD of 3 x 10 -8 M or less; b) binds to cynomolgus AXL with a KD of 8 x 10 -8 M or less; c) does not bind to mouse AXL; d) binds to the Ig1 or Ig2 domain of human AXL; e) inhibits binding of GAS6 to human AXL; f) inhibits proliferation of H1299 cells in vitro in the presence of GAS6 (e.g., wherein the anti-AXL antibody or antigen-binding portion is at a concentration of 25 pg/mL or less and the GAS6 is at a concentration of 1 pg/mL); g) does not exhibit agonistic activity in the absence
- the anti-AXL antibody or antigen-binding portion has at least properties a)-i). In certain embodiments, the anti-AXL antibody or antigen-binding portion has at least properties a)-e), and g)-i). In certain embodiments, the anti-AXL antibody or antigen-binding portion has at least properties a), b), e), g), and h). In certain embodiments, the anti-AXL antibody or antigen-binding portion has at least properties a)-e), g), and h). In certain embodiments, the anti-AXL antibody or antigen-binding portion has at least properties a)-e), g), and i).
- an anti-AXL antibody or antigen-binding portion described herein may inhibit tumor growth and/or induce tumor growth regression in vivo. In some embodiments, an anti-AXL antibody or antigen-binding portion described herein may slow down or reverse metastasis in a cancer patient. In some embodiments, an anti-AXL antibody or antigen-binding portion described herein may prolong survival of a cancer patient. Any combination of the above properties is also contemplated.
- an antibody or antigen-binding portion thereof of the present disclosure may be part of a larger immunoadhesin molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
- immunoadhesin molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov et al.
- CDRs from an antibody are incorporated into a molecule either covalently or noncovalently to make it an immunoadhesin that specifically binds to an antigen of interest.
- the CDR(s) may be incorporated as part of a larger polypeptide chain, may be covalently linked to another polypeptide chain, or may be incorporated noncovalently.
- a fusion antibody or immunoadhesin may be made that comprises all or a portion of an anti-AXL antibody of the present disclosure linked to another polypeptide.
- only the variable domains of the anti- AXL antibody are linked to the polypeptide.
- the VH domain of an anti-AXL antibody is linked to a first polypeptide, while the VL domain of an anti-AXL antibody is linked to a second polypeptide that associates with the first polypeptide in a manner such that the VH and VL domains can interact with one another to form an antigen-binding site.
- the VH domain is separated from the VL domain by a linker such that the VH and VL domains can interact with one another (e.g., single-chain antibodies).
- the VH-linker-VL antibody is then linked to the polypeptide of interest.
- fusion antibodies can be created in which two (or more) single-chain antibodies are linked to one another.
- the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly4 -Ser)3 (SEQ ID NO: 64), such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH domains joined by the flexible linker.
- a flexible linker e.g., encoding the amino acid sequence (Gly4 -Ser)3 (SEQ ID NO: 64)
- the single chain antibody may be monovalent, if only a single VH and VL are used; bivalent, if two VH and VL are used; or polyvalent, if more than two VH and VL are used. Bi-specific or polyvalent antibodies may be generated that bind specifically to human AXL and to another molecule, for instance.
- modified antibodies may be prepared using anti-AXL antibody-encoding nucleic acid molecules.
- “kappa bodies” III et al., Protein Eng. 10:949-57 (1997)
- “minibodies” Martin et al., EMBO J. 13:5303- 9 (1994)
- “diabodies” Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993)
- Janusins Traunecker et al., EMBO J. 10:3655-3659 (1991) and Traunecker et al., Int. J.
- An anti-AXL antibody or antigen-binding portion of the present disclosure can be derivatized or linked to another molecule (e.g., another peptide or protein).
- another molecule e.g., another peptide or protein.
- the antibodies or portions thereof are derivatized such that AXL binding is not affected adversely by the derivatization or labeling. Accordingly, the antibodies and antibody portions of the present disclosure are intended to include both intact and modified forms of the human anti-AXL antibodies described herein.
- an antibody or antibody portion of the present disclosure can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bi-specific antibody or a diabody), a detection agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- another antibody e.g., a bi-specific antibody or a diabody
- a detection agent e.g., a bi-specific antibody or a diabody
- a pharmaceutical agent e.g., a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavi
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- an appropriate spacer e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester
- homobifunctional e.g., disuccinimidyl suberate.
- linkers are available, e.g., from Pierce Chemical Company, Rockford, IL.
- An anti-AXL antibody or antigen-binding portion can also be derivatized with a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group. These groups may be useful to improve the biological characteristics of the antibody, e.g., to increase serum half-life.
- PEG polyethylene glycol
- an antibody or antigen-binding portion according to the present disclosure may also be labeled.
- the terms “label” or “labeled” refer to incorporation of another molecule in the antibody.
- the label is a detectable marker, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
- the label or marker can be therapeutic, e.g., a drug conjugate or toxin.
- labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3H, 14C, 15N, 35S, 90Y, 99Tc, 1111n, 1251, 1311), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, b-galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), magnetic agents such as gadolinium chelates, toxins such as pertussis toxin, taxol, cytofluorouracil, 5-fluorouracil, 5-fluorouracil, 5-fluorouraci
- the antibodies of the present disclosure may be present in a neutral form (including zwitterionic forms) or as a positively or negatively-charged species. In some embodiments, the antibodies may be complexed with a counterion to form a pharmaceutically acceptable salt.
- the present disclosure also provides a combination therapy (e.g., a composition) that comprises one, two, three, four, or more of the anti-AXL antibodies or antigen-binding portions thereof described herein.
- the combination therapy e.g., composition
- the combination therapy may take the form of, e.g., a method of treatment using said antibodies or antigen-binding portions or a pharmaceutical composition comprising said antibodies or antigen-binding portions.
- the present disclosure provides a composition comprising a first anti-AXL antibody or an antigen-binding portion thereof and a second anti-AXL antibody or an antigen-binding portion thereof, wherein the first and second antibodies are: antibodies 23203_1 and 23203_2, respectively; antibodies 23203_1 and 23203_3, respectively; antibodies 23203_1 and 23203_4, respectively; antibodies 23203_1 and 22995, respectively; antibodies 23203_1 and 22883, respectively; antibodies 23203_2 and 23203_3, respectively; antibodies 23203_2 and 23203_4, respectively; antibodies 23203_2 and 22995, respectively; antibodies 23203_2 and 22883, respectively; antibodies 23203_3 and 23203_4, respectively; antibodies 23203_3 and 22995, respectively; antibodies 23203_3 and 22883, respectively; antibodies 23203_4 and 22995, respectively; antibodies 23203_4 and 22883, respectively; or antibodies 22995 and 22883, respectively.
- the first and second antibodies are: antibodies 23203_1 and 23203_2, respectively; antibodies 23203_1 and
- the composition comprises antibodies or antigen binding portions thereof that bind to the same epitope as, or compete for binding with, said first and second antibodies.
- the composition comprises an antibody or an antigen-binding portion thereof that comprises the H-CDR1-3 and L-CDR1-3 amino acid sequences of said first antibody, and an antibody or an antigen-binding portion thereof that comprises the H-CDR1-3 and L-CDR1-3 amino acid sequences of said second antibody.
- the composition comprises an antibody or an antigen-binding portion thereof that comprises a VH and a VL with amino acid sequences that are at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the VH and VL amino acid sequences, respectively, of said first antibody, and an antibody or an antigen-binding portion thereof that comprises a VH and a VL with amino acid sequences that are at least 80%, 85%, 90%, 91%,
- the composition comprises an antibody or an antigen-binding portion thereof that comprises the VH and VL amino acid sequences of said first antibody, and an antibody or an antigen-binding portion thereof that comprises the VH and VL amino acid sequences of said second antibody.
- the composition comprises an antibody or an antigen-binding portion thereof that comprises the HC and LC amino acid sequences of said first antibody, and an antibody or an antigen-binding portion thereof that comprises the HC and LC amino acid sequences of said second antibody.
- said composition may comprise one, two, or more antibodies or antigen-binding portions thereof selected from the group consisting of: a) an antibody comprising H-CDR1-3 that comprise the amino acid sequences of SEQ ID NOs: 5-7, 15-17, 25-27, 35-37, 45-47, or 55-57, respectively; b) an antibody whose VH is at least 90% identical in sequence to the amino acid sequence of SEQ ID NO: 3, 13, 23, 33, 43, or 53; c) an antibody whose VH comprises the amino acid sequence of SEQ ID NO: 3,
- H-CDR1-3 and L-CDR1-3 comprise the amino acid sequences of SEQ ID NOs: 5-10, 15-20, 25-30, 35-40, 45-50, or 55-60, respectively; j) an antibody comprising VH and VL that comprise amino acid sequences at least 90% identical to the amino acid sequences of SEQ ID NOs: 3 and 4, 13 and 14, 23 and 24, 33 and 34, 43 and 44, or 53 and 54, respectively; k) an antibody comprising VH and VL that comprise the amino acid sequences of SEQ ID NOs: 3 and 4, 13 and 14, 23 and 24, 33 and 34, 43 and 44, or 53 and 54, respectively; and
- an antibody comprising HC and LC that comprise the amino acid sequences of 3 and 61, and 4 and 62; 13 and 61, and 14 and 62; 23 and 61, and 24 and 62; 33 and 61 , and 34 and 62; 43 and 61 , and 44 and 62; or 53 and 61 , and 54 and 62; respectively.
- an anti-AXL antibody composition described herein may inhibit tumor growth and/or induce tumor growth regression in vivo. In some embodiments, an anti-AXL antibody composition described herein may prolong survival of a cancer patient.
- the present disclosure also provides a method for producing an anti-AXL antibody composition described herein, comprising providing a first anti-AXL antibody or antigen-binding portion and a second anti-AXL antibody or antigen binding portion, and admixing the two antibodies or portions.
- the present disclosure also provides a bi-specific binding molecule having the binding specificity (e.g., comprising the antigen-binding portions, such as the six CDRs or the VH and VL) of an anti-AXL antibody described herein.
- the bi-specific binding molecule additionally has the binding specificity of another, distinct anti-AXL antibody (e.g., another anti-AXL antibody described herein) or an antibody that targets a different protein, such as a cancer antigen or another cell surface molecule whose activity mediates a disease condition such as cancer.
- Such bi-specific binding molecules are known in the art, and examples of different types of bi-specific binding molecules are given elsewhere herein.
- the present disclosure also provides nucleic acid molecules and sequences encoding anti-AXL antibodies or antigen-binding portions thereof described herein.
- different nucleic acid molecules encode the heavy chain and light chain amino acid sequences of the anti-AXL antibody or antigen-binding portion.
- the same nucleic acid molecule encodes the heavy chain and light chain amino acid sequences of the anti-AXL antibody or antigen-binding portion.
- a reference to a nucleotide sequence encompasses its complement unless otherwise specified.
- a reference to a nucleic acid having a particular sequence should be understood to encompass its complementary strand, with its complementary sequence.
- polynucleotide as referred to herein means a polymeric form of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide. The term includes single- and double-stranded forms.
- the present disclosure provides a nucleic acid molecule comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, or a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, or both, of an anti-AXL antibody or antigen-binding portion thereof described herein.
- nucleotide sequences that are at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to one or more nucleotide sequences recited herein, e.g., to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1 , 2, 11 , 12, 21 , 22, 31 , 32, 41 , 42, 51 , and 52, or to a nucleotide sequence encoding an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 4, 13, 14, 23, 24, 33, 34, 43, 44, 53, and 54.
- sequence identity in the context of nucleic acid sequences refers to the residues in two sequences that are the same when aligned for maximum correspondence.
- the length of sequence identity comparison may be over a stretch of at least about nine nucleotides, usually at least about 18 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32 nucleotides, and preferably at least about 36, 48 or more nucleotides.
- polynucleotide sequences can be compared using FASTA, Gap or Bestfit, which are programs in Wisconsin Package Version 10.0, Genetics Computer Group (GCG), Madison, Wsconsin.
- FASTA which includes, e.g., the programs FASTA2 and FASTA3, provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (see, e.g., Pearson, Methods Enzymol. 183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000); Pearson, Methods Enzymol. 266:227-258 (1996); and Pearson, J. Mol. Biol. 276:71-84 (1998); incorporated herein by reference).
- percent sequence identity between nucleic acid sequences can be determined using FASTA with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) or using Gap with its default parameters as provided in GCG Version 6.1, incorporated herein by reference.
- the present disclosure provides a nucleic acid molecule comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1, 2, 11, 12, 21, 22, 31, 32, 41, 42, 51, and 52.
- the nucleic acid molecule comprises the nucleotide sequences of SEQ ID NOs: 1 and 2, 11 and 12, 21 and 22, 31 and 32, 41 and 42, or 51 and 52.
- the nucleic acid molecules may be isolated. Nucleic acid molecules referred to herein as “isolated” or “purified” are nucleic acids which (1) have been separated away from the nucleic acids of the genomic DNA or cellular RNA of their source of origin; and/or (2) do not occur in nature.
- the present disclosure provides a vector suitable for expressing one or both of the chains of an antibody or antigen-binding portion thereof as described herein.
- the term “vector”, as used herein, means a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- the vector is a plasmid, i.e. , a circular double stranded piece of DNA into which additional DNA segments may be ligated.
- certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as “recombinant expression vectors” (or simply, “expression vectors”).
- the present disclosure provides vectors comprising nucleic acid molecules that encode the heavy chain, the light chain, or both the heavy and light chains of an anti-AXL antibody as described herein or an antigen-binding portion thereof.
- a vector of the present disclosure comprises a nucleic acid molecule described herein.
- the present disclosure further provides vectors comprising nucleic acid molecules encoding fusion proteins, modified antibodies, antibody fragments, and probes thereof.
- the vector may further comprise an expression control sequence.
- expression control sequence means polynucleotide sequences that are necessary to effect the expression and processing of coding sequences to which they are ligated.
- Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e. , Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
- control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence; in eukaryotes, generally, such control sequences include promoters and transcription termination sequence.
- control sequences is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
- a nucleic acid molecule as described herein comprises a nucleotide sequence encoding a VH domain from an anti-AXL antibody or antigen-binding portion as described herein joined in-frame to a nucleotide sequence encoding a heavy chain constant region from any source.
- a nucleic acid molecule as described herein can comprise a nucleotide sequence encoding a VL domain from an anti-AXL antibody or antigen-binding portion as described herein joined in-frame to a nucleotide sequence encoding a light chain constant region from any source.
- nucleic acid molecules encoding the VH and/or VL may be “converted” to full-length antibody genes.
- nucleic acid molecules encoding the VH or VL domains are converted to full-length antibody genes by insertion into an expression vector already encoding heavy chain constant (CH) or light chain constant (CL) regions, respectively, such that the VH segment is operatively linked to the CH seg ent(s) within the vector, and/or the VL segment is operatively linked to the CL segment within the vector.
- CH heavy chain constant
- CL light chain constant
- nucleic acid molecules encoding the VH and/or VL domains are converted into full-length antibody genes by linking, e.g., ligating, a nucleic acid molecule encoding a VH and/or VL domain to a nucleic acid molecule encoding a CH and/or CL region using standard molecular biological techniques. Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed from a cell into which they have been introduced and the anti-AXL antibody isolated.
- the framework region(s) are mutated so that the resulting framework region(s) have the amino acid sequence of the corresponding germline gene.
- a mutation may be made in a framework region or constant region, e.g., to increase the half-life of the anti-AXL antibody. See, e.g., PCT Publication WO 00/09560.
- a mutation in a framework region or constant region also can be made to alter the immunogenicity of the antibody, and/or to provide a site for covalent or non-covalent binding to another molecule.
- an antibody may have mutations in any one or more of the CDRs or framework regions of the variable domain or in the constant region.
- the present disclosure also provides methods for producing the antibody compositions and antibodies and antigen-binding portions thereof described herein.
- the present disclosure relates to a method for producing an anti-AXL antibody or antigen-binding portion as described herein, comprising providing a host cell (e.g., a recombinant host cell) comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, and a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, of an anti-AXL antibody or antigen-binding portion described herein; cultivating said host cell under conditions suitable for expression of the antibody or antigen-binding portion; and isolating the resulting antibody or antigen-binding portion.
- a host cell e.g., a recombinant host cell
- a host cell comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, and a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, of an anti-AXL antibody or antigen-binding portion
- Antibodies or antigen-binding portions produced by such expression in such recombinant host cells are referred to herein as “recombinant” antibodies or antigen- binding portions.
- the present disclosure also provides progeny cells of such host cells, and antibodies or antigen-binding portions produced by same.
- recombinant host cell means a cell into which a recombinant expression vector has been introduced. By definition, a recombinant host cell does not occur in nature.
- the present disclosure provides host cells that may comprise, e.g., a vector as described herein.
- the present disclosure also provides host cells that comprise, e.g., a nucleotide sequence encoding the heavy chain or an antigen-binding portion thereof, a nucleotide sequence encoding the light chain or an antigen-binding portion thereof, or both, of an anti-AXL antibody or antigen-binding portion thereof described herein.
- nucleic acid molecules encoding anti-AXL antibodies and antigen-binding portions thereof and vectors comprising these nucleic acid molecules can be used for transfection of a suitable mammalian, plant, bacterial or yeast host cell. Transformation can be by any known method for introducing polynucleotides into a host cell.
- nucleic acid molecules may be introduced into mammalian cells by viral vectors.
- compositions comprising as an active ingredient (or as the sole active ingredient) an anti-AXL antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the present disclosure.
- the pharmaceutical composition may additionally comprise a pharmaceutically acceptable excipient.
- the pharmaceutical compositions are intended for amelioration, prevention, and/or treatment of cancer, e.g., a cancer described herein.
- the cancer is in a tissue such as skin, lung, intestine, colon, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head and neck, liver, bone, bladder, breast, stomach, uterus, cervix, and pancreas.
- the cancer is melanoma, head and neck cancer, glioblastoma, thyroid cancer, non-small cell lung cancer, breast cancer (e.g., triple negative breast cancer), pancreatic cancer, ovarian cancer, cervical cancer, fallopian tube carcinoma, primary peritoneal carcinoma, endometrial cancer, urothelial carcinoma, renal cell carcinoma, colorectal cancer, rectal cancer, prostate cancer, mesothelioma, squamous cell carcinoma, sarcoma, chronic myeloid leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, small lymphocytic leukemia, myelodysplastic syndrome, or Hodgkin’s lymphoma.
- compositions of the present disclosure will comprise one or more anti-AXL antibodies, antigen-binding portions, antibody compositions, or bi specific binding molecules of the present disclosure, e.g., one or two anti-AXL antibodies, antigen-binding portions, or bi-specific binding molecules.
- the composition comprises a single anti-AXL antibody of the present disclosure or an antigen-binding portion thereof.
- the composition comprises two distinct anti-AXL antibodies of the present disclosure or antigen binding portions thereof.
- the pharmaceutical composition may comprise at least one anti-AXL antibody or antigen-binding portion thereof of the present disclosure, e.g., one anti-AXL antibody or portion, and one or more additional antibodies that target one or more relevant cell surface receptors, e.g., one or more cancer-relevant receptors.
- the antibodies, antigen-binding portions, and bi-specific binding molecules of the present disclosure are suitable to be administered as a formulation in association with one or more pharmaceutically acceptable excipient(s), e.g., as described below.
- excipient is used herein to describe any ingredient other than the co pound(s) of the present disclosure. The choice of excipient(s) will to a large extent depend on factors such as the particular mode of administration, the effect of the excipient on solubility and stability, and the nature of the dosage form.
- pharmaceutically acceptable excipient includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- Some examples of pharmaceutically acceptable excipients are water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- additional examples of pharmaceutically acceptable substances are wetting agents or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the antibody.
- compositions of the present disclosure and methods for their preparation will be readily apparent to those skilled in the art. Such compositions and methods for their preparation may be found, for example, in Remington’s Pharmaceutical Sciences, 19th Edition (Mack Publishing Company, 1995). Pharmaceutical compositions are preferably manufactured under GMP (good manufacturing practices) conditions.
- a pharmaceutical composition of the present disclosure may be prepared, packaged, or sold in bulk, as a single unit dose, or as a plurality of single unit doses.
- a “unit dose” is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
- Formulations of a pharmaceutical composition suitable for parenteral administration typically comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and the like. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
- a pharmaceutically acceptable carrier such as sterile water or sterile isotonic saline.
- Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration.
- injectable formulations may be prepared, packaged, or sold in unit dosage
- the active ingredient is provided in dry (i.e. , powder or granular) form for reconstitution with a suitable vehicle (e.g., sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
- a suitable vehicle e.g., sterile pyrogen-free water
- Parenteral formulations also include aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (preferably to a pH of from 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water.
- Exemplary parenteral administration forms include solutions or suspensions in sterile aqueous solutions, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms can be suitably buffered, if desired.
- Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, or in a liposomal preparation.
- the anti-AXL antibodies and antigen-binding portions thereof, anti-AXL antibody compositions, and bi-specific binding molecules of the present disclosure are for use in the treatment of cancer, e.g., an AXL-positive cancer.
- the cancer may be in one or more tissues such as skin, lung, intestine, colon, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head and neck, liver, bone, bladder, breast, stomach, uterus, cervix, and pancreas.
- cancers treated by the anti-AXL antibodies, antigen binding portions, compositions, and bi-specific binding molecules of the present disclosure may include, e.g., melanoma (e.g., advanced or metastatic melanoma), skin basal cell cancer, glioblastoma, glioma, gliosarcoma, astrocytoma, meningioma, neuroblastoma, adrenocortical cancer, head and neck squamous cell cancer, oral cancer, salivary gland cancer, nasopharyngeal cancer, breast cancer, lung cancer (e.g., non-small cell lung cancer (NSCLC), small cell lung cancer, and squamous cell lung cancer), esophageal cancer, gastroesophageal junction cancer, gastric cancer, gastrointestinal cancer, primary peritoneal cancer, liver cancer, hepatocellular carcinoma, biliary tract cancer, colon cancer, rectal cancer, colorectal carcinoma
- melanoma
- the cancer may be, e.g., at an early, intermediate, late, locally advanced, or metastatic stage, and may be relapsed or refractory to other therapeutics (e.g., other anti-AXL therapeutics) or there may be no standard therapy available.
- other therapeutics e.g., other anti-AXL therapeutics
- cancers treated by the anti-AXL antibodies, antigen binding portions, compositions, and/or bi-specific binding molecules of the present disclosure may include, e.g., melanoma, head and neck cancer, glioblastoma, thyroid cancer, non-small cell lung cancer, breast cancer (e.g., triple negative breast cancer), pancreatic cancer, ovarian cancer, cervical cancer, fallopian tube carcinoma, primary peritoneal carcinoma, endometrial cancer, urothelial carcinoma, renal cell carcinoma, colorectal cancer, prostate cancer, mesothelioma, squamous cell carcinoma, sarcoma, chronic myeloid leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, small lymphocytic leukemia, myelodysplastic syndrome, and/or Hodgkin’s lymphoma.
- melanoma head and neck cancer
- glioblastoma thyroid cancer
- non-small cell lung cancer e.g., triple negative
- Treatment refers to a method of alleviating or abrogating a biological disorder and/or at least one of its attendant symptoms.
- to “alleviate” a disease, disorder or condition means reducing the severity and/or occurrence frequency of the symptoms of the disease, disorder, or condition.
- references herein to “treatment” include references to curative, palliative and prophylactic treatment.
- “Therapeutically effective amount” refers to the amount of the therapeutic agent being administered that will relieve to some extent one or more of the symptoms of the disorder being treated.
- a therapeutically effective amount of an anti-cancer therapeutic may, for example, result in delayed tumor growth, tumor shrinkage, increased survival, elimination of cancer cells, slowed or decreased disease progression, reversal of metastasis, or other clinical endpoints desired by healthcare professionals.
- anti-AXL antibodies or antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules described herein may be administered alone or in combination with one or more other drugs or antibodies (or as any combination thereof).
- the pharmaceutical compositions, methods and uses described herein thus also encompass embodiments of combinations (co administration) with other active agents, as detailed below.
- the terms “co-administration,” “co-administered” and “in combination with,” referring to the anti-AXL antibodies and antigen-binding portions thereof, antibody compositions, and bi-specific binding molecules of the present disclosure with one or more other therapeutic agents is intended to mean, and does refer to and include the following: a) simultaneous administration of such combination of antibody / antigen-binding portion / antibody composition / bi-specific binding molecule of the present disclosure and therapeutic agent(s) to a patient in need of treatment, when such components are formulated together into a single dosage form which releases said components at substantially the same time to said patient, b) substantially simultaneous administration of such combination of antibody / antigen-binding portion / antibody composition / bi-specific binding molecule of the present disclosure and therapeutic agent(s) to a patient in need of treatment, when such components are formulated apart from each other into separate dosage forms which are taken at substantially the same time by said patient, whereupon said components are released at substantially the same time to said patient, c
- the anti-AXL antibodies or antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the present disclosure may be administered without additional therapeutic treatments, i.e. , as a stand-alone therapy (monotherapy).
- treatment with the anti-AXL antibodies or antigen binding portions thereof, antibody compositions, or bi-specific binding molecules of the present disclosure may include at least one additional therapeutic treatment (combination therapy), e.g., an immunostimulatory agent, an anti-cancer agent (e.g., a chemotherapeutic agent, an anti-neoplastic agent, an anti-angiogenic agent, or a tyrosine kinase inhibitor), or a vaccine (e.g., a tumor vaccine).
- an immunostimulatory agent e.g., an anti-cancer agent (e.g., a chemotherapeutic agent, an anti-neoplastic agent, an anti-angiogenic agent, or a tyrosine kinase inhibitor)
- the antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule may be co-administered or formulated with another medication/drug for the treatment of cancer.
- the additional therapeutic treatment may comprise, e.g., an immunostimulatory agent, a vaccine, a chemotherapeutic agent, an anti-neoplastic agent, an anti-angiogenic agent, a tyrosine kinase inhibitor, and/or radiation therapy.
- the additional therapeutic treatment may comprise a different anti-cancer antibody,
- compositions comprising an anti-AXL antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule described herein and at least one other agent (e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent) may be used as a combination treatment for simultaneous, separate or successive administration in cancer therapy.
- agent e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent
- the other agent may by any agent suitable for treatment of the particular cancer in question, for example, an agent selected from the group consisting of alkylating agents, e.g., platinum derivatives such as cisplatin, carboplatin and/or oxaliplatin; plant alkoids, e.g., paclitaxel, docetaxel and/or irinotecan; antitumor antibiotics, e.g., doxorubicin (adriamycin), daunorubicin, epirubicin, idarubicin mitoxantrone, dactinomycin, bleomycin, actinomycin, luteomycin, and/or mitomycin; topoisomerase inhibitors such as topotecan; antimetabolites, e.g., fluorouracil and/or other fluoropyri idines; FOLFOX; osimertinib; cyclophosphamide; anthracycline; dacarb
- An anti-AXL antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the present disclosure may also be used in combination with other anti-cancer therapies such as vaccines, cytokines, enzyme inhibitors, immunostimulatory compounds, and T cell therapies.
- cytokines include, for example, IL-2, IFN-gamma and GM-CSF.
- An example of a type of enzyme inhibitor that has anti-cancer activity is an indoleamine-2, 3-dioxygenase (IDO) inhibitor, for example, 1-methyl-D-tryptophan (1-D-MT).
- IDO indoleamine-2, 3-dioxygenase
- 1-methyl-D-tryptophan (1-D-MT) for example, 1-methyl-D-tryptophan
- adoptive T cell therapy refers to various immunotherapy techniques that involve expanding or engineering patients’ own T cells to recognize and attack their tumors.
- an anti-AXL antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the present disclosure may be used in adjunctive therapy in connection with tyrosine kinase inhibitors.
- tyrosine kinase inhibitors are synthetic, mainly quinazoline-derived, low molecular weight molecules that interact with the intracellular tyrosine kinase domain of receptors and inhibit ligand-induced receptor phosphorylation, e.g., by competing for the intracellular Mg-ATP binding site.
- the tyrosine kinase inhibitor is an AXL inhibitor.
- the antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule may be used in combination with a medication/drug that mediates immune system activation, including, but not limited to, an agent that modulates the expression or activity of A2AR, A1AR, A2BR, A3AR, ADA, ALP, BTLA, B7-H3, B7-H4, CTLA-4, CD27, CD28, CD39, CD40, CD47, CD55, CD73, CD122, CD137, CD160, CGEN-15049, CHK1, CHK2, CTLA-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), EGFR, FLT3, FLT3L, GAL9, GITR, HVEM, LAG-3, LILRB1, LY108, LAIR1, ICOS, IDO, KIR, LAIR1, MET, NKG2A, PAP, PD-1/PD-L1/PD-L2, 0X40, S
- a medication/drug
- the agent is a small molecule inhibitor.
- the agent is an antibody or an antigen-binding fragment thereof that binds to one of the above molecules. It is also contemplated that an anti-AXL antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the present disclosure may be used in combination with a cytokine (e.g., IL-1, IL-2, IL-12, IL-15 or IL-21), an EGFR inhibitor, a VEGF inhibitor, etc.
- a cytokine e.g., IL-1, IL-2, IL-12, IL-15 or IL-21
- an EGFR inhibitor e.g., a VEGF inhibitor, etc.
- sequences e.g., the six CDR or VH and VL sequences
- an anti-AXL antibody or antigen-binding portion described herein in the preparation of a chimeric antigen receptor, which may be for use in CAR-T technology.
- antibodies and antigen-binding portions thereof, antibody compositions, and bi-specific binding molecules of the present disclosure may be used in a method of treatment as described herein, may be for use in a treatment as described herein, and/or may be for use in the manufacture of a medicament for a treatment as described herein.
- the antibodies or antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the present disclosure may be administered in an effective amount for treatment of the condition in question, i.e. , at dosages and for periods of time necessary to achieve a desired result.
- a therapeutically effective amount may vary according to factors such as the particular condition being treated, the age, sex and weight of the patient, and whether the antibodies are being administered as a stand-alone treatment or in combination with one or more additional anti-cancer treatments.
- Dosage regimens may be adjusted to provide the optimum desired response. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the patients/subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the dose and dosing regimen are adjusted in accordance with methods well-known in the therapeutic arts. That is, the maximum tolerable dose can be readily established, and the effective amount providing a detectable therapeutic benefit to a patient may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the patient. Accordingly, while certain dose and administration regimens are exemplified herein, these examples in no way limit the dose and administration regimen that may be provided to a patient in practicing the present disclosure.
- dosage values may vary with the type and severity of the condition to be alleviated, and may include single or multiple doses. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the embodied composition. Further, the dosage regimen with the compositions of the present disclosure may be based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the patient, the severity of the condition, the route of administration, and the particular antibody employed.
- the dosage regimen can vary widely, but can be determined routinely using standard methods. For example, doses may be adjusted based on pharmacokinetic or pharmacodynamic parameters, which may include clinical effects such as toxic effects and/or laboratory values.
- the present disclosure encompasses intra-patient dose-escalation as determined by the skilled artisan. Determining of appropriate dosages and regimens is well-known in the relevant art and would be understood to be encompassed by the skilled artisan once provided the teachings disclosed herein.
- An effective amount for tumor therapy may be measured by its ability to stabilize disease progression and/or ameliorate symptoms in a patient, and preferably to reverse disease progression, e.g., by reducing tumor size.
- the ability of an antibody, antigen-binding portion, antibody composition, or bi-specific binding molecule of the present disclosure to inhibit cancer may be evaluated by in vitro assays, e.g., as described in the examples, as well as in suitable animal models that are predictive of the efficacy in human tumors.
- Suitable dosage regimens will be selected in order to provide an optimum therapeutic response in each particular situation, for example, administered as a single bolus or as a continuous infusion, and with possible adjustment of the dosage as indicated by the exigencies of each case.
- parenteral administration includes any route of administration characterized by physical breaching of a tissue of a subject and administration through the breach in the tissue, thus generally resulting in the direct administration into the blood stream, into muscle, or into an internal organ. Parenteral administration thus includes, but is not limited to, administration by injection, by application through a surgical incision, by application through a tissue-penetrating non-surgical wound, and the like.
- parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intrasternal, intracisternal, intravenous, intraarterial, intrathecal, intraurethral, intracranial, intratumoral, and intrasynovial injection or infusions.
- Particular embodiments include the intravenous and the subcutaneous routes.
- the antibodies and antigen-binding portions of the present disclosure also are useful in diagnostic processes (e.g., in vitro, ex vivo).
- the antibodies and antigen-binding portions can be used to detect and/or measure the level of AXL in a sample from a patient (e.g., a tissue sample, or a body fluid sample such as an inflammatory exudate, blood, serum, bowel fluid, saliva, or urine).
- a sample from a patient e.g., a tissue sample, or a body fluid sample such as an inflammatory exudate, blood, serum, bowel fluid, saliva, or urine.
- Suitable detection and measurement methods include immunological methods such as flow cytometry, enzyme-linked immunosorbent assays (ELISA), chemiluminescence assays, radioimmunoassays, and immunohistology.
- kits e.g., diagnostic kits comprising the antibodies and antigen-binding portions described herein.
- kits comprising one or more containers (e.g., single-use or multi-use containers) containing a pharmaceutical composition of an anti-AXL antibody or antigen-binding portion thereof, composition, or bi-specific binding molecule described herein, optionally an additional biologically active molecule (e.g., another therapeutic agent), and instructions for use.
- the antibody or antigen-binding portion, composition, or bi specific binding molecule, and optional additional biologically active molecule can be packaged separately in suitable packing such as a vial or ampule made from non reactive glass or plastic.
- the vial or ampule holds a concentrated stock (e.g., 2x, 5x, 10x or more) of the antibody or antigen-binding portion, composition, or bi-specific binding molecule and optionally the biologically active molecule.
- the articles of manufacture such as kits include a medical device for administering the antibody or antigen-binding portion, composition, or bi-specific binding molecule and/or biologically active molecule (e.g., a syringe and a needle); and/or an appropriate diluent (e.g., sterile water and normal saline).
- an appropriate diluent e.g., sterile water and normal saline.
- the present disclosure also includes methods for manufacturing said articles.
- Antibodies against human AXL were isolated from an antibody repertoire derived from OmniRat ® rats (Osborn et al., J Immunol. 190(4): 1481 -90 (2013)), a transgenic rat strain from Ligand Pharmaceuticals Inc. that produces antibodies with fully human idiotypes. Cloning of rat-derived antibody genes from single-cell sorted antibody-secreting B cells (ASC) was performed by means of SymplexTM antibody discovery technology (Meijer et al., J Mol Biol 358(3):764-72 (2006)).
- Antibody repertoire constructs encoding fully human immunoglobulins in IgGrLALA format were transfected into HEK293 cells. Cell supernatants were screened for binding to AXL expressed on the surface of CHO cells using flow cytometry in a high-throughput format. AXL reactive clones were analyzed by DNA sequencing and antibody-encoding DNA sequences were extracted. Selected antibody clones were expressed and tested functionally as described below.
- Table 1 shows the heavy and light chain variable domain nucleotide sequences of the germlined antibodies designated 23203_1 , 23203_2, 23203_3, 23203_4, 22995, and 22883.
- the correction process involved amino terminal sequence correction to germline as well as codon usage optimization.
- the targets for matching to human germline sequences were identified by blast homology searches for the heavy chain and the light chain variable regions.
- Antibodies 23203_1 , 23203_2, 23203_3, and 23203_4 represent four variants of a single parent heavy chain variable domain that has been engineered to mitigate potential risks associated with the germline IGHV4-34 sequence (i.e. , the AVY motif of HFR1 and the Nglyc site in HCDR2).
- Protein sequences of the variable domains, the constant regions and the complementarity determining regions (CDR) of antibodies 23203_1, 23203_2, 23203_3, 23203_4, 22995, and 22883 are shown in Table 2, Table 3 and Table 4, respectively.
- Table 1 shows nucleotide sequences encoding the variable domains of antibodies 23203_1 , 23203_2, 23203_3, 23203_4, 22995, and 22883.
- Table 1 Variable domain nucleotide sequences of antibodies 23203_1, 23203_2, 23203_3, 23203_4, 22995, and 22883
- Table 2 shows the deduced amino acid sequences of antibodies 23203_1, 23203_2, 23203_3, 23203_4, 22995, 22883. CDRs are in boldface and underlined.
- Table 2 Variable domain amino acid sequences of antibodies 23203_1, 23203_2, 23203_3, 23203_4, 22995, and 22883.
- Table 3 shows heavy and light chain constant region amino acid sequences (CH and CL, respectively).
- IgGrLALA refers to the presence of “LALA” mutations in the heavy chain (L234A/L235A, numbered according to the Kabat numbering scheme) that are known to reduce effector function of the Fc region of IgGi antibodies (Hezareh et al., J Virol. 75(24):12161-68 (2001); Hessell et al., Nature 449(7158):101-04 (2007)).
- Table 3 Constant region amino acid sequences of antibodies 23203_1, 23203_2, 23203_3, 23203_4, 22995, and 22883
- Table 4 shows heavy and light chain CDR amino acid sequences of antibodies 23203_1 , 23203_2, 23203_3, 23203_4, 22995, and 22883, wherein the CDRs are defined according to the IMGT ® system. SEQ ID NOs. of the sequences are shown in parentheses.
- Table 5 shows SEQ ID NO information for antibodies 23203_1, 23203_2, 23203_3, 23203_4, 22995, and 22883. Unless otherwise stated, the sequences are amino acid sequences.
- This example demonstrates the binding of anti-AXL antibodies to recombinant human and cynomolgus AXL extracellular domains (ECDs) as measured by surface plasmon resonance (SPR).
- the kinetic binding analysis was performed by surface plasmon resonance (SPR), using a Continuous Flow Microspotter (CFM, Wasatch Microfluidics, Salt Lake City, US) combined with an IBIS MX96 SPR instrument (IBIS Technologies, The Netherlands).
- SPR surface plasmon resonance
- CFM Continuous Flow Microspotter
- IBIS MX96 SPR instrument IBIS Technologies, The Netherlands
- the SensEye ® was positioned in the IBIS MX96 biosensor and captured proteins were fixed to the surface using FixIT kit (Ssens BV, The Netherlands).
- Kinetic analysis was performed by applying kinetic titration series (Karlsson et al., Anal Biochem. 349(1):136-47 (2006)), with antigen injections at increasing concentrations from 0.14 nM to 100 nM. Antigen association and dissociation was performed for 15 minutes. After each antigen injection series, the surface was regenerated by 100 mM H 3 PO 4 , pH 3 regeneration buffer. The recorded binding responses were fitted to a simple Langmuir 1:1 binding model with Scrubber 2 software for calculation of the on-rate (k on or ka), off-rate (k 0ff or kd) and affinity (KD) constants.
- Table 7 shows information about the three anti-AXL antibodies used as references in the Examples.
- 10G5 analogue (BerGenBio) was produced in both IgGi and IgGrLALA, and thus is listed in two rows in the table.
- amino acid sequences encoding the heavy and light chain variable domains of the antibody analogues in Table 6 were obtained from the listed patents or patent applications.
- the protein sequences were reverse translated to DNA sequences with human codon usage.
- the corresponding DNA sequences were gene synthesized and cloned into expression vectors containing human heavy or light chain constant regions, resulting in expression of full-length antibody chains.
- the human antibody isotype selected for expression is listed in the antibody format column.
- CHO cells were transfected with the resulting expression plasmids using a standard protein expression system.
- the corresponding antibody supernatants were purified using standard protein A purification column chromatography.
- FIGS. 1A-1C Dose-response curves of antibody binding to human or cynomolgus AXL ECD expressed on transiently transfected CHO-S cells are shown in FIGS. 1A-1C. All six anti-human AXL antibodies bind both human (FIG. 1A) and cynomolgus (FIG. 1B) AXL with varying potency and efficacy. Two reference antibodies are shown for comparison. None of the antibodies bind to mock transfected cells (FIG. 1C).
- Example 5 In vitro functional activity screen of anti-AXL antibodies in an H1299 proliferation assay
- This example describes in vitro functional screening of a panel of anti-AXL monoclonal antibodies with the purpose of characterizing their functionality in the absence or presence of the GAS6 ligand.
- the antibodies were evaluated for their ability to inhibit GAS6 induced proliferation as well as for their agonistic activity in the absence of GAS6 in the AXL expressing H1299 cancer cell line. Reference antibody analogues were included for comparison.
- Selected anti-AXL antibodies were evaluated in vitro for their ability to inhibit proliferation of the AXL expressing cancer cell line H1299.
- the H1299 cells were seeded at 2500 cells/well in a 384 well plate in RPMI 1640 Glutamax media supplemented with 2% FBS and 1% P/S and incubated for six days in a humidified incubator at 37°C with antibodies at a concentration of up to 25 pg/mL, without GAS6 or in the presence of GAS6 (RnD Systems) at 1 pg/mL.
- Cell proliferation was quantified using WST-1 cell proliferation reagent (Roche) as per manufacturer’s instructions.
- Antibodies showing no agonism in the absence of GAS6 were selected for further functional characterization, with emphasis on the rare antibodies with either pronounced counteraction or augmentation of GAS6-induced proliferation (indicated with stippled-line box in the figure).
- Example 6 In vitro functional activity of anti-AXL antibodies in an H1299 proliferation assay
- This example describes in vitro functional evaluation of six anti-AXL monoclonal antibodies with the purpose of demonstrating a dose-dependent antagonistic activity.
- the antibodies were evaluated for their ability to inhibit GAS6 induced proliferation as well as for their agonistic activity in the absence of GAS6 in the AXL-expressing H1299 cell line. Reference antibody analogues were included for comparison.
- Selected anti-AXL antibodies were evaluated in further detail in vitro for their ability to induce proliferation of the AXL-expressing cancer cell line H1299.
- the H1299 cells were seeded in RPMI 1640 Glutamax media supplemented with 2% FBS and 1% P/S and incubated for six days with a two-fold titration of the indicated antibodies starting from 25 pg/mL, either without GAS6 or in the presence of GAS6 (RnD Systems) at 1 pg/mL.
- Cell proliferation was quantified using WST-1 cell proliferation reagent (Roche) as per manufacturer’s instructions.
- Example 7 In vitro functional activity of anti-AXL antibodies in a liposome uptake assay
- This example describes in vitro functional evaluation of six anti-AXL monoclonal antibodies with the purpose of demonstrating dose-dependent antagonistic activity.
- Selected anti-AXL antibodies and reference antibody analogues were evaluated in further detail in vitro for their ability to inhibit GAS6 induced uptake of phosphatidylserine-containing liposomes in MDA-MB-468-AXL cells stably expressing exogenous AXL.
- Liposomes were prepared by mixing and hydrating molar ratios of the lipids POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine; 43%), DOPS (1 ,2-dioleoyl-sn-glycero-3-phospho-L-serine (sodium salt); 11%),
- DOPE (1 ,2-dioleoyl-sn-glycero-3-phosphoethanolamine; 5%), cholesterol (40%), DOPE-NBD (1 ,2-dioleoyl— ⁇ 12-[(7-nitro-2-1 ,3-benzoxadiazol-4-yl)amino]dodecanoyl ⁇ - sn-glycero-3-phosphoethanolamine; 1%) (Avanti Polar Lipids) followed by freeze/thaw cycles and extrusion through nucleopore filters (400 nm, Millipore) essentially as described (Ishimoto, Biochem. 127(3):411 -7 (2000)).
- the MDA-MB- 468-AXL cells were seeded in DMEM with 2% FBS and 1% P/S one day prior to the assay. On the next day, GAS6 (R&D systems, 1 pg/mL), liposomes (25 mM), anti- AXL antibodies, and reference antibodies as well as control antibodies were added to the cells. The antibodies were titrated 4-fold from 6 pg/mL. Uptake was measured and analyzed using the IncuCyte automated microscope platform.
- Example 8 In vivo efficacy of anti-AXL antibodies in a xenogeneic tumor model
- This example demonstrates the in vivo efficacy of antibodies 22995 and 23203_2 in a xenogeneic tumor model.
- mice On day 20 post-inoculation, at an average tumor size of 40 mm 3 , the mice were randomized into five groups of ten animals and treatment was initiated. The results showed a profound tumor inhibitory effect of both monoclonal antibodies against AXL (22995 and 23203_2) in the tested tumor model (**** P ⁇ 0.0001) (FIGS. 5A and 5B).
- Example 9 Epitope binning of anti-AXL antibodies
- This example describes cross-competition analysis of anti-AXL antibodies 23203-1, 22995, and 22883, and 10G5 and YW327.6S2 lgG1-LALA analogues, as measured by Surface Plasmon Resonance (SPR). Non-blocking relationships between the antibodies indicate that they recognize different epitopes of AXL.
- SPR Surface Plasmon Resonance
- FIG. 6 shows normalized values for the binding of the indicated antibodies or the AXL ligand, GAS6, to AXL ECD prebound to an array of immobilized anti-AXL antibodies on the biosensor surface.
- Immobilized antibodies are represented as rows and antibodies in solution as columns.
- Non-blocking (sandwiching) antibodies are shown as white and blocking antibodies are shown as grey.
- This example describes the binding of anti-AXL antibodies to recombinant chimeric AXL ECD, where domains of the mouse AXL sequence were exchanged for human AXL sequence. Binding of the anti-AXL antibodies to the chimeric proteins was measured by Biolayer Interferometry (BLI) to determine the AXL domains bound by antibodies 23203-1, 22995, the 10G5 analogue, and the YW327.6S2 lgG1-LALA analogue.
- BBI Biolayer Interferometry
- FIG. 7 shows normalized responses (nm) of binding of the indicated antibodies to captured chimeric human/mouse AXL ECD proteins.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- General Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020227033462A KR20220148237A (ko) | 2020-02-28 | 2021-02-26 | 항-axl 항체 및 조성물 |
| JP2022551247A JP7748377B2 (ja) | 2020-02-28 | 2021-02-26 | 抗axl抗体及び組成物 |
| IL295596A IL295596A (en) | 2020-02-28 | 2021-02-26 | Anti-axl antibodies and compositions |
| CN202180017213.3A CN115210263A (zh) | 2020-02-28 | 2021-02-26 | 抗axl抗体和组合物 |
| PE2022001857A PE20221783A1 (es) | 2020-02-28 | 2021-02-26 | Anticuerpos anti-axl y composiciones |
| BR112022015977A BR112022015977A2 (pt) | 2020-02-28 | 2021-02-26 | Anticorpos anti-axl e composições |
| MX2022010670A MX2022010670A (es) | 2020-02-28 | 2021-02-26 | Anticuerpos anti-axl y composiciones. |
| PH1/2022/552041A PH12022552041A1 (en) | 2020-02-28 | 2021-02-26 | Anti-axl antibodies and compositions |
| CA3170975A CA3170975A1 (en) | 2020-02-28 | 2021-02-26 | Anti-axl antibodies and compositions |
| EP21717200.6A EP4110824A1 (en) | 2020-02-28 | 2021-02-26 | Anti-axl antibodies and compositions |
| MYPI2022004441A MY209381A (en) | 2020-02-28 | 2021-02-26 | Anti-axl antibodies and compositions |
| AU2021225490A AU2021225490B2 (en) | 2020-02-28 | 2021-02-26 | Anti-AXL antibodies and compositions |
| CONC2022/0012159A CO2022012159A2 (es) | 2020-02-28 | 2022-08-25 | Anticuerpos anti-axl y composiciones |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062982852P | 2020-02-28 | 2020-02-28 | |
| US62/982,852 | 2020-02-28 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021171257A1 true WO2021171257A1 (en) | 2021-09-02 |
Family
ID=75426640
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2021/051636 Ceased WO2021171257A1 (en) | 2020-02-28 | 2021-02-26 | Anti-axl antibodies and compositions |
Country Status (17)
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2026001894A1 (zh) * | 2024-06-24 | 2026-01-02 | 上海医药集团生物治疗技术有限公司 | 靶向axl的嵌合抗原受体及其用途 |
| CN121851176A (zh) * | 2024-11-28 | 2026-04-14 | 北京大学深圳研究生院 | 抗人axl抗体、基因及其应用 |
| CN119912586B (zh) * | 2024-12-31 | 2025-09-30 | 四川省肿瘤医院 | 基于受体酪氨酸激酶家族axl改造的嵌合抗原受体及其应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2017009258A1 (en) * | 2015-07-10 | 2017-01-19 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| WO2017220695A1 (en) * | 2016-06-22 | 2017-12-28 | Bergen Teknologioverføring As | Anti-axl antagonistic antibodies |
| WO2019197506A1 (en) * | 2018-04-10 | 2019-10-17 | Genmab A/S | Axl-specific antibodies for cancer treatment |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2008321835B2 (en) | 2007-11-15 | 2014-11-20 | Chugai Seiyaku Kabushiki Kaisha | Monoclonal antibody capable of binding to anexelekto, and use thereof |
| CA2759836A1 (en) * | 2009-05-11 | 2010-11-18 | U3 Pharma Gmbh | Humanized axl antibodies |
| RU2577986C2 (ru) | 2010-06-18 | 2016-03-20 | Дженентек, Инк. | Антитела против axl и способы их применения |
| MA38165A1 (fr) * | 2012-11-08 | 2018-07-31 | Hoffmann La Roche | Protéines de liaison à l'antigène her3 se liant à l'épingle à cheveux beta de her3 |
| GB201410826D0 (en) * | 2014-06-18 | 2014-07-30 | Bergenbio As | Anti-axl antibodies |
| AU2015366213B2 (en) | 2014-12-18 | 2021-10-07 | Bergenbio Asa | Anti-Axl antagonistic antibodies |
| ES2924402T3 (es) * | 2015-10-02 | 2022-10-06 | Symphogen As | Anticuerpos anti-PD-1 y composiciones |
| PH12018502112B1 (en) * | 2016-04-12 | 2024-03-27 | Servier Lab | Anti-tim-3 antibodies and compositions |
-
2021
- 2021-02-26 US US17/186,465 patent/US11807688B2/en active Active
- 2021-02-26 MX MX2022010670A patent/MX2022010670A/es unknown
- 2021-02-26 IL IL295596A patent/IL295596A/en unknown
- 2021-02-26 AU AU2021225490A patent/AU2021225490B2/en active Active
- 2021-02-26 CA CA3170975A patent/CA3170975A1/en active Pending
- 2021-02-26 BR BR112022015977A patent/BR112022015977A2/pt unknown
- 2021-02-26 MY MYPI2022004441A patent/MY209381A/en unknown
- 2021-02-26 WO PCT/IB2021/051636 patent/WO2021171257A1/en not_active Ceased
- 2021-02-26 CN CN202180017213.3A patent/CN115210263A/zh active Pending
- 2021-02-26 JP JP2022551247A patent/JP7748377B2/ja active Active
- 2021-02-26 EP EP21717200.6A patent/EP4110824A1/en active Pending
- 2021-02-26 PH PH1/2022/552041A patent/PH12022552041A1/en unknown
- 2021-02-26 PE PE2022001857A patent/PE20221783A1/es unknown
- 2021-02-26 KR KR1020227033462A patent/KR20220148237A/ko active Pending
- 2021-02-26 AR ARP210100499A patent/AR121441A1/es unknown
-
2022
- 2022-08-18 CL CL2022002259A patent/CL2022002259A1/es unknown
- 2022-08-25 CO CONC2022/0012159A patent/CO2022012159A2/es unknown
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2017009258A1 (en) * | 2015-07-10 | 2017-01-19 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| WO2017220695A1 (en) * | 2016-06-22 | 2017-12-28 | Bergen Teknologioverføring As | Anti-axl antagonistic antibodies |
| WO2019197506A1 (en) * | 2018-04-10 | 2019-10-17 | Genmab A/S | Axl-specific antibodies for cancer treatment |
Non-Patent Citations (28)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY |
| "UniProt", Database accession no. Q80YQ3 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
| CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| HESSELL ET AL., NATURE, vol. 449, no. 7158, 2007, pages 101 - 04 |
| HEZAREH ET AL., J VIROL., vol. 75, no. 24, 2001, pages 12161 - 68 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HONEGGERPLUCKTHUN, J. MOL. BIOL., vol. 309, no. 3, 2001, pages 657 - 70 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| III ET AL., PROTEIN ENG., vol. 10, 1997, pages 949 - 57 |
| ISHIMOTO, BIOCHEM., vol. 127, no. 3, 2000, pages 411 - 7 |
| KARLSSON ET AL., ANAL BIOCHEM., vol. 349, no. 1, 2006, pages 136 - 47 |
| KIPRIYANOV ET AL., HUMAN ANTIBODIES AND HYBRIDOMAS, vol. 6, 1995, pages 93 - 101 |
| KIPRIYANOV ET AL., MOL. IMMUNOL., vol. 31, 1994, pages 1047 - 1058 |
| LEFRANC ET AL., DEV COMP IMMUNOL, vol. 27, no. 1, 2003, pages 55 - 77 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MARTIN ET AL., EMBO J., vol. 13, 1994, pages 5303 - 9 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MEIJER ET AL., J MOL BIOL, vol. 358, no. 3, 2006, pages 764 - 72 |
| OSBORN ET AL., J IMMUNOL., vol. 190, no. 4, 2013, pages 1481 - 90 |
| PEARSON, J. MOL. BIOL., vol. 276, 1998, pages 71 - 84 |
| PEARSON, METHODS ENZYMOL., vol. 183, 1990, pages 63 - 98 |
| PEARSON, METHODS ENZYMOL., vol. 266, 1996, pages 227 - 258 |
| PEARSON, METHODS MOL. BIOL., vol. 132, 2000, pages 185 - 219 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659 |
| TRAUNECKER ET AL., INT. J. CANCER, vol. 7, 1992, pages 51 - 52 |
| YE ET AL., ONCOGENE, vol. 29, 2010, pages 5254 - 5264 |
Also Published As
| Publication number | Publication date |
|---|---|
| US11807688B2 (en) | 2023-11-07 |
| KR20220148237A (ko) | 2022-11-04 |
| AU2021225490A1 (en) | 2022-09-15 |
| MX2022010670A (es) | 2022-09-23 |
| PH12022552041A1 (en) | 2023-11-29 |
| BR112022015977A2 (pt) | 2022-10-11 |
| US20210269532A1 (en) | 2021-09-02 |
| AU2021225490B2 (en) | 2025-11-27 |
| CA3170975A1 (en) | 2021-09-02 |
| JP2023515821A (ja) | 2023-04-14 |
| AR121441A1 (es) | 2022-06-08 |
| MY209381A (en) | 2025-07-04 |
| CL2022002259A1 (es) | 2023-04-14 |
| JP7748377B2 (ja) | 2025-10-02 |
| IL295596A (en) | 2022-10-01 |
| EP4110824A1 (en) | 2023-01-04 |
| PE20221783A1 (es) | 2022-11-16 |
| CN115210263A (zh) | 2022-10-18 |
| CO2022012159A2 (es) | 2022-10-31 |
| TW202146455A (zh) | 2021-12-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11634500B2 (en) | Anti-CD73 antibodies and compositions | |
| EP3368572A1 (en) | Anti-pd-1 antibodies and compositions | |
| US20250179195A1 (en) | Anti-flt3 antibodies and compositions | |
| US12012450B2 (en) | Anti-NKG2A antibodies and compositions | |
| AU2021225490B2 (en) | Anti-AXL antibodies and compositions | |
| US20210214454A1 (en) | Anti-cd40 antibodies and compositions | |
| RU2837590C1 (ru) | Антитела против axl и композиции | |
| RU2837590C9 (ru) | Антитела против axl и композиции | |
| HK40081002A (en) | Anti-axl antibodies and compositions | |
| EA052808B1 (ru) | Антитела и композиции против flt3 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21717200 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3170975 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202217047734 Country of ref document: IN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022015977 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2022551247 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2022/0012159 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2021225490 Country of ref document: AU Date of ref document: 20210226 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20227033462 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021717200 Country of ref document: EP Effective date: 20220928 |
|
| ENP | Entry into the national phase |
Ref document number: 112022015977 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220811 |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2022/0012159 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522440278 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2022125074 Country of ref document: RU |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 202292450 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522440278 Country of ref document: SA |