WO2021150959A1 - Animal-free dietary collagen - Google Patents

Animal-free dietary collagen Download PDF

Info

Publication number
WO2021150959A1
WO2021150959A1 PCT/US2021/014714 US2021014714W WO2021150959A1 WO 2021150959 A1 WO2021150959 A1 WO 2021150959A1 US 2021014714 W US2021014714 W US 2021014714W WO 2021150959 A1 WO2021150959 A1 WO 2021150959A1
Authority
WO
WIPO (PCT)
Prior art keywords
naturally occurring
occurring polypeptide
terminal truncation
seq
amino acid
Prior art date
Application number
PCT/US2021/014714
Other languages
French (fr)
Inventor
Nikolay OUZOUNOV
Jeffrey R. MELLIN
Julia CO
Original Assignee
Geltor, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3168802A priority Critical patent/CA3168802A1/en
Priority to MX2022009036A priority patent/MX2022009036A/en
Priority to GB2212264.2A priority patent/GB2610313B/en
Priority to CN202180022766.8A priority patent/CN115298212A/en
Priority to BR112022014586A priority patent/BR112022014586A2/en
Priority to JP2022545046A priority patent/JP2023513435A/en
Application filed by Geltor, Inc. filed Critical Geltor, Inc.
Priority to AU2021211721A priority patent/AU2021211721A1/en
Priority to EP21745159.0A priority patent/EP4093761A4/en
Priority to US17/171,874 priority patent/US11174300B2/en
Publication of WO2021150959A1 publication Critical patent/WO2021150959A1/en
Priority to US17/493,627 priority patent/US11332505B2/en
Priority to US17/714,896 priority patent/US20220332775A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L2/00Non-alcoholic beverages; Dry compositions or concentrates therefor; Their preparation
    • A23L2/52Adding ingredients
    • A23L2/66Proteins
    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT, e.g. PRESERVATION, OF FLOUR OR DOUGH, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS; PRESERVATION THEREOF
    • A21D2/00Treatment of flour or dough by adding materials thereto before or during baking
    • A21D2/08Treatment of flour or dough by adding materials thereto before or during baking by adding organic substances
    • A21D2/24Organic nitrogen compounds
    • A21D2/26Proteins
    • A21D2/261Animal proteins
    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT, e.g. PRESERVATION, OF FLOUR OR DOUGH, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS; PRESERVATION THEREOF
    • A21D2/00Treatment of flour or dough by adding materials thereto before or during baking
    • A21D2/08Treatment of flour or dough by adding materials thereto before or during baking by adding organic substances
    • A21D2/24Organic nitrogen compounds
    • A21D2/26Proteins
    • A21D2/264Vegetable proteins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L2/00Non-alcoholic beverages; Dry compositions or concentrates therefor; Their preparation
    • A23L2/385Concentrates of non-alcoholic beverages
    • A23L2/39Dry compositions
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17Amino acids, peptides or proteins
    • A23L33/18Peptides; Protein hydrolysates
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/40Complete food formulations for specific consumer groups or specific purposes, e.g. infant formula
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/16Emollients or protectives, e.g. against radiation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/08Anti-ageing preparations
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q5/00Preparations for care of the hair
    • A61Q5/002Preparations for repairing the hair, e.g. hair cure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q5/00Preparations for care of the hair
    • A61Q5/008Preparations for oily hair
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT, e.g. PRESERVATION, OF FLOUR OR DOUGH, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS; PRESERVATION THEREOF
    • A21D13/00Finished or partly finished bakery products
    • A21D13/80Pastry not otherwise provided for elsewhere, e.g. cakes, biscuits or cookies
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23GCOCOA; COCOA PRODUCTS, e.g. CHOCOLATE; SUBSTITUTES FOR COCOA OR COCOA PRODUCTS; CONFECTIONERY; CHEWING GUM; ICE-CREAM; PREPARATION THEREOF
    • A23G3/00Sweetmeats; Confectionery; Marzipan; Coated or filled products
    • A23G3/34Sweetmeats, confectionery or marzipan; Processes for the preparation thereof
    • A23G3/36Sweetmeats, confectionery or marzipan; Processes for the preparation thereof characterised by the composition containing organic or inorganic compounds
    • A23G3/44Sweetmeats, confectionery or marzipan; Processes for the preparation thereof characterised by the composition containing organic or inorganic compounds containing peptides or proteins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17Amino acids, peptides or proteins
    • A23L33/195Proteins from microorganisms
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23VINDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00Food compositions, function of food ingredients or processes for food or foodstuffs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/02Preparations for care of the skin for chemically bleaching or whitening the skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q3/00Manicure or pedicure preparations

Definitions

  • Collagen is one of the most abundant proteins found in various connective tissues in the body including tendons, ligaments, skin, and hair.
  • Collagens or collagen supplements are popular in medical, cosmetic, and/or health purposes (e.g., stimulating skin growth, promoting wound healing, strengthening nails or joints, etc.).
  • Collagens for most collagen supplements are derived from animals as a byproduct of the animal processing industry. Yet, such animal-derived collagens may increase the risk of illness transmission as well as allergies.
  • certain consumers are generally interested in animal-free products for a variety of other reasons. Thus, there remains a need for improved compositions and methods of collagens derived from non animal sources.
  • a non-naturally occurring polypeptide comprising an amino acid sequence having: (i) at least 80% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 80% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
  • the non- naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 85% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 85% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C- terminal truncation, or both.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 90% sequence identity to SEQ ID NO: 31 with an N- terminal truncation, a C-terminal truncation, or both; or (ii) at least 90% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 95% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 95% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C- terminal truncation, or both.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 98% sequence identity to SEQ ID NO: 31 with an N- tenninal truncation, a C-terminal truncation, or both; or (ii) at least 98% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
  • the non-naturally occurring polypeptide comprises: (i) the amino acid sequence of SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) the amino acid sequence of SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with an N-terminal truncation.
  • the N-terminal truncation is an N-terminal truncation of 50 amino acids to 600 amino acids.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with a C-terminal truncation.
  • the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with both an N-terminal truncation and a C-terminal truncation.
  • the N-terminal truncation is an N-terminal truncation of 50 amino acids to 600 amino acids
  • the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
  • the non-naturally occurring polypeptide comprises the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 6.
  • the non-naturally occurring polypeptide consists of the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 6.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with an N-terminal truncation.
  • the N- terminal truncation is an N-terminal truncation of 50 amino acids to 750 amino acids.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with a C-terminal truncation.
  • the C- terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
  • the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with both an N-terminal truncation and a C-terminal truncation.
  • the N-terminal truncation is an N-terminal truncation of 50 amino acids to 750 amino acids
  • the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
  • the non-naturally occurring polypeptide comprises the amino acid sequence of SEQ ID NO: 8.
  • the non-naturally occurring polypeptide consists of the amino acid sequence of SEQ ID NO: 8.
  • the non-naturally occurring polypeptide has a total truncation of 50 amino acids to 900 amino acids.
  • the non- naturally occurring polypeptide is 50 amino acids to 250 amino acids in length.
  • the non-naturally occurring polypeptide does not comprise one or more of: a laminin G domain, a Von Willebrand factor type A (vWA) domain, and a fibrillar collagen C-terminal domain.
  • the non-naturally occurring polypeptide comprises one or more collagen triple helix repeats.
  • the non-naturally occurring polypeptide is monomeric.
  • the non-naturally occurring polypeptide does not form a stable triple helix structure of a naturally occurring collagen.
  • the non-naturally occurring polypeptide is substantially free of other collagen chains.
  • the non-naturally occurring polypeptide has a non- naturally occurring level of hydroxylation relative to a naturally-occurring collagen.
  • fewer than 10% of prolines present in the non-naturally occurring polypeptide are hydroxylated. In some cases, the non-naturally occurring polypeptide is non-hydroxylated. In some cases, the non-naturally occurring polypeptide has a non-naturally occurring level of glycosylation relative to a naturally-occurring collagen. In some cases, the non-naturally occurring polypeptide protein comprises less than 5 wt. % glycosylation.
  • a composition comprising between 0.001% and 30% w/w of the non-naturally occurring polypeptide of any one of the preceding.
  • the composition is formulated for consumption by an individual.
  • the composition is a nutraceutical.
  • the individual is a human.
  • a method of improving the appearance of the skin, the hair, and/or the nails of a subject, and/or improving bone, muscle, and/or joint health in the subject comprising: administering to the subject a composition of any one of the preceding compositions. In some cases, the administering comprises orally administering to the subject.
  • a recombinant cell is provided containing therein at least one copy of a heterologous nucleic acid sequence encoding a non-naturally occurring polypeptide of any one of the preceding. In some cases, the recombinant cell is a microbial cell. In some cases, the microbial cell is a bacterial cell.
  • the bacterial cell is of the species Escherichia coli.
  • the recombinant cell lacks an enzyme that hydroxylates one or more amino acids of the non-naturally occurring polypeptide.
  • the recombinant cell lacks prolyl 4-hydroxylase and/or prolyl 3 -hydroxylase.
  • the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 80% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30.
  • the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 85% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30.
  • the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 90% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 95% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 98% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the non-naturally occurring polypeptide further comprises a secretion signal.
  • the recombinant cell secretes the non-naturally occurring polypeptide into the periplasm, into a culture media, or extracellularly.
  • the heterologous nucleic acid sequence is codon-optimized for expression in the recombinant cell.
  • the heterologous nucleic acid sequence is operably linked to an inducible promoter or a constitutive promoter.
  • the heterologous nucleic acid is or is contained in a plasmid.
  • the heterologous nucleic acid sequence is stably integrated into a chromosome of the recombinant cell.
  • a culture medium comprising a recombinant cell of any one of the preceding.
  • the culture medium further comprises the non-naturally occurring polypeptide of any one of the preceding secreted from the recombinant cell.
  • the present disclosure further provides a recombinant cell containing therein at least one copy of a heterologous nucleic acid sequence encoding collagen selected from the group consisting of: Gallus gallus collagen or Acipenser schrenckii (Japanese sturgeon) collagen.
  • the recombinant cell is a microbial cell.
  • the microbial cell is a bacterial cell.
  • the bacterial cell is of the species Escherichia coli.
  • the heterologous nucleic acid sequence comprises any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30.
  • the collagen is a Gallus gallus Type 21 collagen. In some embodiments, the collagen is a Acipenser schrenckii Type 2 alpha 1 collagen. In some embodiments, the collagen is a non-naturally occurring collagen. In some embodiments, the collagen is a truncated collagen. In some embodiments, the collagen comprises an amino acid sequence according to any one of SEQ ID NOs: 2, 4, 6, and 8.
  • the collagen further comprises a secretion signal sequence.
  • the secretion signal sequence comprises an amino acid sequence according to any one of SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, and 24.
  • the recombinant cell secretes the collagen into a culture media.
  • the recombinant cell secretes to the periplasm.
  • the recombinant cell secrets the collagen to the extracellular space.
  • the heterologous nucleic acid sequence is codon-optimized for expression in the recombinant cell. In some embodiments, the heterologous nucleic acid sequence is operably linked to an inducible promoter or a constitutive promoter. In some embodiments, the heterologous nucleic acid is or is contained within a plasmid. In some embodiments, the heterologous nucleic acid sequence is stably integrated into the chromosome of the recombinant cell. [0012] The present disclosure also provides a culture medium comprising a recombinant cell described herein. In some embodiments, the culture medium further comprises a recombinant collagen secreted from the recombinant cell.
  • the present disclosure also provides a recombinant protein comprising a sequence that has at least 90% sequence identity to a fragment of a collagen selected from the group consisting of: Gallus gallus collagen, and Acipenser schrenckii collagen.
  • the collagen is a Gallus gallus Type 21 collagen.
  • the collagen is a Acipenser schrenckii Type 2 alpha 1 collagen.
  • the collagen is a non-naturally occurring collagen or fragment thereof.
  • the protein has a non-naturally occurring level of glycosylation (e.g relative to a corresponding natural collagen).
  • the protein comprises less than 5 wt. % glycosylation (e.g., less than 3 wt. %, less than 1 wt. %, less than 0.5 wt. %, or less than 0.1 wt. %).
  • the protein is a truncated collagen.
  • the protein comprises an amino acid sequence according to any one of SEQ ID NOs: 2, 4, 6, and 8 (or having a sequence identity of at least 90% thereof, at least 95% thereof, at least 98% thereof, or the like).
  • the collagen further comprises a secretion signal sequence.
  • the secretion signal sequence comprises an amino acid sequence according to SEQ ID NO: 10, 12, 14, 16, 18, 20, 22, and 24.
  • the present disclosure also provides a composition comprising a recombinant protein as disclosed herein.
  • the composition further comprises a culture media. Additionally and/or alternatively, the composition further comprises a recombinant cell as disclosed herein.
  • the recombinant cell is a microbial cell.
  • the microbial cell is a bacterial cell.
  • the bacterial cell is of the species Escherichia coli.
  • the recombinant cell comprises an integrated heterologous nucleic acid sequence encoding a collagen, a truncated collagen, or fragment thereof.
  • the heterologous nucleic acid sequence comprises any one of SEQ ID NOs: 1, 3, 5, 7, and 25-30.
  • the present disclosure also provides a process for purifying a recombinant collagen, the process comprises incubating a recombinant cell described herein in a culture media wherein the recombinant cell secretes the recombinant collagen into the culture media, collecting the culture media comprising the recombinant collagen secreted thereto, and purifying the recombinant collagen from the culture media.
  • the present disclosure also provides a recombinant collagen purified from the culture medium disclosed in the process herein.
  • the recombinant collagen has a purity of at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%.
  • the present disclosure also provides an expression vector comprising a nucleic acid sequence encoding a non-naturally occurring truncated collagen operably linked to a promoter, wherein the non-naturally occurring truncated collagen is selected from the group consisting of: Gallus gallus collagen and Acipenser schrenckii collagen.
  • the nucleic acid sequence comprises any one of SEQ ID NOs: 1, 3, 5, 7, and 25-30.
  • the Gallus gallus collagen is Type 21 collagen.
  • the Acipenser schrenckii collagen is Type 2 alpha 1 collagen.
  • the expression vector further comprises a nucleic acid sequence encoding a secretion signal sequence.
  • the nucleic acid sequence encoding the secretion signal sequence comprises any one of SEQ ID NOs: 11, 13, 15, 17, 19, 21, and 23.
  • the nucleic acid sequence is codon optimized for expression in a cell.
  • the present disclosure also provides a composition comprising a recombinant collagen disclosed herein, formulated for consumption by an individual.
  • the composition is a nutraceutical.
  • the individual is a human.
  • the composition comprises from 0.1% to 10% recombinant collagen.
  • the composition comprises at least 50% of recombinant collagen. In some embodiments, the composition comprises from 70% to 99% of recombinant collagen. In some embodiments, the composition further comprises at least one of a carrier and a preservative. [0022]
  • the present disclosure also provides a method of improving the appearance of the skin, the hair, and/or the nails of a subject by administering to a subject the composition disclosed herein. In some embodiments, the step of administering comprises orally administering to the subject.
  • FIG. 1 shows an image of two SDS-PAGE gels showing bands of collagen proteins in supernatant samples from microbial cell cultures. The identities of each protein are indicated above each band.
  • FIGS.2A-2C depict images of SDS-PAGE gels showing bands of non-naturally occurring polypeptides of the disclosure before and after pH 3.0 treatment.
  • FIG. 3 depicts increased cell viability of human dermal fibroblasts when treated with a non-naturally occurring polypeptide of the disclosure (comprising an amino acid sequence according to SEQ ID NO: 2).
  • FIG. 4 depicts increased collagen type I production in human dermal fibroblasts when treated with a non-naturally occurring polypeptide of the disclosure (comprising an amino acid sequence according to SEQ ID NO: 2).
  • FIG. 5 depicts increased collagen type I production in tenocytes when treated with a non- naturally occurring polypeptide of the disclosure (comprising an amino acid sequence according to SEQ ID NO: 2).
  • FIG. 6 depicts alignments of non-naturally occurring polypeptides of the disclosure with corresponding naturally occurring collagens.
  • FIG. 6 discloses SEQ ID NOS: 33 and 34, respectively, in order of appearance.
  • FIG. 7A depicts the effect of pH on viscosity of a solution of an exemplary non-naturally occurring polypeptide of the disclosure.
  • FIG. 7B depicts a comparison of the viscosity of a solution of an exemplary non-naturally occurring polypeptide of the disclosure versus a benchmark.
  • FIG. 8 depicts viscosity of various blends of an exemplary non-naturally occurring polypeptide of the disclosure and xanthan.
  • FIG. 9 depicts gel hardness of a solution of an exemplary non-naturally occurring polypeptide of the disclosure.
  • FIG. 10A and FIG. 10B depict gel hardness of solutions of various lots of an exemplary non-naturally occurring polypeptide of the disclosure.
  • FIG. 11 depicts the effect of compaction and lecithin agglomeration on an exemplary non- naturally occurring polypeptide of the disclosure.
  • FIG. 12 depicts the effect of pH and oil type on gel hardness of gels containing an exemplary non-naturally occurring polypeptide of the disclosure.
  • the terms “individual”, “patient”, or “subject” are used interchangeably herein. None of the terms require or are limited to a situation characterized by the supervision (e.g., constant or intermittent) of a health care worker (e.g., a doctor, a registered nurse, a nurse practitioner, a physician’s assistant, an orderly, or a hospice worker).
  • a health care worker e.g., a doctor, a registered nurse, a nurse practitioner, a physician’s assistant, an orderly, or a hospice worker.
  • the term “comprise” or variations thereof such as “comprises” or “comprising” are to be read to indicate the inclusion of any recited feature but not the exclusion of any other features.
  • the term “comprising” is inclusive and does not exclude additional, unrecited features.
  • “comprising” may be replaced with “consisting essentially of’ or “consisting of’.
  • the phrase “consisting essentially of’ is used herein to require the specified feature(s) as well as those which do not materially affect the character or function of the claimed disclosure.
  • the term “consisting” is used to indicate the presence of the recited feature alone.
  • treatment of refers to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
  • a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient is still afflicted with the underlying disorder.
  • the compositions are, in some embodiments, administered to a patient at risk of developing a particular disease or condition, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease has not been made.
  • a “subject” can be a biological entity containing expressed genetic materials.
  • the biological entity can be a plant, animal, or microorganism, including, for example, bacteria, viruses, fungi, and protozoa.
  • the subject can be tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro.
  • the subject can be a mammal.
  • the mammal can be a human.
  • the subject may be diagnosed or suspected of being at high risk for a disease. In some cases, the subject is not necessarily diagnosed or suspected of being at high risk for the disease.
  • truncated collagen as used herein generally refers to a polypeptide that is smaller than a full-length (e.g., natural) collagen wherein one or more portions of the full-length (e.g., natural) collagen is not present.
  • the non-naturally polypeptides provided herein may be truncated at the C-terminal end, the N-terminal end, truncated by removal of internal portion(s) of the full-length collagen sequence (e.g., an internal truncation), truncated at both the C- terminal end and the N-terminal end, or may have one or both of a C-terminal truncation and an N-terminal truncation as well as an internal truncation.
  • a truncated collagen may comprise an amino acid sequence according to SEQ ID NO: 2, or a homolog thereof.
  • a truncated collagen may comprise an amino acid sequence according to SEQ ID NO: 8, or a homolog thereof.
  • a “truncation” is inclusive of said amino acid position.
  • an N-terminal truncation at amino acid position 100 of a full- length protein means a truncation of 100 amino acids from the N-terminus of the full-length protein (i.e., the truncated protein is missing amino acid positions 1 through 100 of the full- length protein).
  • a C-terminal truncation at amino acid position 901 of a full-length protein means a truncation of 100 amino acids from the C-terminus (i.e., the truncated protein is missing amino acid positions 901 through 1000 of the full-length protein).
  • an internal truncation at amino acid positions 101 and 200 means an internal truncation of 100 amino acids of the full-length protein (i.e., the truncated protein is missing amino acid positions 101 to 200 of the full-length protein).
  • compositions, methods, and systems for manufacturing non-naturally occurring polypeptides such as, e.g., animal-free collagen polypeptides or collagen-like polypeptides, as well as collagen fragments, and/or truncated collagens, such as that are expressed in and/or by genetically engineered microorganisms.
  • non-naturally occurring polypeptides include collagen or collagen-like polypeptides, recombinant collagens, collagen fragments, or truncated collagens.
  • the non-naturally occurring polypeptides described herein are derived from any suitable source, such as from mammalian or non-mammalian sources.
  • the non-naturally occurring polypeptides described herein are derived from (e.g., modified, truncated, fragments of, or the like) collagens of a bird or an avian animal (e.g., Gallus gallus collagen), a freshwater- or saltwater-fish (e.g., Acipenser schrenckii collagen), or any combination thereof.
  • a bird or an avian animal e.g., Gallus gallus collagen
  • a freshwater- or saltwater-fish e.g., Acipenser schrenckii collagen
  • the non-naturally occurring polypeptides provided herein are not normally found in nature. Generally, the non-naturally occurring polypeptides described herein exhibit one or more differences from naturally occurring collagens. In certain aspects, the non-naturally occurring polypeptides provided herein may have a different amino acid sequence from naturally occurring polypeptides (e.g., a truncated collagen). In some cases, the non-naturally occurring polypeptides may have a different structure from a naturally occurring collagen. The quaternary structure of natural collagen is a triple helix, typically composed of three polypeptides. In some aspects, the non-naturally occurring polypeptides described herein may not have or may not form a quaternary structure of natural collagen.
  • the non-naturally occurring polypeptides described herein may not form the stable triple helical structure of naturally occurring collagen.
  • two are usually identical and are designated as the alpha chain.
  • the third polypeptide is designated as the beta chain.
  • a typical natural collagen can be designated as AAB, wherein the collagen is composed of two alpha (“A”) strands and one beta (“B”) strand.
  • the non-naturally occurring polypeptides described herein do not have the AAB structure of natural collagen.
  • the non-naturally occurring polypeptides described herein are free from or substantially free from different collagen chains (e.g., a non-naturally occurring polypeptide described herein may comprise an alpha chain collagen and may be free or substantially free from a beta chain collagen).
  • the non-naturally occurring polypeptides described herein are monomeric (e.g., do not form multimeric structures).
  • the non-naturally occurring polypeptides described herein may, in some instances, form multimeric structures with identical monomers (e.g., homodimers, homotrimers, etc.).
  • the non-naturally occurring polypeptides are recombinant polypeptides (e.g., prepared recombinantly in a host cell).
  • the non-naturally occurring collagen is, in one embodiment, a truncated collagen.
  • Other non-naturally occurring collagen polypeptides include chimeric collagens.
  • a chimeric collagen is a polypeptide wherein one portion of a collagen polypeptide is contiguous with a portion of a second collagen polypeptide.
  • a collagen molecule comprising a portion of a collagen from one species contiguous with a portion of a collagen from another species is a chimeric collagen.
  • the non-naturally occurring collagen comprises a fusion polypeptide that includes additional amino acids such as a secretion tag, histidine tag, green fluorescent protein, protease cleavage site,
  • GEK repeats GDK repeats, and/or beta-lactamase.
  • the non-naturally occurring polypeptides e.g., recombinant polypeptides
  • the non-naturally occurring polypeptide comprises less than 10 wt. %, less than 9 wt. %, less than 8 wt. %, less than 7 wt. %, less than 6 wt. %, less than 5 wt. %, less than 4 wt. %, less than 3 wt. %, less than 2 wt.
  • wt. % less than 1 wt. %, less than 0.9 wt. %, less than 0.8 wt. %, less than 0.7 wt. %, less than 0.6 wt. %, less than 0.5 wt. %, less than 0.4 wt. %, less than 0.3 wt. %, less than 0.2 wt. %, or less than 0.1 wt. % glycosylation.
  • the non-naturally occurring polypeptide comprises less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, less than 25%, less than 20%, less than 15%, less than 10%, or less than 5% of total glycosylation of the corresponding natural collagen or naturally present collagen.
  • the non-naturally occurring polypeptide comprises less than 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 glycosylations.
  • those lower levels of glycosylation can be specific to one or more types of glycosylation (e.g., O-glycosylation or N-glycosylation, etc.) and/or the glycosylation residues (e.g., galactosylhydroxylysine (Gal-Hyl), glucosyl galactosylhydroxylsine (GlcGal-Hyl), etc.).
  • Non-naturally occurring polypeptides produced recombinantly e.g., in a recombinant host cell
  • a non-naturally occurring polypeptide provided herein has a non- naturally occurring amount of hydroxyprolines. In some cases, a non-naturally occurring polypeptide provided herein lacks hydroxyprolines. In some cases, a non-naturally occurring polypeptide provided herein comprises fewer hydroxyprolines than a naturally-occurring collagen. Hydroxyprolines include, without limitation, 3-hydroxyproline, 4-hydroxyproline, and 5-hydroxyproline.
  • less than about 50% (e.g., less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, or less) of the prolines present in the amino acid sequence of a non-naturally occurring polypeptide provided herein are hydroxyprolines.
  • a non-naturally occurring polypeptide produced recombinantly e.g., in a recombinant host cell
  • a recombinant polypeptide as provided herein is recombinantly expressed in a recombinant host cell (e.g., bacterial cell) that lacks an enzyme that hydroxylates one or more amino acids (e.g., proline) of the recombinant polypeptide.
  • a recombinant polypeptide as provided herein is recombinantly expressed in a host cell (e.g., bacterial cell) that lacks prolyl 4-hydroxylase and/or prolyl 3 -hydroxylase.
  • the non-naturally occurring polypeptides provided herein lack or substantially lack lysyl oxidation.
  • Lysyl oxidation involves the conversion of lysine residues into highly reactive aldehydes that can form cross-links with other proteins.
  • Naturally occurring collagens may have some level of lysyl oxidation.
  • the non-naturally occurring polypeptides may be different from natural collagens in that they lack or substantially lack lysyl oxidation.
  • the non-naturally occurring polypeptides provided herein may have a function and/or provide a benefit (e.g., as provided herein) similar or substantially similar to that of a natural or a full-length collagen.
  • the non- naturally occurring polypeptides provided herein may have improved or increased function and/or benefit (e.g., as provided herein) as compared to a natural or a full- length collagen.
  • the non-naturally occurring polypeptides disclosed herein often have advantageous properties related to their monomeric structure and/or lack of amino acids capable of cross- linking with other collagen strands, e.g., the lack of hydroxy proline residues.
  • collagen hydrolysates of the non-naturally occurring polypeptides disclosed herein are also produced with increased solubility as compared to full-length or natural collagens.
  • monomeric structures, as opposed to natural triple helix collagens are more readily digestible and bioavailable, or broken down by digestive proteases.
  • Other advantageous properties include improved physical properties in liquid compositions and in purification processes, since full- length or natural collagens or collagen strands interact to form stronger structures that can precipitate due to the presence of hydroxyproline residues.
  • the non-naturally occurring polypeptides provided herein comprise an amino acid sequence that has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to at least a portion of the naturally existing mammalian or non-mammalian collagens from which those are derived from.
  • the non-naturally occurring polypeptide has an amino acid sequence that has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Gallus gallus Type 21 alpha 1 collagen or fragment thereof.
  • the non-naturally occurring polypeptide has an amino acid sequence that has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Acipenser schrenckii Type 2 alpha 1 collagen fragment.
  • the recombinant protein is a truncated collagen.
  • a truncated collagen is a polypeptide that is smaller than a full-length (e.g., natural) collagen wherein one or more portions (e.g., internal and/or terminal portion(s)) of the full-length (e.g., natural) collagen is not present.
  • the non-naturally occurring polypeptides provided herein are truncated at the C-terminal end, the N-terminal end, truncated by removal of internal portion(s) of the full-length collagen polypeptide (e.g., internal truncation), truncated at both the C-terminal end and the N-terminal end, or comprise one or both of a C-terminal truncation and an N-terminal truncation as well as an internal truncation.
  • the non-naturally occurring polypeptides provided herein are truncated at the C-terminal end, the N-terminal end, truncated by removal of internal portion(s) of the full-length collagen polypeptide (e.g., internal truncation), truncated at both the C-terminal end and the N-terminal end, or comprise one or both of a C-terminal truncation and an N-terminal truncation as well as an internal
  • the non-naturally occurring polypeptide is a fragment of a naturally occurring collagen that retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90% of a function (e.g., of interest) of natural or naturally-present corresponding collagens.
  • the term truncated collagen is interchangeably used with the term collagen fragment.
  • the truncated collagen includes any contiguous collagen fragments that are at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% of full-length natural or naturally-present corresponding collagens.
  • the truncation is an internal truncation, a truncation at the N-terminal portion of the collagen, a truncation at the C-terminal portion of the collagen, a truncation of an internal portion, or a truncation at both the C-terminal end and the N-terminal end.
  • a truncated collagen provided herein may be truncated by from 50 amino acids to 1000 amino acids, from 50 amino acids to 950 amino acids, from 50 amino acids to 900 amino acids, from 50 amino acids to 850 amino acids, from 50 amino acids to 800 amino acids, from 50 amino acids to 750 amino acids, from 50 amino acids to 700 amino acids, from 50 amino acids to 650 amino acids, from 50 amino acids to 600 amino acids, from 50 amino acids to 550 amino acids, from 50 amino acids to 500 amino acids, from 50 amino acids to 450 amino acids, from 50 amino acids to 400 amino acids, from 50 amino acids to 350 amino acids, from 50 amino acids to 300 amino acids, from 50 amino acids to 250 amino acids, from 50 amino acids to 200 amino acids, from 50 amino acids to 150 amino acids, or from 50 amino acids to 100 amino acids.
  • a truncated collagen is truncated by 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220
  • a non-naturally occurring polypeptide (e.g., truncated collagen) disclosed herein may comprise a truncation relative to a full-length (e.g., natural) collagen.
  • a truncated collagen disclosed herein may comprise a truncation relative to a full-length (e.g., natural) chicken ( Gallus gallus ) type 21 alpha 1 collagen (e.g., SEQ ID NO: 31).
  • a truncated collagen disclosed herein may comprise the amino acid sequence of SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, an internal truncation, or a combination thereof.
  • a truncated collagen disclosed herein may comprise a truncation relative to a full-length (e.g., natural) Japanese sturgeon ( Acipenser schrenckii ) type 2 alpha 1 collagen (e.g., SEQ ID NO: 32).
  • a truncated collagen disclosed herein may comprise the amino acid sequence of SEQ ID NO: 32 with an N- terminal truncation, a C-terminal truncation, an internal truncation, or a combination thereof.
  • full-length (e.g., natural) collagens are provided in Table 1 below.
  • polypeptides may be truncated collagen polypeptides comparable to fish collagens, including from other species of sturgeon, or from other species producing roe suitable for caviar, including salmon, steelhead, trout, lumpfish, whitefish, or carp, as well as other fish such as tilapia and sharks.
  • Suitable comparable sequences from Acipenser schrenckii include NCBI accession numbers BA058965.1, BA058966.1,
  • Suitable sequences from Acipenser ruthenus include NCBI accession numbers A0A444UGW0, A0A444TZM6, A0A444UC45, A0A444UC53, A0A662YTX1, A0A662Z270, A0A662YZ39, A0A444U1F5, A0A444UJK3, A0A444UNU0, X5HZZ7, X5IHC1, A0A444UPK8, A0A444UBS1, A0A444UYQ7, A0A444TWQ3, A0A444ULY4, A0A444TZ23, A0A662YS48, A0A444U4C8, A0A444UD64, A0A662YX10,
  • polypeptides may be truncated collagen polypeptides comparable to chicken collagens, or other poultry collagens, such as from domestic fowls, including chickens, turkeys, geese, and ducks.
  • Suitable comparable sequences from Gallus gallus (chicken) include NCBI accession numbers V9GZR2, Q9PSS5, A0A3Q2UDI3, Q90802, A0A1D5PNH7, Q4TZW6, Q90803, Q91014, A0A1D5PPI0, A0A1D5P1A5, A0A3Q2U6K2, A0A3Q2U8F9, Q90689, A0A3Q2U3U6, P13731, A0A1D5PFE0, A0A3Q2TXZ7, Q5FY72, A0A1D5PR16, A0A1D5PKR6, F1NDF5, Q90589, P08125, F1NRH2, P3
  • a non-naturally occurring polypeptide as described herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 31) from amino acid positions 1 to 537; from amino acid positions 1 to 542; from amino acid positions 1 to 547; from amino acid positions 1 to 552; from amino acid positions 1 to 557; from amino acid positions 1 to 562; from amino acid positions 1 to 567; from amino acid positions 1 to 572; or from amino acid positions 1 to 577.
  • amino acid position e.g., relative to SEQ ID NO: 31
  • a non- naturally occurring polypeptide as described herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 31) from amino acid positions 726 to 957; from amino acid positions 731 to 957; from amino acid positions 736 to 957; from amino acid positions 741 to 957; from amino acid positions 746 to 957; from amino acid positions 751 to 957; from amino acid positions 756 to 957; from amino acid positions 761 to 957; from amino acid positions 766 to 957; from amino acid positions 769 to 957; from amino acid positions 774 to 957; from amino acid positions 779 to 957; or from amino acid positions 784 to 957.
  • a non-naturally occurring from amino acid positions 726 to 957; from amino acid positions 731 to 9
  • a non-naturally occurring polypeptide as described herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 31) from amino acid positions 1 to 537; from amino acid positions 1 to 542; from amino acid positions 1 to 547; from amino acid positions 1 to 552; from amino acid positions 1 to 557; from amino acid positions 1 to 562; from amino acid positions 1 to 567; from amino acid positions 1 to 572; or from amino acid positions 1 to 577; and with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 31) from amino acid positions 726 to 957; from amino acid positions 731 to 957; from amino acid positions 736 to 9
  • a non-naturally occurring polypeptide e.g., truncated collagen
  • a non-naturally occurring polypeptide may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N- terminal truncation at amino acid position 557 (relative to SEQ ID NO: 31); and with a C- terminal truncation at amino acid position 746 (relative to SEQ ID NO: 31).
  • a non-naturally occurring polypeptide e.g., truncated collagen
  • a non-naturally occurring polypeptide may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at amino acid position 557 (relative to SEQ ID NO: 31); and with a C-terminal truncation at amino acid position 769 (relative to SEQ ID NO: 31).
  • a non-naturally occurring polypeptide as described herein may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 32) from amino acid positions 1 to 660; from amino acid positions 1 to 665; from amino acid positions 1 to 670; from amino acid positions 1 to 675; from amino acid positions 1 to 680; from amino acid positions 1 to 685; from amino acid positions 1 to 690; from amino acid positions 1 to 695; or from amino acid positions 1 to 700.
  • SEQ ID NO: 32 or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ
  • a non-naturally occurring polypeptide as described herein may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 32) from amino acid positions 855 to 1420; from amino acid positions 860 to 1420; from amino acid positions 865 to 1420; from amino acid positions 870 to 1420; from amino acid positions 875 to 1420; from amino acid positions 880 to 1420; from amino acid positions 885 to 1420; from amino acid positions 890 to 1420; from amino acid positions 895 to 1420; or from amino acid positions 900 to 1420.
  • SEQ ID NO: 32 or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with a C-terminal
  • a non-naturally occurring polypeptide as described herein may comprise both an N-terminal truncation and a C-terminal truncation.
  • a non-naturally occurring polypeptide e.g., truncated collagen
  • a non-naturally occurring polypeptide e.g., truncated collagen
  • a non-naturally occurring polypeptide may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at amino acid position 680 (relative to SEQ ID NO: 32); and with a C-terminal truncation at amino acid position 880 (relative to SEQ ID NO: 32).
  • a non-naturally occurring polypeptide may comprise any amino acid sequence provided herein.
  • a non-naturally occurring polypeptide e.g., truncated collagen
  • a non-naturally occurring polypeptide may consist essentially of any amino acid sequence provided herein.
  • the non- naturally occurring polypeptide has or comprises an amino acid sequence of any one of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
  • a non-naturally occurring polypeptide comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to any one of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
  • the non-naturally occurring polypeptide consists of or consists essentially of an amino acid sequence of any one of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
  • the non-naturally occurring polypeptide may include any chimeric collagen that includes at least one non-continuous collagen fragment.
  • the non- naturally occurring polypeptide can be a chimeric collagen in which a portion of N-terminus collagen is contiguous with a portion of C-terminus collagen where the portion of N-terminus collagen and the portion of C-terminus collagen are not contiguous in the natural or naturally- present corresponding collagens.
  • the non-naturally occurring polypeptide can be a chimeric collagen in which a portion of C-terminus collagen is contiguous with a portion of N-terminus collagen (e.g., in a flipped or reverse order - C terminus collagen is located in the N- terminus of the portion of N-terminus collagen) where the portion of C-terminus collagen and the portion of N-terminus collagen are contiguous or non-contiguous in the natural or naturally- present corresponding collagens.
  • the non-naturally occurring polypeptide can be a chimeric collagen in which one portion of a collagen polypeptide is contiguous with a portion of a second collagen polypeptide (e.g., a collagen molecule comprising a portion of a collagen from a first species contiguous with a portion of a collagen from a second species is a chimeric collagen, etc.).
  • a collagen polypeptide e.g., a collagen molecule comprising a portion of a collagen from a first species contiguous with a portion of a collagen from a second species is a chimeric collagen, etc.
  • SEQ ID NO: 1 A nucleotide sequence encoding a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken) GATACCGGTTTTCCGGGTATGCCTGGTCGTAGCGGTGATCCGGGTCGTAGCGGTAAAGATGGTC
  • SEQ ID NO: 2 Amino acid sequence of a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
  • SEQ ID NO: 3 A nucleotide sequence encoding a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
  • SEQ ID NO: 4 Amino acid sequence of a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
  • SEQ ID NO: 5 The nucleotide sequence encoding a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken) [0071] GATACTGGTTTCCCGGGGATGCCTGGGCGCTCAGGTGATCCGGGGCGTAGTGGAAAAGA
  • SEQ ID NO: 6 Amino acid sequence of a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
  • SEQ ID NO: 7 The nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
  • SEQ ID NO: 8 Amino acid sequence of a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
  • SEQ ID NO: 10 Amino acid sequence of a Secretion Signal Sequence 1
  • SEQ ID NO: 11 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 2
  • SEQ ID NO: 13 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 3
  • SEQ ID NO: 14 Amino acid sequence of a Secretion Signal Sequence 3
  • SEQ ID NO: 15 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 4
  • SEQ ID NO: 16 Amino acid sequence of a Secretion Signal Sequence 4
  • SEQ ID NO: 17 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 5
  • SEQ ID NO: 18 Amino acid sequence of a Secretion Signal Sequence 5
  • SEQ ID NO: 19 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 6
  • SEQ ID NO: 20 Amino acid sequence of a Secretion Signal Sequence 6
  • SEQ ID NO: 21 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 7 ATGCTGAACCCGAAAGTTGCTTACATGGTTTGGATGACCTGCCTGGGTCTGACCCTGCCGTCTC
  • SEQ ID NO: 23 The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 8
  • SEQ ID NO: 24 Amino acid sequence of a Secretion Signal Sequence 8
  • SEQ ID NO: 25 A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
  • SEQ ID NO: 26 A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
  • SEQ ID NO: 27 A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon) GGTTTGCAAGGTATGCCAGGGGAACGGGGTGCGTCCGGGATAGCCGGGGCAAAAGGTGATCGAG
  • SEQ ID NO: 28 A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
  • SEQ ID NO: 29 A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
  • SEQ ID NO: 30 A codon-optimized nucleotide sequence encoding a truncated collagen type 21 polypeptide from Gallus gallus
  • the non-naturally occurring polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 2, 4, 6, and 8. In some embodiments, the non-naturally occurring polypeptide comprises an amino acid sequence having a sequence identity of at least
  • the non-naturally occurring polypeptide is encoded by a nucleic acid sequence of any one of SEQ ID NOs: 2, 4, 6, and 8.
  • the non-naturally occurring polypeptide is encoded by a nucleic acid sequence of any one of SEQ ID NOs: 2, 4, 6, and 8.
  • the non-naturally occurring polypeptide is encoded by a nucleic acid having sequence identity of at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% thereof, or the like, to the nucleic acid sequence of any one of SEQ ID NOs: 1, 3, 5, 7, and 25-30.
  • the non-naturally occurring polypeptides provided herein may or may not contain one or more domains from natural collagen.
  • FIG. 6 depicts an alignment of exemplary non-naturally occurring polypeptides (e.g., truncated collagens) of the disclosure with the corresponding naturally occurring collagen.
  • the top panel depicts an alignment of a non-naturally occurring polypeptide of SEQ ID NO: 2 and SEQ ID NO: 6 with Gallus gallus type 21 alpha 1 collagen (e.g., SEQ ID NO: 31).
  • the bottom panel depicts an alignment of a non-naturally occurring polypeptide of SEQ ID NO: 8 with Acipenser schrenckii type 2 alpha 1 collagen.
  • FIG. 1 depicts an alignment of exemplary non-naturally occurring polypeptides (e.g., truncated collagens) of the disclosure with the corresponding naturally occurring collagen.
  • the top panel depicts an alignment of a non-naturally occurring polypeptide of SEQ ID NO: 2 and SEQ ID NO
  • non-naturally occurring polypeptides may have one or more domains found in natural collagen (e.g., collagen triple helix repeat domains).
  • FIG. 6 further demonstrates that non-naturally occurring polypeptides may lack one or more domains found in natural collagen (e.g., Von Willebrand factor type A (vWA) domain, laminin G domain, fibrillar collagen C- terminal domain).
  • vWA Von Willebrand factor type A
  • a non-naturally occurring polypeptide provided herein may contain one or more collagen triple helix repeat domains.
  • a non-naturally occurring polypeptide provided herein may lack one or more of a Von Willebrand factor type A (vWA) domain, a laminin G domain, and a fibrillar collagen C-terminal domain).
  • the non-naturally occurring polypeptide includes a secretion signal sequence.
  • Any suitable secretion signal sequence e.g., hydrophobic signaling peptides, Sec signal peptides, Tat signal peptides, etc.
  • exemplary secretion signal sequences includes a peptide having an amino acid sequence of any one of SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, and 24.
  • the secretion signal sequence includes a peptide encoded by a nucleic acid sequence of any one of SEQ ID NOs: 9, 11, 13, 15, 17, 19, 21, and 23.
  • the secretion signal sequence is preferably located in the N-terminus of the non-naturally occurring polypeptide (e.g., recombinant polypeptide). Yet, it is contemplated that the secretion signal sequence can be located at other than N-terminus where the secretion signal sequence remains functional.
  • the non-naturally occurring polypeptide (e.g., recombinant polypeptide) as described herein can be expressed or generated via a nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide).
  • another aspect of the disclosure includes an expression vector comprising a nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide).
  • the expression vector is a bacterial expression vector.
  • the expression vector is a yeast expression vector.
  • the expression vector is an insect expression vector.
  • Any suitable expression vector that can induce the protein expression from the inserted nucleic acid encoding the non-naturally occurring polypeptide e.g., recombinant polypeptide.
  • exemplary bacterial expression vectors may include pGEX vectors where glutathione S- transferase is used as a fusion partner and gene expression is under the control of the tac promoter, or pET vectors (e.g., pET28 vector, etc.) which uses a T7 promoter.
  • Exemplary yeast expression vectors may include pPIC vectors, which uses the AOX1 promoter inducible with methanol.
  • the expression vector is in a plasmid form (e.g., including bacterial artificial chromosome form, etc.) that are independently present in the host cell (e.g., cells expressing the recombinant polypeptide).
  • the expression vector is stably integrated into the chromosome of the host cell via random or targeted integration.
  • the nucleic acid sequence encoding the non-naturally occurring polypeptide is codon-optimized to be expressed in non-animal cells, preferably in bacterial cells.
  • “codon-optimized” means that the codon composition is improved for expression in the heterologous cells (e.g., microbial cells, bacterial cells, etc.) without altering the encoded amino acid sequences.
  • Non-limiting examples of codon- optimized nucleic acid sequences include SEQ ID NOs: 25-30.
  • the expression vector may include one or more selection agent.
  • the selection agents include certain sugars including galactose containing sugars or antibiotics including ampicillin, hygromycin, G418 and others. Enzymes that are used to confer resistance to the selection agent include b-galactosidase or a b-lactamase.
  • the expression vector includes an inducible promoter or a constitutive promoter (e.g., CMV promoter, etc.) such that the nucleic acid encoding the recombinant protein is operatively linked to the inducible promoter or the constitutive promoter.
  • the expression vector may include tetracycline-inducible promoter pTET, araC-ParaBAD inducible promoter, or IPTG inducible lac promoter.
  • operatively linked promoter and nucleic acid means that the expression of the nucleic acid (e.g., transcription, translation, etc.) is at least under partial control of the promoter.
  • the nucleic acid encoding the non-naturally occurring polypeptide e.g., recombinant polypeptide
  • the expression vector may have an overlap of from 20 to 50 bp long, from 20 to 40 bp long, from 20 to 30 bp long, or from 30 to 40 bp long.
  • Such overlap can be added using PCR with aDNA polymerase (e.g., PRIMESTAR ® GXL polymerase (www.takarabio.com/products/pcr/gc- rich-pcr/primestar-gxl-dna-polymerase)).
  • aDNA polymerase e.g., PRIMESTAR ® GXL polymerase (www.takarabio.com/products/pcr/gc- rich-pcr/primestar-gxl-dna-polymerase)
  • Opened expression vector and the insert nucleic acid encoding the non-naturally occurring polypeptide can be assembled together into the final plasmid using any suitable cloning system (e.g., IN-FUSION ® Cloning (www.takarabio.com/products/cloning/in-fusion-cloning) or SGI Gibson assembly (us.vwr.com/store/product/17613857/gibson-assembly-hifi-l-step-kit-synthetic-genomics-inc)).
  • IN-FUSION ® Cloning www.takarabio.com/products/cloning/in-fusion-cloning
  • SGI Gibson assembly us.vwr.com/store/product/17613857/gibson-assembly-hifi-l-step-kit-synthetic-genomics-inc
  • Such prepared expression vector can be used to generate genetically engineered or modified organisms, or a recombinant cell to produce the non-naturally occurring polypeptides described herein (e.g., collagens, truncated collagens, or collagen fragments).
  • the recombinant cells contain at least one copy of a plasmid or a stably integrated heterologous nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., collagens, truncated collagens, or collagen fragments, preferably collagens, truncated collagens, or collagen fragments of, or derived from, Gallus gallus collagen and/or Acipenser schrenckii collagen).
  • the recombinant cell is a microbial cell.
  • the expression vector can be inserted into (e.g., via any suitable transformation method) the bacterial cells for protein expression (e.g., Escherichia coli including BL-21 cells, etc.) to be independently present in the cytoplasm of the bacteria (e.g., as a plasmid form) or to be at least temporarily and/or stably integrated into the bacterial chromosome.
  • the transformed cells can be cultivated in a suitable media.
  • the suitable media includes a minimal media and the cells are frozen in 1.5 aliquots with vegetable glycerin at a ratio of 50:50 of cells of cells to glycerin.
  • one vial of the frozen cultured cells can be cultured in a suitable amount of bacteria culture media (e.g., minimal media, 50ml, 100ml, etc.) for at least 6 hours, at least 8 hours, at least 10 hours, at least 12 hours, at least overnight at at least 36 °C, preferably at about 37 °C by continuously shaking the culture (e.g., at least 100 rpm, at least 200 rpm, at least 250 rpm, etc.).
  • Table 2 and Table 3 show the exemplary formulation of the minimal media that can be used for cell cultivation and culture.
  • transformed cells can then be transferred to a larger volume of growth media (e.g., minimal media) and grown for at least 4 hours, at least 5 hours, at least 6 hours, at least 7 hours, at least 8 hours, from 5 to 10 hours, from 5 to 9 hours, from 6 to 9 hours, and/or alternatively until the cell density in the media reaches optical density (OD) of 600.
  • growth media e.g., minimal media
  • fermentation process can be performed at various temperature ranging from 22 °C to 33 °C, from 29 °C to 33 °C, from 30 °C to 32 °C, from 23 °C to 29 °C, or from 25 °C to 28 °C.
  • the temperature of the fermentation can be maintained at a constant temperature and immediately upon completion of fermentation the non-naturally occurring polypeptide can be purified.
  • the temperature of the fermentations can be maintained for a desired period of time and when cell densities of OD600 of 10-20 are reached, then the temperature can be reduced to induce protein production. In such embodiments, typically, the temperature is reduced from 28° C to 25° C.
  • protein expression in the bacteria can be induced by adding induction reagent.
  • the expression vector contains lac promoter and the nucleic acid encoding the non-naturally occurring polypeptide (e.g., truncated collagen, collagen fragments, or collagen) is under the control of the lac promoter
  • the expression of the nucleic acid can be induced by adding isopropyl b-d-l-thiogalactopyranoside (IPTG) at a concentration ranging from 0.1 - 1.5 mM, from 0.1 - 1.0 mM, or from 0.1 - 0.5 mM. Fermentation can be continued for 20-24 hours, or in some embodiments, for 40-60 hours.
  • IPTG isopropyl b-d-l-thiogalactopyranoside
  • such generated recombinant cells e.g., recombinant bacteria transformed with the expression vector
  • intracellularly express the non-naturally occurring polypeptides e.g., truncated collagen, collagen fragments, or collagen
  • Such intracellularly expressed polypeptides e.g., truncated collagen, collagen fragments, or collagen
  • the culture media can contain secreted recombinant protein (e.g., truncated collagen, collagen fragments, or collagen) encoded by the nucleic acids.
  • compositions including the non-naturally occurring polypeptide (e.g., recombinant collagen, truncated collagen, collagen fragments, or collagen) encoded by the nucleic acids.
  • the composition may include the recombinant cell comprising an integrated heterologous nucleic acid sequence encoding a non- naturally occurring polypeptide (e.g., collagen, a truncated collagen, or fragment thereof), and/or the culture medium (e.g., growth media, cultivation media, etc.) for the recombinant cell.
  • the composition may include purified recombinant proteins from the recombinant cells and/or the culture medium.
  • the recombinant proteins are purified from the culture medium where the recombinant cells grow and secrete the recombinant proteins thereto.
  • the recombinant protein is coupled with a tag (e.g., histidine tag, etc) such that the recombinant protein can be purified using affinity purification is known as immobilized metal affinity chromatography (IMAC).
  • IMAC immobilized metal affinity chromatography
  • the recombinant protein can be purified via column chromatography.
  • the recombinant protein can be purified by acid treatment of homogenized growth media.
  • the pH of the growth media e.g., fermentation broth
  • the recombinant cells are then separated using centrifugation. Supernatant of the acidified broth can be tested on a polyacrylamide gel and determined whether it contains the recombinant protein in relatively high abundance compared to starting pellet.
  • the recombinant protein slurry obtained is generally high in salts.
  • concentration and diafiltration steps can be performed using filtration steps.
  • the filtration step can be performed using EMD Millipore Tangential Flow Filtration system with ultrafiltration cassettes of 0.1 m 2 each. Total area of filtration in this example can be 0.2 m 2 using two cassettes in parallel.
  • a volume reduction of 5x and a salt reduction of 19x can be achieved in the TFF stage.
  • Final collagen slurry can be run on an SDS-PAGE gel to confirm presence of the recombinant protein.
  • the purified recombinant protein can then be analyzed on an SDS-PAGE gel to identify a corresponding thick and clear band observed at the expected sizes for each respective protein. Quantification of titers and purity can be further conducted using reverse phase and size exclusion HPLC chromatography. It is preferred that the purity of the purified recombinant proteins is at least at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%.
  • the composition including the non-naturally occurring polypeptides provided herein can be formulated for consumption by an individual (e.g., a human, a patient, a person, an animal, etc.).
  • the non-naturally occurring polypeptides e.g., recombinant proteins and/or purified recombinant proteins
  • the non-naturally occurring polypeptides e.g., recombinant proteins and/or purified recombinant proteins
  • the non-naturally occurring polypeptides can be formulated as a protein supplement.
  • the non-naturally occurring polypeptides e.g., recombinant proteins and/or purified recombinant proteins
  • the composition may include vitamins (e.g.
  • vitamin A, vitamin B, vitamin C, vitamin D, vitamin E, etc. minerals (e.g., calcium, zinc, copper, manganese, chromium, molundenum, boron, etc), sugar (e.g., cellulose, dextrose, maltose, etc.), and/or natural extracts (e.g., herb, ginseng, echinacea, green tea, glucosamine, omega-3, lutein, folic acid, liver oil, fish oil, coffee extracts, etc.).
  • minerals e.g., calcium, zinc, copper, manganese, chromium, molundenum, boron, etc
  • sugar e.g., cellulose, dextrose, maltose, etc.
  • natural extracts e.g., herb, ginseng, echinacea, green tea, glucosamine, omega-3, lutein, folic acid, liver oil, fish oil, coffee extracts, etc.
  • Formulations suitable for consumption by an individual include, without limitation, ready-to-mix powders, ready-to-drink beverages, functional shots, supplement tablets and capsules, coffee creamers, bars, bites or baked goods, “no bone” broth, non-dairy frozen novelty, gummies (e.g., candy), chocolates, and meat snacks.
  • suitable for consumption by an individual include, without limitation, ready-to-mix powders, ready-to-drink beverages, functional shots, supplement tablets and capsules, coffee creamers, bars, bites or baked goods, “no bone” broth, non-dairy frozen novelty, gummies (e.g., candy), chocolates, and meat snacks.
  • a composition, formulation, or product is "nutritional” or “nutritive” if it provides an appreciable amount of nourishment to its intended consumer, meaning the consumer assimilates all or a portion of the composition or formulation into a cell, organ, and/or tissue.
  • such assimilation into a cell, organ, and/or tissue provides a benefit or utility to the consumer, e.g., by maintaining or improving the health and/or natural function(s) of said cell, organ, and/or tissue.
  • a nutritional composition or formulation that is assimilated as described herein is termed “nutrition”.
  • a polypeptide is nutritional if it provides an appreciable amount of polypeptide nourishment to its intended consumer, meaning the consumer assimilates all or a portion of the protein, typically in the form of single amino acids or small peptides, into a cell, organ, and/or tissue.
  • “Nutrition” also means the process of providing to a subject, such as a human or other mammal, a nutritional composition, formulation, product, or other material.
  • a nutritional product need not be “nutritionally complete”, meaning if consumed in sufficient quantity, the product provides all carbohydrates, lipids, essential fatty acids, essential amino acids, conditionally essential amino acids, vitamins, and minerals required for health of the consumer.
  • a “nutritionally complete protein” contains all protein nutrition required (meaning the amount required for physiological normalcy by the organism) but does not necessarily contain micronutrients such as vitamins and minerals, carbohydrates, or lipids.
  • a composition or formulation is nutritional in its provision of polypeptide capable of decomposition (e.g., the breaking of a peptide bond, often termed protein digestion) to single amino acids and/or small peptides (e.g., two amino acids, three amino acids, or four amino acids, possibly up to ten amino acids) in an amount sufficient to provide a “nutritional benefit”.
  • polypeptide capable of decomposition e.g., the breaking of a peptide bond, often termed protein digestion
  • small peptides e.g., two amino acids, three amino acids, or four amino acids, possibly up to ten amino acids
  • nutritional polypeptides that transit across the gastrointestinal wall and are absorbed into the bloodstream as small peptides (e.g., larger than single amino acids but smaller than about ten amino acids) or larger peptides, oligopeptides, or polypeptides (e.g., >11 amino acids).
  • a nutritional benefit in a polypeptide-containing composition can be demonstrated and, optionally, quantified, by a number of metrics.
  • a nutritional benefit is the benefit to a consuming organism equivalent to or greater than at least about 0.5% of a reference daily intake value of protein, such as about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100% or greater than about 100% of a reference daily intake value.
  • a nutritional benefit is demonstrated by the feeling and/or recognition of satiety by the consumer.
  • a nutritional benefit is demonstrated by incorporation of a substantial amount of the polypeptide component of the composition or formulation into the cells, organs, and/or tissues of the consumer, such incorporation generally meaning that single amino acids or short peptides are used to produce polypeptides de novo intracellularly.
  • a “consumer” or a “consuming organism” means any animal capable of ingesting the product having the nutritional benefit.
  • the consumer is a mammal such as a healthy human, e.g., a healthy infant, child, adult, or older adult.
  • the consumer is a mammal such as a human (e.g., an infant, child, adult, or older adult) at risk of developing or suffering from a disease, disorder, or condition characterized by (i) the lack of adequate nutrition and/or (ii) the alleviation thereof by the nutritional products of the present disclosure.
  • a human e.g., an infant, child, adult, or older adult
  • An “infant” is generally a human under about age 1 or 2
  • a “child” is generally a human under about age 18, and an “older adult” or “elderly” human is a human aged about 65 or older.
  • nutritive polypeptides capable of transforming health and treating, preventing and reducing the severity of a multitude of diseases, disorders, and conditions associated with amino acid pathophysiology, as they are selected for specific physiologic benefits to improve health and address many nutrition-related conditions, including gastrointestinal malabsorption, muscle wasting, diabetes or pre-diabetes, obesity, oncology, metabolic diseases, and other cellular and systemic diseases.
  • compositions and formulations that contain the nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein), as food, beverages, medical foods, supplements, and pharmaceuticals.
  • Nutritive polypeptides e.g., non-naturally occurring polypeptides described herein
  • properties can be evaluated (see, e.g., Example 7).
  • Such properties may include digestibility, allergenicity, thermostability, solubility, aggregation, toxicity, taste, and mouth/feel characteristics.
  • the formulations are incorporated into food products having advantages over similar food products lacking the nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein), or the formulations are incorporated into other products such as beverage products or animal feed products.
  • the food products have a reduced fat content, a reduced sugar content, and/or a reduced calorie content compared to a food product not having the nutritive polypeptide (e.g., non-naturally occurring polypeptides described herein).
  • the nutritive polypeptide e.g., non-naturally occurring polypeptides described herein
  • gelatin an animal- derived material
  • a non-animal derived product containing one or more nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein).
  • the nutritive polypeptide e.g., non-naturally occurring polypeptides described herein
  • the gelatin replacement is incorporated into a food product, a beverage product, or an animal feed product, and the formulation is substantially free of non-comestible products.
  • formulations containing a nutritive polypeptide present in a functional and/or nutritional amount, which increases the viscosity of a food or beverage product, such as formulations containing viscosity-increasing nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein) incorporated into food products having advantages over similar food products lacking the nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein).
  • the food products have a reduced fat content, a reduced sugar content, and/or a reduced calorie content compared to a food product not having the nutritive polypeptide (e.g., non-naturally occurring polypeptides described herein).
  • Viscous nutritive polypeptides can be used as a nutritionally favorable low calorie substitute for fat.
  • the non-naturally occurring polypeptides of the disclosure may be combined with other ingredients to provide combination products.
  • ingredients may include carbohydrates, lipids, supplemental minerals, supplemental vitamins, excipients or buffering agents, flavoring agents, sweeteners, or coloring agents.
  • a “carbohydrate” refers to a sugar or polymer of sugars.
  • saccharide “polysaccharide,” “carbohydrate”, and “oligosaccharide” can be used interchangeably.
  • Most carbohydrates are aldehydes or ketones with many hydroxyl groups, usually one on each carbon atom of the molecule.
  • Carbohydrates generally have the molecular formula CnH2nOn.
  • a carbohydrate can be a monosaccharide, a disaccharide, trisaccharide, oligosaccharide, or polysaccharide.
  • the most basic carbohydrate is a monosaccharide, such as glucose, sucrose, galactose, mannose, ribose, arabinose, xylose, and fructose.
  • Disaccharides are two joined monosaccharides. Exemplary disaccharides include sucrose, maltose, cellobiose, and lactose.
  • an oligosaccharide includes between three and six monosaccharide units (e.g., raffmose, stachyose), and polysaccharides include six or more monosaccharide units.
  • Exemplary polysaccharides include starch, glycogen, and cellulose.
  • Carbohydrates may contain modified saccharide units such as 2'-deoxyribose wherein a hydroxyl group is removed, 2'-fluororibose wherein a hydroxyl group is replace with a fluorine, or N-acetylglucosamine, a nitrogen- containing form of glucose (e.g., 2'-fluororibose, deoxyribose, and hexose).
  • Carbohydrates may exist in many different forms, for example, conformers, cyclic forms, acyclic forms, stereoisomers, tautomers, anomers, and isomers.
  • lipid includes fats, oils, triglycerides, cholesterol, phospholipids, fatty acids in any form including free fatty acids. Fats, oils and fatty acids can be saturated, unsaturated (cis or trans) or partially unsaturated (cis or trans).
  • the lipid comprises at least one fatty acid selected from lauric acid (12:0), myristic acid (14:0), palmitic acid (16:0), palmitoleic acid (16:1), margaric acid (17:0), heptadecenoic acid (17:1), stearic acid (18:0), oleic acid (18:1), linoleic acid (18:2), linolenic acid (18:3), octadecatetraenoic acid (18:4), arachidic acid (20:0), eicosenoic acid (20:1), eicosadienoic acid (20:2), eicosatetraenoic acid (20:4), eicosapentaenoic acid (20:5) (EPA), docosanoic acid (22:0), docosenoic acid (22:1), docosapentaenoic acid (22:5), docosahexaenoic acid (22:6) (DHA), and t
  • Additional ingredients also include supplemental minerals or mineral sources.
  • minerals include, without limitation: chloride, sodium, calcium, iron, chromium, copper, iodine, zinc, magnesium, manganese, molybdenum, phosphorus, potassium, and selenium.
  • Suitable forms of any of the foregoing minerals include soluble mineral salts, slightly soluble mineral salts, insoluble mineral salts, chelated minerals, mineral complexes, non-reactive minerals such as carbonyl minerals, and reduced minerals, and combinations thereof.
  • Additional ingredients also include one or more supplemental vitamins.
  • the vitamin can be fat-soluble or water soluble vitamins. Suitable vitamins include but are not limited to vitamin C, vitamin A, vitamin E, vitamin B12, vitamin K, riboflavin, niacin, vitamin D, vitamin B6, folic acid, pyridoxine, thiamine, pantothenic acid, and biotin. Suitable forms of any of the foregoing are salts of the vitamin, derivatives of the vitamin, compounds having the same or similar activity of the vitamin, and metabolites of the vitamin.
  • the formulations may also include excipients or buffering agents.
  • suitable excipients include a tastant, a flavorant, a buffering agent, a preservative, a stabilizer, a binder, a compaction agent, a lubricant, a dispersion enhancer, a disintegration agent, a flavoring agent, a sweetener, a coloring agent.
  • suitable buffering agents include sodium citrate, magnesium carbonate, magnesium bicarbonate, calcium carbonate, and calcium bicarbonate.
  • the formulations may also include a preservative.
  • suitable preservatives include organic acids that are naturally derived from fermentation (such as citric, ascorbic, propionic acids), antimicrobial peptides (nisin) or other suitable preservatives (such as salt, calcium sorbate, sodium sorbate).
  • Binding agents, lubricants, dispersion enhancers, disintegrants and the like may also be used as an excipient.
  • suitable binders include starches, pregelatinized starches, gelatin, polyvinylpyrolidone, cellulose, methylcellulose, sodium carboxymethylcellulose, ethylcellulose, polyacrylamides, polyvinyloxoazolidone, polyvinylalcohols, C12-C18 fatty acid alcohol, polyethylene glycol, polyols, saccharides, oligosaccharides, and combinations thereof.
  • Non-limiting examples of suitable lubricants include magnesium stearate, calcium stearate, zinc stearate, hydrogenated vegetable oils, sterotex, polyoxyethylene monostearate, talc, polyethyleneglycol, sodium benzoate, sodium lauryl sulfate, magnesium lauryl sulfate, and light mineral oil.
  • suitable dispersants include starch, alginic acid, polyvinylpyrrolidones, guar gum, kaolin, bentonite, purified wood cellulose, sodium starch glycolate, isoamorphous silicate, and microcrystalline cellulose as high HLB emulsifier surfactants.
  • Non-limiting examples of suitable non-effervescent disintegrants include starches such as com starch, potato starch, pregelatinized and modified starches thereof, sweeteners, clays, such as bentonite, micro- crystalline cellulose, alginates, sodium starch glycolate, gums such as agar, guar, locust bean, karaya, pecitin, and tragacanth.
  • the disintegrant is an effervescent disintegrant.
  • suitable effervescent disintegrants include sodium bicarbonate in combination with citric acid, and sodium bicarbonate in combination with tartaric acid.
  • Additional ingredients may also include flavoring agents, sweeteners, or coloring agents.
  • Flavoring agents incorporated into the outer layer can be chosen from synthetic flavor oils and flavoring aromatics; natural oils; extracts from plants, leaves, flowers, and fruits; and combinations thereof.
  • suitable sweeteners include glucose (com syrup), dextrose, invert sugar, fructose, and mixtures thereof (when not used as a carrier); saccharin and its various salts such as the sodium salt; dipeptide sweeteners such as aspartame; dihydrochalcone compounds, glycyrrhizin; Stevia Rebaudiana (Stevioside); chloro derivatives of sucrose such as sucralose; and sugar alcohols such as sorbitol, mannitol, sylitol, and the like.
  • suitable color agents include food, drug and cosmetic colors (FD&C), drug and cosmetic colors (D&C), and external drug and cosmetic colors (Ext. D&C).
  • Solid dosage forms for oral administration include capsules, tablets, caplets, pills, troches, lozenges, powders, and granules.
  • a capsule typically comprises a core material comprising a protein or composition and a shell wall that encapsulates the core material.
  • the core material comprises at least one of a solid, a liquid, and an emulsion.
  • the shell wall material comprises at least one of a soft gelatin, a hard gelatin, and a polymer.
  • Powders or granules embodying the polypeptides and compositions disclosed herein can be incorporated into a food product.
  • the food product is a drink for oral administration.
  • suitable drink include fruit juice, a fruit drink, an artificially flavored drink, an artificially sweetened drink, a carbonated beverage, a sports drink, a liquid diary product, a shake, an alcoholic beverage, a caffeinated beverage, infant formula, and so forth.
  • suitable means for oral administration include aqueous and nonaqueous solutions, creams, pastes, emulsions, suspensions and slurries, each of which may optionally also contain at least one of suitable solvents, preservatives, emulsifying agents, suspending agents, diluents, sweeteners, coloring agents, a tastant, a flavorant, and flavoring agents.
  • Suitable examples of a solid foodstuff include without limitation a food bar, a snack bar, a cookie, a brownie, a muffin, a cracker, a biscuit, a cream or paste, an ice cream bar, a frozen yogurt bar, and the like.
  • a formulation can contain a nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein) in an amount based on the concentration of the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein) (e.g., on a weight- to-weight basis), such that the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein) accounts for up to 100% of the weight of the formulation, meaning that all or essentially all of the matter present in the formulation is in the form of the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein).
  • a nutritive polypeptide e.g., non-naturally occurring polypeptides as described herein
  • the formulation contains 10 mg, 100 mg, 500 mg, 750 mg, 1 g, 2 g, 3 g, 4 g, 5 g, 6 g, 7 g, 8 g, 9, 10 g, 15 g, 20 g, 25 g, 30 g, 35 g, 40 g, 45 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, or over 100 g of nutritive polypeptide.
  • the polypeptides or compositions are provided in a dosage form.
  • the dosage form is designed for administration of at least one polypeptide disclosed herein, wherein the total amount of polypeptide administered is selected from 0.1 g to 1 g, 1 g to 5 g, from 2 g to 10 g, from 5 g to 15 g, from 10 g to 20 g, from 15 g to 25 g, from 20 g to 40 g, from 25 g to 50 g, and from 30 g to 60 g.
  • the dosage form is designed for administration of at least one protein disclosed herein, wherein the total amount of protein administered is selected from about 0.1 g, 0.1 g to 1 g, 1 g, 2 g, 3 g, 4 g, 5 g, 6 g, 7 g, 8 g, 9 g, 10 g, 15 g, 20 g, 25 g, 30 g, 35 g, 40 g, 45 g, 50 g, 55 g, 60 g, 65 g, 70 g, 75 g, 80 g, 85 g, 90 g, 95 g, and 100 g.
  • the protein or composition is consumed at a rate of from 0.1 g to 1 g a day, 1 g to 5 g a day, from 2 g to 10 g a day, from 5 g to 15 g a day, from 10 g to 20 g a day, from 15 g to 30 g a day, from 20 g to 40 g a day, from 25 g to 50 g a day, from 40 g to 80 g a day, from 50 g to 100 g a day, or more.
  • this disclosure provides methods of maintaining or increasing at least one of muscle mass, muscle strength, and functional performance in a subject.
  • the methods comprise providing to the subject a sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure.
  • the subject is at least one of elderly, critically - medically ill, and suffering from protein-energy malnutrition.
  • the sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure is consumed by the subject in coordination with performance of exercise.
  • the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral, enteral, or parenteral route. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral route. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an enteral route.
  • this disclosure provides methods of maintaining or achieving a desirable body mass index in a subject.
  • the methods comprise providing to the subject a sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure.
  • the subject is at least one of elderly, critically-medically ill, and suffering from protein-energy malnutrition.
  • the sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure is consumed by the subject in coordination with performance of exercise.
  • the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral, enteral, or parenteral route.
  • this disclosure provides methods of providing a polypeptide (e.g., of the disclosure) to a subject with protein-energy malnutrition.
  • the methods comprise providing to the subject a sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure.
  • the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral, enteral, or parenteral route.
  • polypeptides of this disclosure are useful for treating sarcopenia or frailty once it develops in a subject or for preventing the onset of sarcopenia or frailty in a subject who is a member of an at risk groups.
  • all of the polypeptide consumed by the subject is a polypeptide according to this disclosure.
  • polypeptides according to this disclosure are combined with other sources of protein and/or free amino acids to provide the total protein intake of the subject.
  • the subject is at least one of elderly, critically-medically ill, and suffering from protein-energy malnutrition.
  • the polypeptide according to disclosure, the composition according to disclosure, or the composition made by a method according to disclosure is consumed by the subject in coordination with performance of exercise. In some embodiments, the polypeptide according to this disclosure, the composition according to disclosure, or the composition made by a method according to disclosure is consumed by the subject by an oral, enteral, or parenteral route.
  • incorporating at least one polypeptide or composition of this disclosure into the diet of a subject has at least one effect selected from inducing postprandial satiety (including by suppressing hunger), inducing thermogenesis, reducing glycemic response, positively affecting energy expenditure positively affecting lean body mass, reducing the weight gain caused by overeating, and decreasing energy intake.
  • incorporating at least one polypeptide or composition of this disclosure into the diet of a subject has at least one effect selected from increasing loss of body fat, reducing lean tissue loss, improving lipid profile, and improving glucose tolerance and insulin sensitivity in the subject.
  • the composition including the non-naturally occurring polypeptides can be formulated for topical application.
  • the topical application can be for medical purpose or cosmetic purpose.
  • the composition may further include at least one of a carrier molecule (e.g., vehicle), a preservative, and/or additional edible ingredients.
  • any suitable carrier molecules are contemplated, and the exemplary carrier molecule may include water, oil, alcohol, propylene glycol, or emulsifiers in addition, any suitable preservatives are contemplated, and the exemplary preservatives include zinc oxide, parabens, formaldehyde releasers, isothiazolinones, phenoxyethanol, or organic acids such as benzoic acid, sodium benzoate, or butylene glycol, hexanediol, or potassium sorbate.
  • the compositions that comprise non-naturally occurring polypeptides may be personal care products (e.g., a cosmetic).
  • the compositions are formulated for topical administration.
  • the compositions can contain other cosmetic ingredients suitable for human use.
  • the personal care products may be useful for preventing or treating ultraviolet radiation damage to human skin or hair.
  • the personal care products may be useful for increasing the firmness, elasticity, brightness, hydration, tactile texture or visual texture of skin and/or stimulate collagen production.
  • the personal care products may be useful for reducing redness of the skin.
  • the personal care products may be applied to skin or hair.
  • compositions include, for example, masks, skin cleaners such as soap, cleansing creams, cleansing lotions, facial cleansers, cleansing milks, cleansing pads, facial washes, facial and body creams and moisturizers, facial serums, facial and body masks, facial toners and mists, eye creams and eye treatments, exfoliator formulas, lip balms and lipsticks, hair shampoo, hair conditioner and body shampoos, hair and scalp serums, hair mists and sprays, eye shadow, concealer, mascara and other color cosmetics.
  • skin cleaners such as soap, cleansing creams, cleansing lotions, facial cleansers, cleansing milks, cleansing pads, facial washes, facial and body creams and moisturizers, facial serums, facial and body masks, facial toners and mists, eye creams and eye treatments, exfoliator formulas, lip balms and lipsticks, hair shampoo, hair conditioner and body shampoos, hair and scalp serums, hair mists and sprays, eye shadow, concealer, mascara and other color cosmetics.
  • compositions that comprise the non-naturally occurring polypeptide can further comprise at least one additional ingredient comprising a topical carrier or a preservative.
  • the topical carrier may comprise a topical carrier selected from the group consisting of liposome, biodegradable microcapsule, lotion, spray, aerosol, dusting powder, biodegradable polymer, mineral oil, triglyceride oil, silicone oil, glycerin, glycerin monostearate, alcohols, emulsifying agents, liquid petroleum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene, wax, sorbitan monostearate, polysorbate, cetyl ester wax, cetearyl alcohol, 2- octyldodecanol, benzyl alcohol, cyclomethicone, cyclopentasiloxane and water.
  • the preservative may comprise a preservative selected from the group consisting of tocopherol, diiodomethyl-p-tolylsulfone, 2-Bromo-2-nitropropane-l,3-diol, cis isomer l-(3-chloroallyl)- 3,5,7-triaza-l-azoniaadamantane chloride, glutaraldehyde, 4,4-dimethyl oxazolidine, 7- Ethylbicyclooxazolidine, phenoxyethanol, butylene glycol, 1,2 Hexanediol, methyl paraben, sorbic acid, Germaben ® II, rosemary extract, and EDTA
  • methods of decreasing skin damage, promoting the repair of damaged skin, protecting skin against UV damage, and/or protecting skin cells against the effects of exposure to urban dust are provided.
  • the methods may comprise a step of applying a composition comprising a non-naturally occurring polypeptide of the disclosure to the skin of a subject.
  • the non-naturally occurring polypeptide in the composition may decrease skin damage by protecting against UV damage.
  • the non-naturally occurring polypeptide in the composition may promote the repair of damaged skin by increasing the viability of cells.
  • the non-naturally occurring polypeptide in the composition may decrease skin damage and/or promote repair of cells by increasing procollagen synthesis when applied to skin, and/or promoting the viability of skin cells. In some cases, the non-naturally occurring polypeptide decreases the formation of thymine-thymine (TT) dimer formation.
  • TT thymine-thymine
  • compositions for treatment indicated in the method such as by the steps provided herein.
  • the disclosure provides the use of a composition provided herein (e.g., a non-naturally occurring polypeptide or a formulation comprising a non-naturally occurring polypeptide) in a method for decreasing skin damage, promoting the repair of damaged skin, protecting skin against UV damage, and/or protecting skin cells against the effects of exposure to urban dust (e.g., such as by administering to the skin of a subject a composition provided herein).
  • a composition provided herein e.g., a non-naturally occurring polypeptide or a formulation comprising a non-naturally occurring polypeptide
  • the disclosure provides the use of a composition provided herein (e.g., a non-naturally occurring polypeptide or a formulation comprising a non-naturally occurring polypeptide) in a method for increasing the firmness, elasticity, brightness, hydration, tactile texture, or visual texture of skin and/or stimulating collagen production.
  • a composition provided herein e.g., a non-naturally occurring polypeptide or a formulation comprising a non-naturally occurring polypeptide
  • compositions or formulations comprising one or more non-naturally occurring polypeptide provided herein (e.g., for cosmetic use).
  • the composition provides any suitable amount of polypeptide provided herein, such as in any suitable amount (e.g., an amount suitable to provide a benefit when given or administered to an individual or cell).
  • the composition comprises an amount suitable to provide a beneficial effect to the skin of an individual when (e.g., topically) administered to the skin of the individual.
  • the composition comprises between 0.001% and 30% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein.
  • the composition comprises between 0.001% and 20% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 10% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 5% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 2% w/w of a polypeptide (or non- naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 1% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 0.5% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, and between 0.001% and 0.2% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein.
  • a polypeptide or
  • the concentration or amount of a non-naturally occurring polypeptide (e.g., recombinant protein) provided herein is in a composition provided herein in any suitable amount and may, e.g., vary depending on the use or formulation (e.g., gel, capsule, liquid, powder, etc.).
  • Exemplary concentrations of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can be at least about 0.01%, at least about 0.05%, at least about 0.1%, at least about 0.2 %, at least about 0.5%, at least about 1%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98% (w/v or w/w) in the composition.
  • the exemplary concentration of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can be about 0.01%, about 0.05%, about 0.1%, about 0.2 %, at least 0.5%, 1%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98% (w/v or w/w) in the composition.
  • the exemplary concentration of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can range from about 0.01% to about 99%, from about 0.05% to about 99%, from about 0.1% to about 99%, from about 0.1% to about 99%, from about 0.5% to about 99%, from about 0.1% to about 10%, from about 1% to about 99%, from about 5% to about 99%, from about 10% to about 99%, from about 15% to about 99%, from about 20% to about 99%, from about 25% to about 99%, from about 30% to about 99%, from about 35% to about 99%, from about 40% to about 99%, from about 45% to about 99%, from about 50% to about 99%, from about 55% to about 99%, from about 60% to about 99%, from about 65% to about 99%, from about 70% to about 99%, from about 75% to about 99%, from about 80% to about 99%, from about 85% to about 99%, from about 90% to about 99%
  • the exemplary concentration of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can be less than about 95%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, etc.
  • Certain aspects of the disclosure include methods of improving the appearance of the skin, the hair, and/or the nails of a subject by administering the composition to the subject. Additionally and/or alternatively, the disclosure includes a method of improving the joint health and/or restoring bone density in a subject. In some embodiments, the subject has or is suspected to have osteoporosis and/or osteoarthritis. Alternatively and/or additionally, the disclosure includes a method of improving gut health, altering or improving the microbiome of a subject, or altering and/or reducing inflammation or tissue repair in a subject.
  • the composition is administered orally in a dose and schedule sufficient or effective for improving the appearance of the skin, the hair, and/or the nails of a subject, improving the joint health and/or restoring bone density in a subject having osteoporosis and/or osteoarthritis, and/or improving gut health, altering or improving the microbiome of a subject, or altering and/or reducing inflammation or tissue repair in a subject. Any suitable dose is optionally used.
  • the dose used is from about 0.1 mg/kg to about 200 mg/kg, from about 0.2 mg/kg to about 150 mg/kg, from about 0.5 mg/kg to about 150 mg/kg, from about 0.5 mg/kg to about 100 mg/kg, from about 0.8 mg/kg to about 100 mg/kg, from about 1.0 mg/kg to about 100 mg/kg, from about 1.0 mg/kg to about 90 mg/kg, from about 1.0 mg/kg to about 80 mg/kg, from about 1.0 mg/kg to about 70 mg/kg, from about 1.0 mg/kg to about 60 mg/kg, from about 1.0 mg/kg to about 50 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 1.5 mg/kg, about 2.0 mg/kg, about 2.5 mg/kg, about 3.0 mg/kg, about 3.5 mg/kg, about 4.0 mg/kg, about 4.5 mg/kg, or about 5.0 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, or about 5.0 mg
  • the dose may increase or decrease by the schedule of the administration.
  • the dose for administering to a subject e.g., human
  • the dose for administering to a subject can be increased or decreased for about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, or about 1.0 mg/kg per each administration (e.g., for 3 consecutive administration, the dose can be increased from 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, respectively, etc.).
  • the dose for administering to a subject can be increased and then decreased, or decreased and then increased for about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, or about 1.0 mg/kg per each administration (e.g., for 5 consecutive administration, the dose can be increased from 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, then 2.2 mg/kg, and 2.0 mg/kg, respectively, etc.).
  • the schedule of administration varies depending on the purpose, gender, age, or health condition of the subject.
  • the composition is administered once a day, twice a day, three times a day, up to 6 times a day, every 2 days, every 3 days, every 4 days, every 5 days, every 6 days, etc.
  • the composition is administered a plurality of times in an irregular interval, or increased interval, or decreased interval.
  • the composition is topically applied in a dose and/or schedule sufficient or effective for improving the appearance of the skin, the hair, and/or the nails of a subject, and/or reducing inflammation in a subject.
  • the dose varies depending on the target area for the topical application (e.g., hair, skin, wound, nail, etc.), and can range from about 0.1 g/inch 2 to about 10 g/inch 2 , from about 0.1 g/inch 2 to about 9 g/inch 2 , from about 0.1 g/inch 2 to about 8 g/inch 2 , from about 0.1 g/inch 2 to about 7 g/inch 2 , from about 0.1 g/inch 2 to about 6 g/inch 2 , from about 0.1 g/inch 2 to about 5 g/inch 2 , from about 0.1 g/inch 2 to about 4 g/inch 2 , from about 0.1 g/inch 2 to about 3 g/inch 2 , from about 0.5 g/
  • the dose varies depending on the purpose, gender, age, severity of damage on the area, or health condition.
  • the composition can be applied to the target area of the subject at least three times a day, at least twice a day, once a day, up to 6 times a day, every 2 days, every 3 days, every 4 days, every 5 days, every 6 days, etc.
  • Skin appearance and quality In some embodiments, provided herein are methods of improving skin appearance and/or quality, such as by administering an effective amount of a product or composition (e.g., containing a non-naturally occurring polypeptide described herein) provided herein to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally or topically. In some instances, administration results in various changes or effects on the skin of the individual. In some instances, the skin of the individual demonstrates increased proliferation and/or reduced cell death rate (e.g., when tested using a colorimetric assay for assessing cell metabolic activity (e.g., MTT assay)).
  • a product or composition e.g., containing a non-naturally occurring polypeptide described herein
  • administration is orally or topically.
  • administration results in various changes or effects on the skin of the individual.
  • the skin of the individual demonstrates increased proliferation and/or reduced cell death rate (e.g., when tested using a colorimetric assay for
  • the skin demonstrates improved production of extracellular matrix (ECM) components such as collagen, elastin, fibronectin, fibrillin and/or decreased production of matrix degrading proteins (e.g., matrix metalloproteinases (MMPs) and proteases).
  • ECM extracellular matrix
  • MMPs matrix metalloproteinases
  • the skin shows resistance or improved outcome upon exposure to harmful agents like photodamage (e.g., UV irradiation), pollution (e.g., urban dust), and/or harsh skincare actives (e.g., retinoic acid, benzoyl peroxide, salicylic acid).
  • such resistance or improved outcome is shown via improved cell viability or proliferation (or reduced cell death) that can be assessed using MTT viability assay, via improved DNA repair that can be assessed by thymidine-dimer ELISA detection, reduced inflammation that can be assessed by Luminex detection, reduced reactive oxidative stress (ROS) that can be assessed by CM-EEDCFDA (General oxidative stress indicator) detection.
  • improved cell viability or proliferation or reduced cell death
  • MTT viability assay via improved DNA repair that can be assessed by thymidine-dimer ELISA detection
  • reduced inflammation can be assessed by Luminex detection
  • ROS reduced reactive oxidative stress
  • CM-EEDCFDA General oxidative stress indicator
  • the skin demonstrates reduction in wrinkles and/or fine lines, reduction in skin redness and/or hyperpigmentation, increase in skin brightness, decrease in pore size, decrease in skin roughness, and/or reduction in acne (e.g., when assessed using CLARITY analysis).
  • the skin demonstrates improvement in skin elasticity, increase in skin firmness, increase in skin hydration, increase in skin barrier function, increase in skin collagen and elastin content, and/or increase in dermal density.
  • hair Quality In some embodiments, provided herein are methods of improving hair appearance and/or quality, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement).
  • administration is orally or topically.
  • administration results in various changes or effects on the hair of the individual.
  • the hair demonstrates improved hair fiber thickness and/or density, increases in moisture, faster growth rate, reduced split ends, reduced frizz/increased static control, improved fiber alignment/shine, increased combability, and/or stronger resistance to hair breakage.
  • the hair demonstrates improved hair growth, thicker hair fiber diameter, increased combability, reduced hair loss, and/or increased hair tensile strength.
  • Nail Quality In some embodiments, provided herein are methods of improving nail appearance and/or quality, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally or topically. In some instances, administration results in various changes or effects on the nail of the individual. In certain instances, the nail demonstrates improved (reductions in) nail peeling, nail edge irregularities and/or nail roughness, frequency of cracked/chipped nails, and/or increases in nail growth rate.
  • a product or composition provided herein e.g., containing a non-naturally occurring polypeptide as described herein
  • administration is orally or topically.
  • administration results in various changes or effects on the nail of the individual.
  • the nail demonstrates improved (reductions in) nail peeling, nail edge irregularities and/or nail roughness, frequency of cracked/chipped nails, and/or
  • Joint health In some embodiments, provided herein are methods of improving j oint health, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally. In some instances, administration results in various changes or effects in joint health of the individual. In certain instances, the improved joint health is demonstrated by reduction in reported joint pain and/or increase in range of joint mobility.
  • a product or composition provided herein e.g., containing a non-naturally occurring polypeptide as described herein
  • administration is orally.
  • administration results in various changes or effects in joint health of the individual.
  • the improved joint health is demonstrated by reduction in reported joint pain and/or increase in range of joint mobility.
  • Inflammation in some embodiments, provided herein are methods of improving inflammatory effects, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement).
  • administration is orally or topically.
  • administration results in various changes or effects in inflammation in the individual.
  • the improved inflammatory effect is demonstrated by lower cytokine levels in the bloodstream (e.g., assessed by Luminex detection) and/or restore healthy levels of immune cells (e.g., by blood differential counts).
  • Gut health In some embodiments, provided herein are methods of improving gut health, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally. In some instances, administration results in various changes or effects in gut health of the individual. In certain instances, the improved gut health is demonstrated by improved bowel movements and/or decrease in gastrointestinal discomfort/pain.
  • a product or composition provided herein e.g., containing a non-naturally occurring polypeptide as described herein
  • administration is orally.
  • administration results in various changes or effects in gut health of the individual.
  • the improved gut health is demonstrated by improved bowel movements and/or decrease in gastrointestinal discomfort/pain.
  • Microbiome In some embodiments, provided herein are methods of altering and/or improving the microbiome, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally. In some instances, administration results in various changes or effects in the microbiome of the individual. In certain instances, the improved microbiome is demonstrated by increased diversity of microbes and/or increased abundance of beneficial microbes (e.g., assessed by 16S DNA sequencing stool samples).
  • Example 1 Generation of non-naturally occurring polypeptides of the disclosure.
  • This example shows the generation of a recombinant polypeptide of the disclosure by genetically engineered microorganisms and purification process of such generated polypeptides.
  • the polynucleotides of SEQ ID NOs: 1, 3, 5, and 7 were synthesized and at least one of the polynucleotides were inserted into a pET vector.
  • Overlaps between a pET vector and SEQ ID NOs: 1, 3, 5, and 7 were designed to be between 20 and 30 bp long and added using PCR with the enzyme PRIMESTAR ® GXL polymerase (www.takarabio.com/products/pcr/gc-rich- pcr/primestar-gxl-dna-polymerase).
  • PRIMESTAR ® GXL polymerase www.takarabio.com/products/pcr/gc-rich- pcr/primestar-gxl-dna-polymerase.
  • the opened pET vector and insert DNA e.g., polynucleotide of SEQ ID NO: 1
  • IN-FUSION ® Cloning www.takarabio.com/products/cloning/in-fusion-cloning.
  • the nucleic acid sequences were preceded by a secretion signal sequence disclosed as SEQ ID NOs: 9, 11, 13,
  • the fermentations were performed at various temperature ranging from 25° to 28° C.
  • the temperature of the fermentation was maintained at a constant temperature and immediately upon completion of fermentation the polypeptide was purified.
  • the temperature of the fermentations was maintained for a desired period of time and when cell densities of OD600 of 10-20 were reached, the temperature was reduced to induce protein production. Typically, the temperature was reduced from 28° C to 25° C. Induction was carried out by adding IPTG to the media at concentrations ranging from 0.1 - 0.5 mM. Fermentations were continued for 40-60 hours.
  • the recombinant polypeptide was purified as follows: The pH of the fermentation broth was decreased to between 3-3.5 using 5-50% Sulfuric Acid. The cells were then separated using centrifugation or centrifugation followed by microfiltration. Supernatant of the acidified broth was tested on a polyacrylamide gel and found to contain recombinant polypeptide in relatively high abundance compared to starting pellet. To obtain volume and salt reduction, concentration and diafiltration steps were performed ultrafiltration. Final polypeptide slurry was run on an SDS- PAGE gel to confirm presence of the recombinant polypeptide.
  • FIGS. 2A-2C depict SDS-PAGE gels of non-naturally occurring polypeptides of the disclosure before and after treatment at pH 3.0.
  • FIG. 2A depicts an SDS-PAGE gel of fermentation supernatant containing a non-naturally occurring polypeptide having an amino acid sequence of SEQ ID NO: 2 before (Lane 1) and after (Lane 2) treatment at pH 3.0.
  • the expected molecular weight of such polypeptide was about 17.9 kDa.
  • the identity of the polypeptide was confirmed by mass spectrometry (data not shown).
  • FIG. 2B depicts an SDS-PAGE gel of fermentation supernatant containing a non-naturally occurring polypeptide having an amino acid sequence of SEQ ID NO: 8 before (Lane 3) and after (Lane 4) treatment at pH 3.0.
  • the expected molecular weight of such polypeptide was about 17.6 kDa.
  • the identity of the polypeptide was confirmed by mass spectrometry (data not shown).
  • FIG. 2C depicts an SDS-PAGE gel of fermentation supernatant containing a non-naturally occurring polypeptide produced in various bacterial host strains having an amino acid sequence of SEQ ID NO: 8 before (Lanes 3-5) and after (Lanes 6-8) treatment at pH 3.0.
  • Example 2 Human clinical study of the non-naturally occurring polypeptides of the disclosure.
  • Skin appearance and quality Patients are recruited and/or cultured human skin cells or patient-derived skin samples are provided to evaluate the benefit of recombinant polypeptides provided herein.
  • Non-naturally occurring polypeptides as described herein (or products containing non-naturally occurring polypeptides as described herein) and control products are administered (orally or topically) to separate (in vitro or in vivo) cohorts to evaluate for various effects on skin. Skin effects are evaluated quantitatively and/or qualitatively.
  • the cultured human skin cells in vitro either primary culture or cell line
  • human skin tissue ex vivo the cultured human skin cells or cells in the human skin tissue show increased proliferation or reduced cell death rate (e.g., when tested using a colorimetric assay for assessing cell metabolic activity (e.g., MTT assay)).
  • a colorimetric assay for assessing cell metabolic activity e.g., MTT assay
  • such cultured human skin cells or cells in the human skin tissue contacted or treated with the compositions including the non-naturally occurring polypeptides described herein may show, via RNA-seq transcriptomic analysis or proteomics analysis, increased production of extracellular matrix (ECM) components such as collagen, elastin, fibronectin, fibrillin, and decreased production of matrix-degrading proteins (e.g., matrix metalloproteinases (MMPs) and proteases).
  • ECM extracellular matrix
  • MMPs matrix metalloproteinases
  • Such treated cultured human skin cells or cells in the human skin tissue are evaluated to demonstrate resistance or improved outcome upon exposure to harmful agents like photodamage (e.g., UV irradiation), pollution (e.g., urban dust), and harsh skincare actives (e.g., retinoic acid, benzoyl peroxide, salicylic acid).
  • harmful agents e.g., UV irradiation
  • pollution e.g., urban dust
  • harsh skincare actives e.g., retinoic acid, benzoyl peroxide, salicylic acid.
  • Such resistance or improved outcome is shown via improved cell viability or proliferation (or reduced cell death) that is assessed using MTT viability assay, via improved DNA repair that is assessed by thymidine-dimer ELISA detection, reduced inflammation that is assessed by Luminex detection, and/or reduced reactive oxidative stress (ROS) that is assessed by CM-EEDCFDA (General oxidative stress indicator) detection.
  • ROS reactive oxidative stress
  • composition including a non-naturally occurring polypeptide e.g., as described herein
  • the subject when applied to, or administered to the subject orally or topically on the skin, the subject’s skin is evaluated for reduction in wrinkles and fine lines, reduction in skin redness and hyperpigmentation, increase in skin brightness, decrease in pore size, decrease in skin roughness, and reduction in acne (e.g., when assessed using CLARITY analysis).
  • the skin is also further evaluated (before and after administration) to show change in skin elasticity, change in skin firmness, change in skin hydration, change in skin barrier function, change in skin collagen and elastin content, and/or change in dermal density.
  • Hair Quality Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on hair are also evaluated.
  • products e.g., containing a non-naturally occurring polypeptide as described herein
  • hair quality is measured, such as by measuring changes in hair fiber thickness and density, changes in moisture, changes in growth rate, changes in prevalence of split ends, changes in frizz/increased static control, changes in fiber alignment/shine, changes in combability, and/or changes in resistance to hair breakage (e.g., measured by in vitro hair tress testing).
  • clinical testing measures changes in hair growth, hair fiber diameter, combability, hair loss, and/or hair tensile strength.
  • Nail Quality Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on nails are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are applied to nail or orally administered to a subject, nail quality is measured, such as by measuring changes in nail hardness, nail peeling, nail edge irregularities and nail roughness, frequency of cracked/chipped nails, and/or nail growth rate.
  • products e.g., containing a non-naturally occurring polypeptide as described herein
  • nail quality is measured, such as by measuring changes in nail hardness, nail peeling, nail edge irregularities and nail roughness, frequency of cracked/chipped nails, and/or nail growth rate.
  • Joint health Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on joints are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are orally administered to a subject, joint quality is measured, such as by measuring changes in reported joint pain and/or range of joint mobility.
  • Inflammation Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on inflammation are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are orally administered to a subject, changes in inflammation are measured, cytokine levels in the bloodstream are measured (e.g., assessed by Luminex detection), and/or levels of immune cells are measured (by blood differential counts).
  • products e.g., containing a non-naturally occurring polypeptide as described herein
  • cytokine levels in the bloodstream are measured (e.g., assessed by Luminex detection), and/or levels of immune cells are measured (by blood differential counts).
  • Gut health Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) in gut health are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are orally administered to a subject, changes in bowel movements and/or gastrointestinal discomfort/pain are measured.
  • products e.g., containing a non-naturally occurring polypeptide as described herein
  • changes in bowel movements and/or gastrointestinal discomfort/pain are measured.
  • Microbiome Effects of products (e.g., containing a non-naturally occurring polypeptide described herein) provided herein (e.g., relative to control products) in the microbiome are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide described herein) are orally administered to a subject, changes in diversity of microbes or abundance of beneficial microbes is measured, which can be assessed by 16S DNA sequencing stool samples. Also, such effect can be shown in vitro as the composition supports growth of beneficial microbes in broth co-cultures.
  • Example 3 In vitro studies of non-naturally occurring polypeptides of the disclosure. [0176] This example demonstrates functional effects on cells in vitro after treatment with a non- naturally occurring polypeptide having the amino acid sequence of SEQ ID NO: 2.
  • a non-naturally occurring polypeptide of SEQ ID NO: 2 increases viability of human dermal fibroblasts.
  • a non-naturally occurring polypeptide of SEQ ID NO: 2 increases collagen type I production in human dermal fibroblasts.
  • Human primary fibroblasts were cultured in media alone (FIG. 4; “A”), or with 0.025% w/w (FIG. 4; “B”), 0.05% w/w (FIG. 4; “C”), or 0.1% w/w (FIG. 4; “D”) of a non-naturally occurring polypeptide having the amino acid sequence of SEQ ID NO: 2 for 24 hours.
  • Fibroblast production of collagen type I was determined by analyzing the supernatants with an enzyme- linked immunosorbent assay (ELISA) for pro-collagen type I C-peptide, which is a readout for total secreted collagen type I. As shown in FIG. 4, fibroblasts treated with the polypeptide of SEQ ID NO: 2 secreted higher levels of collagen type I than media control-treated fibroblasts.
  • ELISA enzyme- linked immunosorbent assay
  • a non-naturally occurring polypeptide of SEQ ID NO: 2 increases collagen type I production in human tenocytes.
  • Example 4 Sports drink containing a non-naturally occurring polypeptide of the disclosure.
  • a non-naturally occurring polypeptide of the disclosure was formulated in a sports drink.
  • Example 5 Gummies containing a non-naturally occurring polypeptide of the disclosure. [0193] In this example, a non-naturally occurring polypeptide of the disclosure was formulated in a gummy.
  • Tapioca syrup cane sugar, water, collagen peptides, citric acid, pectin, sodium citrate, natural flavor, sodium hyaluronate, fruit and vegetable juice [for color]
  • Polypeptide of SEQ ID NO: 2 has a buffering effect; tested different citrate/citric acid levels.
  • Example 6 Brownies containing a non-naturally occurring polypeptide of the disclosure.
  • (Bread) flour cane sugar, cocoa powder, water, coconut oil, polypeptide of SEQ ID NO: 2, olive oil, glycerin, vanilla extract, baking soda, salt, xanthan, lecithin.
  • Example 7 Properties of non-naturally occurring polypeptides of the disclosure related to nutritional use
  • the non-naturally occurring polypeptide of SEQ ID NO: 2 was evaluated for various properties related to nutritional use.
  • the non-naturally occurring polypeptides provided herein can be evaluated for viscosity in solution.
  • a polypeptide of SEQ ID NO: 2 was shown to be soluble up to 43% w/w at pH 4.5 and 50% w/w at pH 6.5, using a flow sweep on DHR-II rheometer with 40 mm parallel plate at 25° C.
  • a polypeptide of SEQ ID NO: 2 as a spray dried powder was found to go into solution slower in water at 50° C or higher versus water at ambient temperature. Results are depicted in FIG. 7A and FIG. 7B.
  • Interactions of a polypeptide of SEQ ID NO: 2 with hydrocolloids and oils was also evaluated. Blends of a polypeptide of SEQ ID NO: 2 and gum arabic were prepared in DI water and evaluated for viscosity in the ratios according to Table 4.
  • Blends of a polypeptide of SEQ ID NO: 2 and xanthan were prepared in DI water and evaluated for viscosity in various ratios.
  • FIG. 8 depicts results of this study.
  • SDA represents a polypeptide of SEQ ID NO: 2 spray dried at pH 6.5.
  • SDB represents a polypeptide of SEQ ID NO: 2 spray dried with a feed of 20% solids at pH 4.5.
  • the non-naturally occurring polypeptides of the disclosure can be evaluated for gel hardness in solution. Briefly, 5% protein solutions (containing a polypeptide of SEQ ID NO: 2) were crosslinked with 100 u transglutaminase enzyme. Protein and enzyme mixtures were deposited in 12-well cell plates and incubated at 50° C for 2 hours. Gels were heated to 100° C for 10 minutes to inactivate transglutaminase enzyme. Gels were cooled at ambient temperature and stored in 4° C overnight. Gel hardness was evaluated by molding 4 mL of gel mixture in 23 mm diameter wells.
  • Protein solutions were prepared in DI water or 10 mM sodium phosphate buffer, pH 7.2. Solutions were adjusted to target pH using 1M HC1 or 2N NaOH prior to addition of enzyme. Results of this study are depicted in FIG. 9.
  • Protein solutions were prepared in DI water or 10 mM sodium phosphate buffer, pH 7.2. Solutions were adjusted to target pH using 1M HC1 or 2N NaOH prior to addition of enzyme. Results are depicted in FIG. 10A and FIG. 10B. At pH 5.5, crosslinked GL21 gels range in hardness from 27-35 g. Between pH 6.3-6.4, crosslinked polypeptide gels range in hardness from 20-3 lg.
  • the non-naturally occurring polypeptides described herein can be evaluated for emulsion properties in solution.
  • Protein solutions at pH 4.5 were mixed with canola oil at a 5: 1 ratio and were homogenized using IKA Ultra Turrax at 10000 rpm for 10 min. Stability of emulsion was evaluated after 24 hours at ambient temperature in 12 mL conical tubes.
  • non-naturally occurring polypeptides described herein can be evaluated for foaming properties in solution. 10 mL of 5% w/w of a polypeptide of SEQ ID NO: 2 solution from various lots was shaken in a conical 50 mL tube for 2 minutes. Volume of foam and time of foam collapse were recorded, and results are depicted in Table 5.
  • non-naturally occurring polypeptides of the disclosure can be evaluated for sensory properties, including odor and flavor.
  • Spray dried polypeptide of SEQ ID NO: 2 from various lots was evaluated either dried or in solution, and the results are depicted in Table 6.
  • Non-naturally occurring polypeptides of the disclosure can be evaluated for solubility.
  • the effect of agglomeration with lecithin solution on compacted powder forms of a polypeptide of SEQ ID NO: 2 to increase particle size and improve solubility was evaluated.
  • 2.5 g protein powder was dropped into 50 mL water. Wettability was evaluated by observing sinking within 20 seconds. Dissolution was evaluated with 40 seconds of slow stirring and 60 seconds of rest. Results are depicted in Table 7.
  • Viscosity of solutions of a polypeptide of SEQ ID NO: 2 at 20% w/w solutions were also determined at 25° C, and results are depicted in FIG. 11.
  • 8% w/w protein solution (containing a polypeptide of SEQ ID NO: 2) at pH 5.5 and 100 u transglutaminase enzyme was homogenized with 50% w/w oil at 26000 rpm with Polytron for 1 minute on ice. 4g of mixture was deposited into each well of a 12-well cell plate and incubated for 2 hours at 50° C. Gels were heated to 100° C for 10 minutes to inactivate the enzyme. Gels were cooled at ambient temperature and stored at 4° C overnight. A polypeptide of SEQ ID NO:2 stabilized high oil emulsion during crosslinking reaction to form protein oil gel. Results are depicted in FIG.
  • Example 8 Polypeptide sequence confirmation of products and lack of hydroxyproline residues
  • the truncated collagen polypeptides of the present disclosure also differ from naturally occurring collagen polypeptides in their lack of hydroxyproline residues. Table 10. Analysis of amino acid and peptide modifications of the polypeptide of SEQ ID NO: 2.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Nutrition Science (AREA)
  • Genetics & Genomics (AREA)
  • Polymers & Plastics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Dermatology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Rheumatology (AREA)
  • Gerontology & Geriatric Medicine (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Immunology (AREA)
  • Pain & Pain Management (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)

Abstract

Provided herein are non-naturally occurring polypeptides comprising a sequence of a fragment of a collagen and recombinant cells containing heterologous nucleic acid sequences encoding the non-naturally occurring polypeptides. Further provided herein are animal-free methods of generating and purifying such non-naturally occurring polypeptides using microorganisms, preferably from bacterial cells.

Description

ANIMAL-FREE DIETARY COLLAGEN
CROSS-REFERENCE
[0001] This application claims the benefit of U.S. Provisional Application Nos. 62/965,700, filed January 24, 2020, and 63/117,243, filed November 23, 2020, which applications are incorporated herein by reference in their entirety.
BACKGROUND
[0002] Collagen is one of the most abundant proteins found in various connective tissues in the body including tendons, ligaments, skin, and hair. Collagens or collagen supplements are popular in medical, cosmetic, and/or health purposes (e.g., stimulating skin growth, promoting wound healing, strengthening nails or joints, etc.). Collagens for most collagen supplements are derived from animals as a byproduct of the animal processing industry. Yet, such animal-derived collagens may increase the risk of illness transmission as well as allergies. Moreover, certain consumers are generally interested in animal-free products for a variety of other reasons. Thus, there remains a need for improved compositions and methods of collagens derived from non animal sources.
SUMMARY
[0003] In one aspect, a non-naturally occurring polypeptide is provided comprising an amino acid sequence having: (i) at least 80% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 80% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both. In some cases, the non- naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 85% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 85% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C- terminal truncation, or both. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 90% sequence identity to SEQ ID NO: 31 with an N- terminal truncation, a C-terminal truncation, or both; or (ii) at least 90% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 95% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 95% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C- terminal truncation, or both. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having: (i) at least 98% sequence identity to SEQ ID NO: 31 with an N- tenninal truncation, a C-terminal truncation, or both; or (ii) at least 98% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both. In some cases, the non-naturally occurring polypeptide comprises: (i) the amino acid sequence of SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) the amino acid sequence of SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with an N-terminal truncation. In some cases, the N-terminal truncation is an N-terminal truncation of 50 amino acids to 600 amino acids. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with a C-terminal truncation. In some cases, the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with both an N-terminal truncation and a C-terminal truncation. In some cases, the N-terminal truncation is an N-terminal truncation of 50 amino acids to 600 amino acids, and the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids. In some cases, the non-naturally occurring polypeptide comprises the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 6. In some cases, the non-naturally occurring polypeptide consists of the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 6. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with an N-terminal truncation. In some cases, the N- terminal truncation is an N-terminal truncation of 50 amino acids to 750 amino acids. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with a C-terminal truncation. In some cases, the C- terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids. In some cases, the non-naturally occurring polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with both an N-terminal truncation and a C-terminal truncation. In some cases, the N-terminal truncation is an N-terminal truncation of 50 amino acids to 750 amino acids, and the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids. In some cases, the non-naturally occurring polypeptide comprises the amino acid sequence of SEQ ID NO: 8. In some cases, the non-naturally occurring polypeptide consists of the amino acid sequence of SEQ ID NO: 8. In some cases, the non-naturally occurring polypeptide has a total truncation of 50 amino acids to 900 amino acids. In some cases, the non- naturally occurring polypeptide is 50 amino acids to 250 amino acids in length. In some cases, the non-naturally occurring polypeptide does not comprise one or more of: a laminin G domain, a Von Willebrand factor type A (vWA) domain, and a fibrillar collagen C-terminal domain. In some cases, the non-naturally occurring polypeptide comprises one or more collagen triple helix repeats. In some cases, the non-naturally occurring polypeptide is monomeric. In some cases, the non-naturally occurring polypeptide does not form a stable triple helix structure of a naturally occurring collagen. In some cases, the non-naturally occurring polypeptide is substantially free of other collagen chains. In some cases, the non-naturally occurring polypeptide has a non- naturally occurring level of hydroxylation relative to a naturally-occurring collagen. In some cases, fewer than 10% of prolines present in the non-naturally occurring polypeptide are hydroxylated. In some cases, the non-naturally occurring polypeptide is non-hydroxylated. In some cases, the non-naturally occurring polypeptide has a non-naturally occurring level of glycosylation relative to a naturally-occurring collagen. In some cases, the non-naturally occurring polypeptide protein comprises less than 5 wt. % glycosylation.
[0004] In another aspect, a composition is provided comprising between 0.001% and 30% w/w of the non-naturally occurring polypeptide of any one of the preceding. In some cases, the composition is formulated for consumption by an individual. In some cases, the composition is a nutraceutical. In some cases, the individual is a human.
[0005] In another aspect, a method of improving the appearance of the skin, the hair, and/or the nails of a subject, and/or improving bone, muscle, and/or joint health in the subject is provided, the method comprising: administering to the subject a composition of any one of the preceding compositions. In some cases, the administering comprises orally administering to the subject. [0006] In yet another aspect, a recombinant cell is provided containing therein at least one copy of a heterologous nucleic acid sequence encoding a non-naturally occurring polypeptide of any one of the preceding. In some cases, the recombinant cell is a microbial cell. In some cases, the microbial cell is a bacterial cell. In some cases, the bacterial cell is of the species Escherichia coli. In some cases, the recombinant cell lacks an enzyme that hydroxylates one or more amino acids of the non-naturally occurring polypeptide. In some cases, the recombinant cell lacks prolyl 4-hydroxylase and/or prolyl 3 -hydroxylase. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 80% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 85% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 90% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 95% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the heterologous nucleic acid sequence comprises a nucleic acid sequence having at least 98% sequence identity to any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30. In some cases, the non-naturally occurring polypeptide further comprises a secretion signal. In some cases, the recombinant cell secretes the non-naturally occurring polypeptide into the periplasm, into a culture media, or extracellularly. In some cases, the heterologous nucleic acid sequence is codon-optimized for expression in the recombinant cell. In some cases, the heterologous nucleic acid sequence is operably linked to an inducible promoter or a constitutive promoter. In some cases, the heterologous nucleic acid is or is contained in a plasmid. In some cases, the heterologous nucleic acid sequence is stably integrated into a chromosome of the recombinant cell.
[0007] In yet another aspect, a culture medium is provided comprising a recombinant cell of any one of the preceding. In some cases, the culture medium further comprises the non-naturally occurring polypeptide of any one of the preceding secreted from the recombinant cell.
[0008] The present disclosure further provides a recombinant cell containing therein at least one copy of a heterologous nucleic acid sequence encoding collagen selected from the group consisting of: Gallus gallus collagen or Acipenser schrenckii (Japanese sturgeon) collagen. In some embodiments, the recombinant cell is a microbial cell. In some embodiments, the microbial cell is a bacterial cell. In some embodiments, the bacterial cell is of the species Escherichia coli. In some embodiments, the heterologous nucleic acid sequence comprises any one of SEQ ID NOs: 1, 3, 5, 7, 9, 11, and 25-30.
[0009] In some embodiments, the collagen is a Gallus gallus Type 21 collagen. In some embodiments, the collagen is a Acipenser schrenckii Type 2 alpha 1 collagen. In some embodiments, the collagen is a non-naturally occurring collagen. In some embodiments, the collagen is a truncated collagen. In some embodiments, the collagen comprises an amino acid sequence according to any one of SEQ ID NOs: 2, 4, 6, and 8.
[0010] In some embodiments, the collagen further comprises a secretion signal sequence. In some instances, the secretion signal sequence comprises an amino acid sequence according to any one of SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, and 24. In some embodiments, the recombinant cell secretes the collagen into a culture media. In some embodiments, the recombinant cell secretes to the periplasm. In some embodiments, the recombinant cell secrets the collagen to the extracellular space.
[0011] In some embodiments, the heterologous nucleic acid sequence is codon-optimized for expression in the recombinant cell. In some embodiments, the heterologous nucleic acid sequence is operably linked to an inducible promoter or a constitutive promoter. In some embodiments, the heterologous nucleic acid is or is contained within a plasmid. In some embodiments, the heterologous nucleic acid sequence is stably integrated into the chromosome of the recombinant cell. [0012] The present disclosure also provides a culture medium comprising a recombinant cell described herein. In some embodiments, the culture medium further comprises a recombinant collagen secreted from the recombinant cell.
[0013] The present disclosure also provides a recombinant protein comprising a sequence that has at least 90% sequence identity to a fragment of a collagen selected from the group consisting of: Gallus gallus collagen, and Acipenser schrenckii collagen. In some embodiments, the collagen is a Gallus gallus Type 21 collagen. In some embodiments, the collagen is a Acipenser schrenckii Type 2 alpha 1 collagen.
[0014] In some embodiments, the collagen is a non-naturally occurring collagen or fragment thereof. In some embodiments, the protein has a non-naturally occurring level of glycosylation ( e.g relative to a corresponding natural collagen). In some embodiments, the protein comprises less than 5 wt. % glycosylation (e.g., less than 3 wt. %, less than 1 wt. %, less than 0.5 wt. %, or less than 0.1 wt. %). In some embodiments, the protein is a truncated collagen. In some embodiments, the protein comprises an amino acid sequence according to any one of SEQ ID NOs: 2, 4, 6, and 8 (or having a sequence identity of at least 90% thereof, at least 95% thereof, at least 98% thereof, or the like).
[0015] In some embodiments, the collagen further comprises a secretion signal sequence. In some embodiments, the secretion signal sequence comprises an amino acid sequence according to SEQ ID NO: 10, 12, 14, 16, 18, 20, 22, and 24.
[0016] The present disclosure also provides a composition comprising a recombinant protein as disclosed herein. In some embodiments, the composition further comprises a culture media. Additionally and/or alternatively, the composition further comprises a recombinant cell as disclosed herein. In some embodiments, the recombinant cell is a microbial cell. In some embodiments, the microbial cell is a bacterial cell. In some embodiments, the bacterial cell is of the species Escherichia coli. In some embodiments, the recombinant cell comprises an integrated heterologous nucleic acid sequence encoding a collagen, a truncated collagen, or fragment thereof. In some embodiments, the heterologous nucleic acid sequence comprises any one of SEQ ID NOs: 1, 3, 5, 7, and 25-30.
[0017] The present disclosure also provides a process for purifying a recombinant collagen, the process comprises incubating a recombinant cell described herein in a culture media wherein the recombinant cell secretes the recombinant collagen into the culture media, collecting the culture media comprising the recombinant collagen secreted thereto, and purifying the recombinant collagen from the culture media. [0018] The present disclosure also provides a recombinant collagen purified from the culture medium disclosed in the process herein. In some embodiments, the recombinant collagen has a purity of at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%.
[0019] The present disclosure also provides an expression vector comprising a nucleic acid sequence encoding a non-naturally occurring truncated collagen operably linked to a promoter, wherein the non-naturally occurring truncated collagen is selected from the group consisting of: Gallus gallus collagen and Acipenser schrenckii collagen. In some embodiments, the nucleic acid sequence comprises any one of SEQ ID NOs: 1, 3, 5, 7, and 25-30. In some embodiments, the Gallus gallus collagen is Type 21 collagen. In some embodiments, the Acipenser schrenckii collagen is Type 2 alpha 1 collagen.
[0020] In some embodiments, the expression vector further comprises a nucleic acid sequence encoding a secretion signal sequence. In some embodiments, the nucleic acid sequence encoding the secretion signal sequence comprises any one of SEQ ID NOs: 11, 13, 15, 17, 19, 21, and 23. In some embodiments, the nucleic acid sequence is codon optimized for expression in a cell. [0021] The present disclosure also provides a composition comprising a recombinant collagen disclosed herein, formulated for consumption by an individual. In some embodiments, the composition is a nutraceutical. In some embodiments, the individual is a human. In some embodiments, the composition comprises from 0.1% to 10% recombinant collagen. In some embodiments, the composition comprises at least 50% of recombinant collagen. In some embodiments, the composition comprises from 70% to 99% of recombinant collagen. In some embodiments, the composition further comprises at least one of a carrier and a preservative. [0022] The present disclosure also provides a method of improving the appearance of the skin, the hair, and/or the nails of a subject by administering to a subject the composition disclosed herein. In some embodiments, the step of administering comprises orally administering to the subject.
[0023] Additional aspects and advantages of the present disclosure will become readily apparent to those skilled in this art from the following detailed description, wherein only illustrative embodiments of the present disclosure are shown and described. As will be realized, the present disclosure is capable of other and different embodiments, and its several details are capable of modifications in various obvious respects, all without departing from the disclosure. Accordingly, the drawings and description are to be regarded as illustrative in nature, and not as restrictive.
BRIEF DESCRIPTION OF THE DRAWINGS [0024] The novel features of the subject matter disclosed herein are set forth with particularity in the appended claims. A better understanding of the features and advantages of the subject matter disclosed herein will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the subject matter disclosed herein are utilized, and the accompanying drawings of which:
[0025] FIG. 1 shows an image of two SDS-PAGE gels showing bands of collagen proteins in supernatant samples from microbial cell cultures. The identities of each protein are indicated above each band.
[0026] FIGS.2A-2C depict images of SDS-PAGE gels showing bands of non-naturally occurring polypeptides of the disclosure before and after pH 3.0 treatment.
[0027] FIG. 3 depicts increased cell viability of human dermal fibroblasts when treated with a non-naturally occurring polypeptide of the disclosure (comprising an amino acid sequence according to SEQ ID NO: 2).
[0028] FIG. 4 depicts increased collagen type I production in human dermal fibroblasts when treated with a non-naturally occurring polypeptide of the disclosure (comprising an amino acid sequence according to SEQ ID NO: 2).
[0029] FIG. 5 depicts increased collagen type I production in tenocytes when treated with a non- naturally occurring polypeptide of the disclosure (comprising an amino acid sequence according to SEQ ID NO: 2).
[0030] FIG. 6 depicts alignments of non-naturally occurring polypeptides of the disclosure with corresponding naturally occurring collagens. FIG. 6 discloses SEQ ID NOS: 33 and 34, respectively, in order of appearance.
[0031] FIG. 7A depicts the effect of pH on viscosity of a solution of an exemplary non-naturally occurring polypeptide of the disclosure.
[0032] FIG. 7B depicts a comparison of the viscosity of a solution of an exemplary non-naturally occurring polypeptide of the disclosure versus a benchmark.
[0033] FIG. 8 depicts viscosity of various blends of an exemplary non-naturally occurring polypeptide of the disclosure and xanthan.
[0034] FIG. 9 depicts gel hardness of a solution of an exemplary non-naturally occurring polypeptide of the disclosure.
[0035] FIG. 10A and FIG. 10B depict gel hardness of solutions of various lots of an exemplary non-naturally occurring polypeptide of the disclosure.
[0036] FIG. 11 depicts the effect of compaction and lecithin agglomeration on an exemplary non- naturally occurring polypeptide of the disclosure.
[0037] FIG. 12 depicts the effect of pH and oil type on gel hardness of gels containing an exemplary non-naturally occurring polypeptide of the disclosure. DETAILED DESCRIPTION
Definitions
[0038] The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms “a”, “an”, and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including”, “includes”, “having”, “has”, “with”, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising”.
[0039] The terms “about” or “approximately” mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term “about” should be assumed to mean an acceptable error range for the particular value.
[0040] The terms “individual”, “patient”, or “subject” are used interchangeably herein. None of the terms require or are limited to a situation characterized by the supervision (e.g., constant or intermittent) of a health care worker (e.g., a doctor, a registered nurse, a nurse practitioner, a physician’s assistant, an orderly, or a hospice worker).
[0041] As used herein, the term “comprise” or variations thereof such as “comprises” or “comprising” are to be read to indicate the inclusion of any recited feature but not the exclusion of any other features. Thus, as used herein, the term “comprising” is inclusive and does not exclude additional, unrecited features. In some embodiments of any of the compositions and methods provided herein, “comprising” may be replaced with “consisting essentially of’ or “consisting of’. The phrase “consisting essentially of’ is used herein to require the specified feature(s) as well as those which do not materially affect the character or function of the claimed disclosure. As used herein, the term “consisting” is used to indicate the presence of the recited feature alone.
[0042] Throughout this disclosure, various embodiments are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of any embodiments. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as any individual numerical values within that range to the tenth of the unit of the lower limit unless the context clearly dictates otherwise. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6, etc., as well as any individual values within that range, for example, 1.1, 2, 2.3, 5, and 5.9. This applies regardless of the breadth of the range. The upper and lower limits of these intervening ranges may independently be included in the smaller ranges, and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure, unless the context clearly dictates otherwise.
[0043] The terms “treatment of’, “treating”, ‘applying”, “palliating” or “ameliorating” are used herein interchangeably. These terms refer to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and/or a prophylactic benefit. By “therapeutic benefit” is meant eradication or amelioration of the underlying disorder being treated. Also, a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient is still afflicted with the underlying disorder. For prophylactic benefit, the compositions are, in some embodiments, administered to a patient at risk of developing a particular disease or condition, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease has not been made.
[0044] The terms “subject”, “individual”, or “patient” are often used interchangeably herein. A “subject” can be a biological entity containing expressed genetic materials. The biological entity can be a plant, animal, or microorganism, including, for example, bacteria, viruses, fungi, and protozoa. The subject can be tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro. The subject can be a mammal. The mammal can be a human. The subject may be diagnosed or suspected of being at high risk for a disease. In some cases, the subject is not necessarily diagnosed or suspected of being at high risk for the disease.
[0045] The term “truncated collagen” as used herein generally refers to a polypeptide that is smaller than a full-length (e.g., natural) collagen wherein one or more portions of the full-length (e.g., natural) collagen is not present. The non-naturally polypeptides provided herein may be truncated at the C-terminal end, the N-terminal end, truncated by removal of internal portion(s) of the full-length collagen sequence (e.g., an internal truncation), truncated at both the C- terminal end and the N-terminal end, or may have one or both of a C-terminal truncation and an N-terminal truncation as well as an internal truncation. In a non-limiting embodiment, a truncated collagen may comprise an amino acid sequence according to SEQ ID NO: 2, or a homolog thereof. In another non-limiting embodiment, a truncated collagen may comprise an amino acid sequence according to SEQ ID NO: 8, or a homolog thereof.
[0046] When used in reference to an amino acid position, a “truncation” is inclusive of said amino acid position. For example, an N-terminal truncation at amino acid position 100 of a full- length protein means a truncation of 100 amino acids from the N-terminus of the full-length protein (i.e., the truncated protein is missing amino acid positions 1 through 100 of the full- length protein). Similarly, a C-terminal truncation at amino acid position 901 of a full-length protein (assuming a 1000 amino acid full-length protein) means a truncation of 100 amino acids from the C-terminus (i.e., the truncated protein is missing amino acid positions 901 through 1000 of the full-length protein). Similarly, an internal truncation at amino acid positions 101 and 200 means an internal truncation of 100 amino acids of the full-length protein (i.e., the truncated protein is missing amino acid positions 101 to 200 of the full-length protein).
[0047] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.
[0048] Provided in certain embodiments herein are, by way of non-limiting example, compositions, methods, and systems for manufacturing non-naturally occurring polypeptides, such as, e.g., animal-free collagen polypeptides or collagen-like polypeptides, as well as collagen fragments, and/or truncated collagens, such as that are expressed in and/or by genetically engineered microorganisms. Thus, in various aspects of the disclosure, the non-naturally occurring polypeptides provided herein include collagen or collagen-like polypeptides, recombinant collagens, collagen fragments, or truncated collagens. In certain embodiments, the non-naturally occurring polypeptides described herein (e.g., recombinant collagens, collagen fragments, or truncated collagens) are derived from any suitable source, such as from mammalian or non-mammalian sources. For example, in some embodiments, the non-naturally occurring polypeptides described herein (e.g., recombinant collagens, collagen fragments, or truncated collagens), or at least a portion thereof, are derived from (e.g., modified, truncated, fragments of, or the like) collagens of a bird or an avian animal (e.g., Gallus gallus collagen), a freshwater- or saltwater-fish (e.g., Acipenser schrenckii collagen), or any combination thereof.
[0049] The non-naturally occurring polypeptides provided herein are not normally found in nature. Generally, the non-naturally occurring polypeptides described herein exhibit one or more differences from naturally occurring collagens. In certain aspects, the non-naturally occurring polypeptides provided herein may have a different amino acid sequence from naturally occurring polypeptides (e.g., a truncated collagen). In some cases, the non-naturally occurring polypeptides may have a different structure from a naturally occurring collagen. The quaternary structure of natural collagen is a triple helix, typically composed of three polypeptides. In some aspects, the non-naturally occurring polypeptides described herein may not have or may not form a quaternary structure of natural collagen. For example, in some instances, the non-naturally occurring polypeptides described herein may not form the stable triple helical structure of naturally occurring collagen. In certain instances, of the three polypeptides that form natural collagen, two are usually identical and are designated as the alpha chain. The third polypeptide is designated as the beta chain. In certain instances, a typical natural collagen can be designated as AAB, wherein the collagen is composed of two alpha (“A”) strands and one beta (“B”) strand. In some aspects, the non-naturally occurring polypeptides described herein do not have the AAB structure of natural collagen. In some instances, the non-naturally occurring polypeptides described herein are free from or substantially free from different collagen chains (e.g., a non-naturally occurring polypeptide described herein may comprise an alpha chain collagen and may be free or substantially free from a beta chain collagen). In some aspects, the non-naturally occurring polypeptides described herein are monomeric (e.g., do not form multimeric structures). In other aspects, the non-naturally occurring polypeptides described herein may, in some instances, form multimeric structures with identical monomers (e.g., homodimers, homotrimers, etc.).
[0050] In some aspects, the non-naturally occurring polypeptides are recombinant polypeptides (e.g., prepared recombinantly in a host cell). The non-naturally occurring collagen is, in one embodiment, a truncated collagen. Other non-naturally occurring collagen polypeptides include chimeric collagens. A chimeric collagen is a polypeptide wherein one portion of a collagen polypeptide is contiguous with a portion of a second collagen polypeptide. For example, a collagen molecule comprising a portion of a collagen from one species contiguous with a portion of a collagen from another species is a chimeric collagen. In another embodiment, the non-naturally occurring collagen comprises a fusion polypeptide that includes additional amino acids such as a secretion tag, histidine tag, green fluorescent protein, protease cleavage site,
GEK repeats, GDK repeats, and/or beta-lactamase.
[0051] In some embodiments, the non-naturally occurring polypeptides (e.g., recombinant polypeptides) provided herein have a non-naturally occurring level of glycosylation, for example, relative to a corresponding natural collagen or naturally present collagen. For example, in some embodiments, the non-naturally occurring polypeptide (e.g., recombinant polypeptide) comprises less than 10 wt. %, less than 9 wt. %, less than 8 wt. %, less than 7 wt. %, less than 6 wt. %, less than 5 wt. %, less than 4 wt. %, less than 3 wt. %, less than 2 wt. %, less than 1 wt. %, less than 0.9 wt. %, less than 0.8 wt. %, less than 0.7 wt. %, less than 0.6 wt. %, less than 0.5 wt. %, less than 0.4 wt. %, less than 0.3 wt. %, less than 0.2 wt. %, or less than 0.1 wt. % glycosylation. Alternatively and/or additionally, the non-naturally occurring polypeptide (e.g., recombinant polypeptide) comprises less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, less than 25%, less than 20%, less than 15%, less than 10%, or less than 5% of total glycosylation of the corresponding natural collagen or naturally present collagen. For example, where the naturally present collagen ABC from a species XYZ has 20 glycosylations (throughout the full length of the collagen ABC or a portion thereof), it is contemplated that the non-naturally occurring polypeptide (e.g., recombinant polypeptide) comprises less than 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 glycosylations. In some embodiments, those lower levels of glycosylation can be specific to one or more types of glycosylation (e.g., O-glycosylation or N-glycosylation, etc.) and/or the glycosylation residues (e.g., galactosylhydroxylysine (Gal-Hyl), glucosyl galactosylhydroxylsine (GlcGal-Hyl), etc.). Non-naturally occurring polypeptides produced recombinantly (e.g., in a recombinant host cell), in some instances, may have a glycosylation level and/or a glycosylation pattern that differs from naturally occurring collagen.
[0052] In some aspects, a non-naturally occurring polypeptide provided herein has a non- naturally occurring amount of hydroxyprolines. In some cases, a non-naturally occurring polypeptide provided herein lacks hydroxyprolines. In some cases, a non-naturally occurring polypeptide provided herein comprises fewer hydroxyprolines than a naturally-occurring collagen. Hydroxyprolines include, without limitation, 3-hydroxyproline, 4-hydroxyproline, and 5-hydroxyproline. In some cases, less than about 50% (e.g., less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, or less) of the prolines present in the amino acid sequence of a non-naturally occurring polypeptide provided herein are hydroxyprolines. In some aspects, a non-naturally occurring polypeptide produced recombinantly (e.g., in a recombinant host cell) may have fewer hydroxyprolines than a naturally occurring collagen. In some cases, a recombinant polypeptide as provided herein is recombinantly expressed in a recombinant host cell (e.g., bacterial cell) that lacks an enzyme that hydroxylates one or more amino acids (e.g., proline) of the recombinant polypeptide. In some cases, a recombinant polypeptide as provided herein is recombinantly expressed in a host cell (e.g., bacterial cell) that lacks prolyl 4-hydroxylase and/or prolyl 3 -hydroxylase.
[0053] In some aspects, the non-naturally occurring polypeptides provided herein lack or substantially lack lysyl oxidation. Lysyl oxidation involves the conversion of lysine residues into highly reactive aldehydes that can form cross-links with other proteins. Naturally occurring collagens may have some level of lysyl oxidation. Thus, the non-naturally occurring polypeptides may be different from natural collagens in that they lack or substantially lack lysyl oxidation.
[0054] Generally, the non-naturally occurring polypeptides provided herein (e.g., truncated collagens) may have a function and/or provide a benefit (e.g., as provided herein) similar or substantially similar to that of a natural or a full-length collagen. In some cases, the non- naturally occurring polypeptides provided herein (e.g., truncated collagens) may have improved or increased function and/or benefit (e.g., as provided herein) as compared to a natural or a full- length collagen.
[0055] The non-naturally occurring polypeptides disclosed herein often have advantageous properties related to their monomeric structure and/or lack of amino acids capable of cross- linking with other collagen strands, e.g., the lack of hydroxy proline residues. In addition, collagen hydrolysates of the non-naturally occurring polypeptides disclosed herein are also produced with increased solubility as compared to full-length or natural collagens. Moreover, monomeric structures, as opposed to natural triple helix collagens, are more readily digestible and bioavailable, or broken down by digestive proteases. Other advantageous properties include improved physical properties in liquid compositions and in purification processes, since full- length or natural collagens or collagen strands interact to form stronger structures that can precipitate due to the presence of hydroxyproline residues.
[0056] In certain preferred embodiments, the non-naturally occurring polypeptides provided herein (e.g., truncated collagens) comprise an amino acid sequence that has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to at least a portion of the naturally existing mammalian or non-mammalian collagens from which those are derived from. In some instances, a portion or portions of a natural amino acid sequence is deleted, but the remainder of the sequence is substantially similar or identical to the natural amino acid sequence. In certain exemplary embodiments, the non-naturally occurring polypeptide has an amino acid sequence that has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Gallus gallus Type 21 alpha 1 collagen or fragment thereof. In another example, the non-naturally occurring polypeptide has an amino acid sequence that has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Acipenser schrenckii Type 2 alpha 1 collagen fragment.
[0057] In some embodiments, the recombinant protein is a truncated collagen. In certain instances, a truncated collagen is a polypeptide that is smaller than a full-length (e.g., natural) collagen wherein one or more portions (e.g., internal and/or terminal portion(s)) of the full-length (e.g., natural) collagen is not present. In various instances, the non-naturally occurring polypeptides provided herein (e.g., truncated collagens) are truncated at the C-terminal end, the N-terminal end, truncated by removal of internal portion(s) of the full-length collagen polypeptide (e.g., internal truncation), truncated at both the C-terminal end and the N-terminal end, or comprise one or both of a C-terminal truncation and an N-terminal truncation as well as an internal truncation. In some instances, the non-naturally occurring polypeptide is a fragment of a naturally occurring collagen that retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90% of a function (e.g., of interest) of natural or naturally-present corresponding collagens. In some instances, the term truncated collagen is interchangeably used with the term collagen fragment. In some instances, the truncated collagen includes any contiguous collagen fragments that are at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% of full-length natural or naturally-present corresponding collagens. In some embodiments, the truncation is an internal truncation, a truncation at the N-terminal portion of the collagen, a truncation at the C-terminal portion of the collagen, a truncation of an internal portion, or a truncation at both the C-terminal end and the N-terminal end. A truncated collagen provided herein may be truncated by from 50 amino acids to 1000 amino acids, from 50 amino acids to 950 amino acids, from 50 amino acids to 900 amino acids, from 50 amino acids to 850 amino acids, from 50 amino acids to 800 amino acids, from 50 amino acids to 750 amino acids, from 50 amino acids to 700 amino acids, from 50 amino acids to 650 amino acids, from 50 amino acids to 600 amino acids, from 50 amino acids to 550 amino acids, from 50 amino acids to 500 amino acids, from 50 amino acids to 450 amino acids, from 50 amino acids to 400 amino acids, from 50 amino acids to 350 amino acids, from 50 amino acids to 300 amino acids, from 50 amino acids to 250 amino acids, from 50 amino acids to 200 amino acids, from 50 amino acids to 150 amino acids, or from 50 amino acids to 100 amino acids. In another embodiment, a truncated collagen is truncated by 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220,
230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410,
420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600,
650, 700, 750, 800, 850, 900, 950, or 1000 amino acids.
[0058] A non-naturally occurring polypeptide (e.g., truncated collagen) disclosed herein may comprise a truncation relative to a full-length (e.g., natural) collagen. In some embodiments, a truncated collagen disclosed herein may comprise a truncation relative to a full-length (e.g., natural) chicken ( Gallus gallus ) type 21 alpha 1 collagen (e.g., SEQ ID NO: 31). In some embodiments, a truncated collagen disclosed herein may comprise the amino acid sequence of SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, an internal truncation, or a combination thereof. In some embodiments, a truncated collagen disclosed herein may comprise a truncation relative to a full-length (e.g., natural) Japanese sturgeon ( Acipenser schrenckii ) type 2 alpha 1 collagen (e.g., SEQ ID NO: 32). In some embodiments, a truncated collagen disclosed herein may comprise the amino acid sequence of SEQ ID NO: 32 with an N- terminal truncation, a C-terminal truncation, an internal truncation, or a combination thereof. Non-limiting examples of full-length (e.g., natural) collagens are provided in Table 1 below. [0059] In other embodiments, polypeptides may be truncated collagen polypeptides comparable to fish collagens, including from other species of sturgeon, or from other species producing roe suitable for caviar, including salmon, steelhead, trout, lumpfish, whitefish, or carp, as well as other fish such as tilapia and sharks. Suitable comparable sequences from Acipenser schrenckii (Japanese sturgeon) include NCBI accession numbers BA058965.1, BA058966.1,
BA058967.1, BAT51012.1, BAR72360.1, BAR72359.1, BAR72358.1, BAR72357.1 and BAR72356.1. Suitable sequences from Acipenser ruthenus (Sterlet sturgeon) include NCBI accession numbers A0A444UGW0, A0A444TZM6, A0A444UC45, A0A444UC53, A0A662YTX1, A0A662Z270, A0A662YZ39, A0A444U1F5, A0A444UJK3, A0A444UNU0, X5HZZ7, X5IHC1, A0A444UPK8, A0A444UBS1, A0A444UYQ7, A0A444TWQ3, A0A444ULY4, A0A444TZ23, A0A662YS48, A0A444U4C8, A0A444UD64, A0A662YX10, A0A662YXI2, A0A444TXQ4, A0A444TZ42, A0A444U8N8, A0A444UJU3, A0A444UQ51, A0A444U2T2, A0A662YJ50, A0A444V1V9, A0A444V113, A0A662YWR6, A0A662YW91, A0A444U5J5, A0A662YR93, A0A444UJB0, A0A444UFS4, A0A444UVK2, A0A444UJU1, A0A444ULY 9, A0A444UKA7, A0A444U5L7, A0A444V6M4, A0A444V788, A0A444UFS9, A0A444UVP7, A0A444U4D9, A0A444UHN6, A0A662YJC1, A0A444V1E8, A0A444UPM0, A0A662YU87, A0A444TZS8, A0A444U200, A0A444V2E3, A0A662YXD3, A0A662YQA4, A0A444U1H9, A0A444V7I5, A0A444UFX8, A0A444V7B8, A0A444U2K4, A0A444V762, A0A444UQ49, A0A662YMD3, A0A662YWF2, A0A444UE44, A0A444UAR6, A0A444UX46, A0A444U5P4, A0A662YRG8, A0A444USC3, A0A444UK09, A0A444UNQ7, A0A444UN69, A0A444V5D9, E6Y298, A0A444TZY1, A0A444TYS0, and E6Y299.
[0060] In other embodiments, polypeptides may be truncated collagen polypeptides comparable to chicken collagens, or other poultry collagens, such as from domestic fowls, including chickens, turkeys, geese, and ducks. Suitable comparable sequences from Gallus gallus (chicken) include NCBI accession numbers V9GZR2, Q9PSS5, A0A3Q2UDI3, Q90802, A0A1D5PNH7, Q4TZW6, Q90803, Q91014, A0A1D5PPI0, A0A1D5P1A5, A0A3Q2U6K2, A0A3Q2U8F9, Q90689, A0A3Q2U3U6, P13731, A0A1D5PFE0, A0A3Q2TXZ7, Q5FY72, A0A1D5PR16, A0A1D5PKR6, F1NDF5, Q90589, P08125, F1NRH2, P32017, A0A1D5PW49, Q90800, P12108, E1C353, Q7LZR2, P02460, A0A1L1RNI7, Q90796, P12106, F1NQ20, Q9I9K3, P20785, A0A1D5PWN6, P15988, P12105, F1NIL4, 093419, P02467, A0A5H1ZRJ7, A0A1D5PKQ4, A0A5H1ZRK9, Q90W37, A0A1D5NY11, A0A1D5P959, P02457, A0A1D5PYU1, A0A1D5PE57, Q90ZA0, Q90584, A0A1L1RZW7, A0A1D5NVM0, A0A1D5P8P3, F1NIP0, F1P2Q3, A0A1D5PE74, Q9IAU4, A0A3Q2TTC1, F1NHH4, P32018, A0A1D5P0F4, R4GHP9, A0A3Q2UD12, A0A3Q2UMJ2, A0A3Q2U4U7, F1NX22, A0A1D5P8I8, A0A1L1RPW4, P13944, P15989, F1P2F0, A0A1D5PGD5, and A0A3Q3AR07.
Table 1. Full-length collagen amino acid sequences
Figure imgf000018_0001
[0061] In some cases, a non-naturally occurring polypeptide (e.g., truncated collagen) as described herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 31) from amino acid positions 1 to 537; from amino acid positions 1 to 542; from amino acid positions 1 to 547; from amino acid positions 1 to 552; from amino acid positions 1 to 557; from amino acid positions 1 to 562; from amino acid positions 1 to 567; from amino acid positions 1 to 572; or from amino acid positions 1 to 577. In some cases, a non- naturally occurring polypeptide (e.g., truncated collagen) as described herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 31) from amino acid positions 726 to 957; from amino acid positions 731 to 957; from amino acid positions 736 to 957; from amino acid positions 741 to 957; from amino acid positions 746 to 957; from amino acid positions 751 to 957; from amino acid positions 756 to 957; from amino acid positions 761 to 957; from amino acid positions 766 to 957; from amino acid positions 769 to 957; from amino acid positions 774 to 957; from amino acid positions 779 to 957; or from amino acid positions 784 to 957. In some cases, a non-naturally occurring polypeptide as described herein (e.g., a truncated collagen) may comprise both an N-terminal truncation and a C-terminal truncation.
For example, a non-naturally occurring polypeptide (e.g., truncated collagen) as described herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 31) from amino acid positions 1 to 537; from amino acid positions 1 to 542; from amino acid positions 1 to 547; from amino acid positions 1 to 552; from amino acid positions 1 to 557; from amino acid positions 1 to 562; from amino acid positions 1 to 567; from amino acid positions 1 to 572; or from amino acid positions 1 to 577; and with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 31) from amino acid positions 726 to 957; from amino acid positions 731 to 957; from amino acid positions 736 to 957; from amino acid positions 741 to 957; from amino acid positions 746 to 957; from amino acid positions 751 to 957; from amino acid positions 756 to 957; from amino acid positions 761 to 957; from amino acid positions 766 to 957; from amino acid positions 769 to 957; from amino acid positions 774 to 957; from amino acid positions 779 to 957; or from amino acid positions 784 to 957. In a specific embodiment, a non-naturally occurring polypeptide (e.g., truncated collagen) disclosed herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N- terminal truncation at amino acid position 557 (relative to SEQ ID NO: 31); and with a C- terminal truncation at amino acid position 746 (relative to SEQ ID NO: 31). In another specific embodiment, a non-naturally occurring polypeptide (e.g., truncated collagen) disclosed herein may comprise the amino acid sequence of SEQ ID NO: 31 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at amino acid position 557 (relative to SEQ ID NO: 31); and with a C-terminal truncation at amino acid position 769 (relative to SEQ ID NO: 31).
[0062] In some cases, a non-naturally occurring polypeptide (e.g., truncated collagen) as described herein may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 32) from amino acid positions 1 to 660; from amino acid positions 1 to 665; from amino acid positions 1 to 670; from amino acid positions 1 to 675; from amino acid positions 1 to 680; from amino acid positions 1 to 685; from amino acid positions 1 to 690; from amino acid positions 1 to 695; or from amino acid positions 1 to 700. In some cases, a non-naturally occurring polypeptide (e.g., truncated collagen) as described herein may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 32) from amino acid positions 855 to 1420; from amino acid positions 860 to 1420; from amino acid positions 865 to 1420; from amino acid positions 870 to 1420; from amino acid positions 875 to 1420; from amino acid positions 880 to 1420; from amino acid positions 885 to 1420; from amino acid positions 890 to 1420; from amino acid positions 895 to 1420; or from amino acid positions 900 to 1420. In some cases, a non- naturally occurring polypeptide as described herein (e.g., a truncated collagen) may comprise both an N-terminal truncation and a C-terminal truncation. For example, a non-naturally occurring polypeptide (e.g., truncated collagen) as described herein may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at any amino acid position (e.g., relative to SEQ ID NO: 32) from amino acid positions 1 to 660; from amino acid positions 1 to 665; from amino acid positions 1 to 670; from amino acid positions 1 to 675; from amino acid positions 1 to 680; from amino acid positions 1 to 685; from amino acid positions 1 to 690; from amino acid positions 1 to 695; or from amino acid positions 1 to 700; and with a C-terminal truncation at any amino acid position (relative to SEQ ID NO: 32) from amino acid positions 855 to 1420; from amino acid positions 860 to 1420; from amino acid positions 865 to 1420; from amino acid positions 870 to 1420; from amino acid positions 875 to 1420; from amino acid positions 880 to 1420; from amino acid positions 885 to 1420; from amino acid positions 890 to 1420; from amino acid positions 895 to 1420; or from amino acid positions 900 to 1420. In a specific embodiment, a non-naturally occurring polypeptide (e.g., truncated collagen) disclosed herein may comprise the amino acid sequence of SEQ ID NO: 32 (or an amino acid sequence having at least 80% (e.g., at least 85%, at least 90%, at least 95%, at least 98%) sequence identity thereto) with an N-terminal truncation at amino acid position 680 (relative to SEQ ID NO: 32); and with a C-terminal truncation at amino acid position 880 (relative to SEQ ID NO: 32).
[0063] In some cases, a non-naturally occurring polypeptide (e.g., truncated collagen) may comprise any amino acid sequence provided herein. In some cases, a non-naturally occurring polypeptide (e.g., truncated collagen) may consist of any amino acid sequence provided herein.
In some cases, a non-naturally occurring polypeptide (e.g., truncated collagen) may consist essentially of any amino acid sequence provided herein. In specific embodiments, the non- naturally occurring polypeptide has or comprises an amino acid sequence of any one of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8. In some embodiments, a non- naturally occurring polypeptide (e.g., truncated collagen) comprises an amino acid sequence having at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to any one of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8. In some embodiments, the non-naturally occurring polypeptide consists of or consists essentially of an amino acid sequence of any one of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
[0064] In some aspects, the non-naturally occurring polypeptide may include any chimeric collagen that includes at least one non-continuous collagen fragment. For example, the non- naturally occurring polypeptide can be a chimeric collagen in which a portion of N-terminus collagen is contiguous with a portion of C-terminus collagen where the portion of N-terminus collagen and the portion of C-terminus collagen are not contiguous in the natural or naturally- present corresponding collagens. In another example, the non-naturally occurring polypeptide can be a chimeric collagen in which a portion of C-terminus collagen is contiguous with a portion of N-terminus collagen (e.g., in a flipped or reverse order - C terminus collagen is located in the N- terminus of the portion of N-terminus collagen) where the portion of C-terminus collagen and the portion of N-terminus collagen are contiguous or non-contiguous in the natural or naturally- present corresponding collagens. In another example, the non-naturally occurring polypeptide can be a chimeric collagen in which one portion of a collagen polypeptide is contiguous with a portion of a second collagen polypeptide (e.g., a collagen molecule comprising a portion of a collagen from a first species contiguous with a portion of a collagen from a second species is a chimeric collagen, etc.).
[0065] Exemplary amino acid sequences of or nucleic acid sequences encoding the recombinant proteins are provided below:
[0066] SEQ ID NO: 1 - A nucleotide sequence encoding a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken) GATACCGGTTTTCCGGGTATGCCTGGTCGTAGCGGTGATCCGGGTCGTAGCGGTAAAGATGGTC
TGCCTGGTAGCCCGGGTTTTAAAGGTGAAGTTGGTCAGCCAGGTAGCCCTGGTCTGGAAGGTCA
TCGTGGTGAACCGGGTATTCCAGGTATTCCGGGTAATCAGGGTGCAAAAGGTCAGAAAGGCGAA
ATTGGTCCTCCGGGTCTGCCAGGTGCCAAAGGTTCTCCGGGTGAAACCGGTCTGATGGGTCCTG
AAGGTAGCTTTGGCCTGCCTGGTGCACCGGGTCCGAAAGGTGACAAAGGTGAACCTGGTCTGCA
GGGTAAACCGGGTAGCAGCGGTGCAAAAGGCGAACCAGGTGGTCCGGGTGCTCCGGGTGAACCA
GGCTATCCGGGTATTCCTGGTACTCAGGGTATTAAAGGCGATAAAGGTAGCCAGGGTGAAAGCG
GTATTCAGGGTCGTAAGGGTGAAAAAGGCCGTCAGGGTAATCCAGGCCTGCAGGGCACCGAAGG
TCTGCGTGGCGAACAGGGCGAAAAAGGTGAGAAGGGTGACCCAGGCATTCGT
[0067] SEQ ID NO: 2 - Amino acid sequence of a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
DTGFPGMPGRSGDPGRSGKDGLPGSPGFKGEVGQPGSPGLEGHRGEPGIPGIPGNQGAKGQKGE IGPPGLPGAKGSPGETGLMGPEGSFGLPGAPGPKGDKGEPGLQGKPGSSGAKGEPGGPGAPGEP GYPGIPGTQGIKGDKGSQGESGIQGRKGEKGRQGNPGLQGTEGLRGEQGEKGEKGDPGIR
[0068] SEQ ID NO: 3 - A nucleotide sequence encoding a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
GATACTGGTTTCCCGGGGATGCCTGGGCGCTCAGGTGATCCGGGGCGTAGTGGAAA
AGACGGTCTGCCGGGGTCCCCGGGCTTTAAGGGTGAGGTGGGTCAGCCCGGTAGTC
CAGGTTTAGAAGGTCACCGCGGAGAGCCCGGGATTCCAGGCATTCCTGGCAACCAG
GGTGCCAAGGGACAGAAAGGCGAAATTGGTCCGCCCGGCCTACCGGGCGCGAAAG
GTTCTCCTGGTGAAACCGGTCTCATGGGTCCGGAAGGTAGCTTCGGCCTGCCCGGCG
C AC CT GGT C CGAAGGGC GAT AAGGGGGAGC CT GGGCT GC AAGGT AAAC CGGGTAG
TTCTGGCGCCAAAGGTGAACCCGGCGGTCCCGGTGCGCCAGGGGAACCAGGTTATC
CTGGTATTCCTGGAACCCAAGGAATTAAAGGTGACAAAGGCTCACAGGGCGAAAGT
GGTATACAGGGTCGCAAGGGCGAAAAAGGACGTCAGGGCAATCCAGGCCTGCAGG
GTACTGAAGGCCTGCGTGGAGAACAGGGTGAGAAAGGTGAAAAAGGAGATCCTGG
TATTCGC
[0069] SEQ ID NO: 4 - Amino acid sequence of a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
DTGFPGMPGRSGDPGRSGKDGLPGSPGFKGEVGQPGSPGLEGHRGEPGIPGIPGNQGAKGQKGE IGPPGLPGAKGSPGETGLMGPEGSFGLPGAPGPKGDKGEPGLQGKPGSSGAKGEPGGPGAPGEP GYPGIPGTQGIKGDKGSQGESGIQGRKGEKGRQGNPGLQGTEGLRGEQGEKGEKGDPGIR
[0070] SEQ ID NO: 5 - The nucleotide sequence encoding a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken) [0071] GATACTGGTTTCCCGGGGATGCCTGGGCGCTCAGGTGATCCGGGGCGTAGTGGAAAAGA
CGGTCTGCCGGGGTCCCCGGGCTTTAAGGGTGAGGTGGGTCAGCCCGGTAGTCCAGGTTTAGAA
GGTCACCGCGGAGAGCCCGGGATTCCAGGCATTCCTGGCAACCAGGGTGCCAAGGGACAGAAAG
GCGAAATTGGTCCGCCCGGCCTACCGGGCGCGAAAGGTTCTCCTGGTGAAACCGGTCTCATGGG
TCCGGAAGGTAGCTTCGGCCTGCCCGGCGCACCTGGTCCGAAGGGCGATAAGGGGGAGCCTGGG
CTGCAAGGTAAACCGGGTAGTTCTGGCGCCAAAGGTGAACCCGGCGGTCCCGGTGCGCCAGGGG
AACCAGGTTATCCTGGTATTCCTGGAACCCAAGGAATTAAAGGTGACAAAGGCTCACAGGGCGA
AAGTGGTATACAGGGTCGCAAGGGCGAAAAAGGACGTCAGGGCAATCCAGGCCTGCAGGGTACT
GAAGGCCTGCGTGGAGAACAGGGTGAGAAAGGTGAAAAAGGAGATCCTGGTATTCGCGGCATTA
ACGGTCAAAAGGGTGAAAGTGGGATACAAGGTCTTGTCGGTCCGCCCGGAGTTAGAGGCCAG
[0072] SEQ ID NO: 6 - Amino acid sequence of a truncated collagen type 21 alpha 1 polypeptide from Gallus gallus (chicken)
DTGFPGMPGRSGDPGRSGKDGLPGSPGFKGEVGQPGSPGLEGHRGEPGIPGIPGNQGAKGQKGE IGPPGLPGAKGSPGETGLMGPEGSFGLPGAPGPKGDKGEPGLQGKPGSSGAKGEPGGPGAPGEP GYPGIPGTQGIKGDKGSQGESGIQGRKGEKGRQGNPGLQGTEGLRGEQGEKGEKGDPGIRGING QKGESGIQGLVGPPGVRGQ
[0073] SEQ ID NO: 7 - The nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
GTCTGCAGGGTATGCCTGGTGAACGTGGTGCAAGCGGTATTGCCGGTGCAAAAGGTGATCGTGG
TGATGTTGGTGAAAAAGGTCCGGAAGGTGCCAGCGGTAAAGATGGTAGCCGTGGTCTGACCGGT
CCGATTGGTCCGCCTGGTCCGGCAGGTCCGAATGGCGAAAAAGGTGAAAGCGGTCCGAGCGGTC
CTCCGGGTGCAGCAGGTACTCGTGGTGCACCGGGTGATCGCGGTGAAAATGGTCCACCGGGTCC
TGCCGGTTTTGCAGGTCCGCCAGGTGCAGATGGTCAGCCTGGTGCCAAAGGCGAACAAGGCGAA
GGTGGTCAGAAAGGTGATGCAGGCGCTCCGGGTCCGCAGGGTCCTTCTGGTGCACCTGGTCCTC
AGGGTCCGACCGGTGTTTCTGGTCCGAAAGGCGCACGTGGTGCCCAGGGTCCACCTGGTGCGAC
CGGTTTTCCTGGCGCAGCAGGTCGTGTTGGTCCTCCAGGTCCTAATGGTAATCCGGGTCCAAGC
GGTCCTGCAGGTAGCGCAGGCAAAGATGGTCCTAAAGGTGTACGCGGTGATGCTGGTCCTCCTG
GCCGTGCCGGTGATGCCGGT
[0074] SEQ ID NO: 8 - Amino acid sequence of a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
GLQGMPGERGASGIAGAKGDRGDVGEKGPEGASGKDGSRGLTGPIGPPGPAGPNGEKGESGPSG
PPGAAGTRGAPGDRGENGPPGPAGFAGPPGADGQPGAKGEQGEGGQKGDAGAPGPQGPSGAPGP
QGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGPSGPAGSAGKDGPKGVRGDAGPP
GRAGDAG [0075] SEQ ID NO: 9 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 1
ATGAAAAAGATTTGGCTGGCGCTGGCTGGTTTAGTTTTAGCGTTTAGCGCATCGGCG
[0076] SEQ ID NO: 10 - Amino acid sequence of a Secretion Signal Sequence 1
MKKIWLALAGLVLAFSASA
[0077] SEQ ID NO: 11 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 2
ATGAAAAAAGGTTTCATGCTGTTCACCCTCCTCGCTGCGTTCTCTGGTTTCGCGCAGGCT
[0078] SEQ ID NO: 12 - Amino acid sequence of a Secretion Signal Sequence 2
MKKGFMLFTLLAAFSGFAQA
[0079] SEQ ID NO: 13 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 3
ATGATGATCACCCTGCGTAAACTGCCGCTGGCTGTTGCTGTTGCTGCTGGTGTTATGTCTGCTC AGGCTATGGCT
[0080] SEQ ID NO: 14 - Amino acid sequence of a Secretion Signal Sequence 3
MMITLRKLPLAVAVAAGVMSAQAMA
[0081] SEQ ID NO: 15 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 4
ATGAAAAAAACCGCTATCGCTATCGCTGTTGCTCTGGCTGGTTTCGCTACCGTTGCTCAGGCT
[0082] SEQ ID NO: 16 - Amino acid sequence of a Secretion Signal Sequence 4
MKKTAIAIAVALAGFATVAQA
[0083] SEQ ID NO: 17 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 5
ATGAAAGTTAAAGTTCTGTCTCTGCTGGTTCCGGCTCTGCTGGTTGCTGGTGCTGCTAACGCT
[0084] SEQ ID NO: 18 - Amino acid sequence of a Secretion Signal Sequence 5
MKVKVLSLLVPALLVAGAANA
[0085] SEQ ID NO: 19 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 6
ATGAAAAAAAACATCCTGTCTCTGTCTATGGTTGCTCTGTCTCTGTCTCTGGCTCTGGGTTCTG TTTCTGTTACCGCT
[0086] SEQ ID NO: 20 - Amino acid sequence of a Secretion Signal Sequence 6
MKKNILSLSMVALSLSLALGSVSVTA
[0087] SEQ ID NO: 21 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 7 ATGCTGAACCCGAAAGTTGCTTACATGGTTTGGATGACCTGCCTGGGTCTGACCCTGCCGTCTC
AGGCT
[0088] SEQ ID NO: 22 - Amino acid sequence of a Secretion Signal Sequence 7
MLNPKVAYMVWMTCLGLTLPSQA
[0089] SEQ ID NO: 23 - The nucleotide sequence encoding a secretion signal sequence named Secretion Signal Sequence 8
ATGAAACAGGCTCTGCGTGTAGCGTTCGGTTTCCTGATACTGTGGGCTTCTGTTCTGCACGCT
[0090] SEQ ID NO: 24 - Amino acid sequence of a Secretion Signal Sequence 8
MKQALRVAFGFLILWASVLHA
[0091] SEQ ID NO: 25 - A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
GGTCTGCAGGGTATGCCGGGTGAACGTGGTGCCAGCGGTATTGCAGGTGCCAAAGGTGATCGTG
GTGATGTTGGTGAAAAAGGTCCGGAAGGTGCAAGCGGTAAAGATGGTAGCCGTGGTCTGACCGG
TCCGATTGGTCCGCCGGGTCCGGCCGGTCCGAATGGTGAAAAAGGTGAAAGCGGTCCGAGCGGT
CCGCCGGGTGCAGCCGGTACCCGTGGTGCACCGGGTGATCGTGGTGAAAATGGTCCGCCGGGTC
CGGCCGGTTTTGCAGGTCCGCCGGGTGCCGATGGTCAGCCGGGTGCAAAAGGTGAACAGGGTGA
AGGTGGTCAGAAAGGTGATGCCGGTGCACCGGGTCCGCAGGGTCCGAGCGGTGCCCCGGGTCCG
CAGGGTCCGACCGGTGTTAGCGGTCCGAAAGGTGCACGTGGTGCCCAGGGTCCGCCGGGTGCAA
CCGGTTTTCCGGGTGCCGCAGGTCGTGTTGGTCCGCCGGGTCCGAATGGTAATCCGGGTCCGAG
CGGTCCGGCAGGTAGCGCCGGTAAAGATGGTCCGAAAGGTGTTCGTGGTGATGCAGGTCCGCCG
GGTCGTGCCGGTGATGCAGGTTAA
[0092] SEQ ID NO: 26 - A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
GGCCTGCAAGGCATGCCAGGCGAGCGCGGCGCGTCTGGCATCGCGGGCGCGAAGGGCGACCGCG
GCGACGTGGGCGAGAAGGGCCCTGAGGGCGCGTCCGGCAAGGACGGCTCTCGCGGCCTGACAGG
CCCAATCGGCCCTCCAGGCCCTGCGGGCCCAAACGGCGAGAAGGGCGAGTCCGGCCCTTCTGGC
CCACCTGGCGCGGCGGGCACACGCGGCGCGCCAGGCGACCGCGGCGAGAACGGCCCTCCAGGCC
CTGCGGGCTTCGCGGGCCCACCTGGCGCGGACGGCCAACCAGGCGCGAAGGGCGAGCAAGGCGA
GGGCGGCCAAAAGGGCGACGCGGGCGCGCCTGGCCCACAAGGCCCTTCTGGCGCGCCAGGCCCT
CAAGGCCCAACAGGCGTGTCCGGCCCTAAGGGCGCGCGCGGCGCGCAAGGCCCACCTGGCGCGA
CAGGCTTCCCAGGCGCGGCGGGCCGCGTGGGCCCTCCAGGCCCTAACGGCAACCCAGGCCCTTC
TGGCCCAGCGGGCTCCGCGGGCAAGGACGGCCCTAAGGGCGTGCGCGGCGACGCGGGCCCACCT
GGCCGCGCGGGCGACGCGGGCTGA
[0093] SEQ ID NO: 27 - A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon) GGTTTGCAAGGTATGCCAGGGGAACGGGGTGCGTCCGGGATAGCCGGGGCAAAAGGTGATCGAG
GCGATGTAGGAGAAAAAGGCCCAGAAGGGGCGTCAGGTAAGGACGGATCTCGCGGCTTGACGGG
ACCTATCGGGCCTCCAGGTCCCGCCGGCCCTAATGGGGAAAAAGGCGAGAGTGGGCCGTCTGGT
CCGCCCGGCGCCGCTGGCACACGTGGAGCGCCGGGCGATCGTGGTGAGAACGGACCACCGGGTC
CTGCTGGTTTTGCGGGACCTCCGGGAGCAGACGGCCAGCCGGGCGCTAAAGGTGAACAGGGTGA
AGGTGGCCAAAAAGGCGATGCAGGCGCACCGGGTCCGCAGGGCCCTTCAGGTGCACCGGGTCCA
CAGGGCCCAACTGGCGTTTCAGGGCCGAAAGGCGCAAGAGGTGCTCAGGGTCCGCCCGGGGCAA
CTGGGTTTCCTGGAGCGGCCGGCCGTGTTGGACCTCCGGGGCCGAACGGAAACCCTGGACCGTC
TGGACCAGCCGGTTCAGCGGGTAAGGATGGTCCTAAGGGTGTAAGGGGTGACGCAGGTCCCCCT
GGACGTGCAGGGGATGCGGGGTAG
[0094] SEQ ID NO: 28 - A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
GGGTTACAAGGTATGCCGGGAGAACGTGGAGCGTCAGGAATTGCTGGGGCCAAAGGTGATCGTG
GTGATGTTGGCGAGAAAGGGCCCGAAGGCGCATCTGGTAAAGATGGCTCACGCGGGTTAACTGG
ACCAATCGGACCACCAGGCCCCGCTGGGCCTAATGGTGAAAAGGGTGAAAGTGGCCCTTCTGGA
CCCCCAGGAGCCGCCGGTACACGTGGAGCGCCAGGCGATCGTGGCGAAAACGGACCGCCCGGAC
CTGCAGGTTTTGCGGGACCCCCTGGAGCAGACGGCCAACCAGGAGCAAAAGGTGAGCAAGGTGA
AGGTGGACAAAAGGGAGATGCCGGAGCGCCAGGCCCCCAAGGCCCATCAGGAGCTCCAGGACCT
CAAGGTCCAACTGGTGTATCAGGGCCTAAGGGTGCGCGCGGCGCTCAAGGACCGCCTGGCGCAA
CTGGCTTTCCGGGAGCTGCTGGTCGTGTGGGCCCGCCTGGCCCAAACGGAAATCCAGGCCCTTC
AGGCCCGGCGGGCTCAGCCGGAAAAGACGGTCCGAAGGGAGTCCGTGGAGATGCGGGACCGCCA
GGACGCGCTGGCGATGCAGGCTAA
[0095] SEQ ID NO: 29 - A codon-optimized nucleotide sequence encoding a truncated collagen type 2 alpha 1 polypeptide from Acipenser schrenckii (Japanese sturgeon)
GGTTTACAGGGAATGCCAGGGGAACGCGGCGCCTCAGGGATTGCCGGTGCTAAAGGAGATCGTG
GCGACGTGGGTGAAAAGGGTCCCGAGGGAGCATCAGGTAAGGATGGTTCCCGTGGTTTGACGGG
ACCTATTGGACCTCCGGGTCCTGCAGGTCCGAACGGCGAAAAGGGGGAAAGCGGGCCTAGTGGT
CCACCCGGCGCCGCAGGTACCCGTGGTGCCCCAGGCGACCGCGGGGAGAATGGACCGCCTGGCC
CTGCCGGTTTTGCGGGTCCTCCAGGAGCCGATGGGCAGCCCGGTGCAAAAGGAGAGCAGGGAGA
GGGAGGTCAAAAGGGAGATGCCGGCGCCCCGGGCCCTCAGGGACCAAGCGGTGCGCCAGGCCCC
CAGGGTCCTACGGGTGTTAGCGGGCCGAAAGGCGCACGCGGAGCGCAGGGCCCACCTGGTGCAA
CAGGCTTCCCAGGAGCTGCGGGGCGCGTCGGACCTCCGGGACCCAATGGAAACCCAGGTCCGTC
AGGGCCGGCAGGCTCCGCAGGGAAAGATGGTCCCAAAGGCGTGCGTGGAGACGCAGGGCCCCCC
GGACGCGCCGGCGATGCGGGATAA [0096] SEQ ID NO: 30 - A codon-optimized nucleotide sequence encoding a truncated collagen type 21 polypeptide from Gallus gallus
GATACTGGTTTCCCGGGGATGCCTGGGCGCTCAGGTGATCCGGGGCGTAGTGGAAAAGACGGTC
TGCCGGGGTCCCCGGGCTTTAAGGGTGAGGTGGGTCAGCCCGGTAGTCCAGGTTTAGAAGGTCA
CCGCGGAGAGCCCGGGATTCCAGGCATTCCTGGCAACCAGGGTGCCAAGGGACAGAAAGGCGAA
ATTGGTCCGCCCGGCCTACCGGGCGCGAAAGGTTCTCCTGGTGAAACCGGTCTCATGGGTCCGG
AAGGTAGCTTCGGCCTGCCCGGCGCACCTGGTCCGAAGGGCGATAAGGGGGAGCCTGGGCTGCA
AGGTAAACCGGGTAGTTCTGGCGCCAAAGGTGAACCCGGCGGTCCCGGTGCGCCAGGGGAACCA
GGTTATCCTGGTATTCCTGGAACCCAAGGAATTAAAGGTGACAAAGGCTCACAGGGCGAAAGTG
GTATACAGGGTCGCAAGGGCGAAAAAGGACGTCAGGGCAATCCAGGCCTGCAGGGTACTGAAGG
CCTGCGTGGAGAACAGGGTGAGAAAGGTGAAAAAGGAGATCCTGGTATTCGC
[0097] In some embodiments, the non-naturally occurring polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 2, 4, 6, and 8. In some embodiments, the non-naturally occurring polypeptide comprises an amino acid sequence having a sequence identity of at least
80%, at least 85%, at least 90%, at least 95%, or at least 98% thereof, or the like, to the amino acid sequence of any one of SEQ ID NOs: 2, 4, 6, and 8. Alternatively and/or additionally, the non-naturally occurring polypeptide is encoded by a nucleic acid sequence of any one of SEQ ID
NOs: 1, 3, 5, 7, and 25-30. In some embodiments, the non-naturally occurring polypeptide is encoded by a nucleic acid having sequence identity of at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% thereof, or the like, to the nucleic acid sequence of any one of SEQ ID NOs: 1, 3, 5, 7, and 25-30.
[0098] In some aspects, the non-naturally occurring polypeptides provided herein may or may not contain one or more domains from natural collagen. FIG. 6 depicts an alignment of exemplary non-naturally occurring polypeptides (e.g., truncated collagens) of the disclosure with the corresponding naturally occurring collagen. The top panel depicts an alignment of a non-naturally occurring polypeptide of SEQ ID NO: 2 and SEQ ID NO: 6 with Gallus gallus type 21 alpha 1 collagen (e.g., SEQ ID NO: 31). The bottom panel depicts an alignment of a non-naturally occurring polypeptide of SEQ ID NO: 8 with Acipenser schrenckii type 2 alpha 1 collagen. FIG. 6 demonstrates that non-naturally occurring polypeptides may have one or more domains found in natural collagen (e.g., collagen triple helix repeat domains). FIG. 6 further demonstrates that non-naturally occurring polypeptides may lack one or more domains found in natural collagen (e.g., Von Willebrand factor type A (vWA) domain, laminin G domain, fibrillar collagen C- terminal domain). In some aspects, a non-naturally occurring polypeptide provided herein may contain one or more collagen triple helix repeat domains. In some aspects, a non-naturally occurring polypeptide provided herein may lack one or more of a Von Willebrand factor type A (vWA) domain, a laminin G domain, and a fibrillar collagen C-terminal domain).
[0099] In some embodiments, the non-naturally occurring polypeptide (e.g., recombinant polypeptide) includes a secretion signal sequence. Any suitable secretion signal sequence (e.g., hydrophobic signaling peptides, Sec signal peptides, Tat signal peptides, etc.) that can induce the non-naturally occurring polypeptide (e.g., recombinant polypeptide) to be secreted to the periplasmic and/or extracellular space (e.g., when produced in a recombinant host cell). Exemplary secretion signal sequences includes a peptide having an amino acid sequence of any one of SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, and 24. Alternatively and/or additionally, the secretion signal sequence includes a peptide encoded by a nucleic acid sequence of any one of SEQ ID NOs: 9, 11, 13, 15, 17, 19, 21, and 23. The secretion signal sequence is preferably located in the N-terminus of the non-naturally occurring polypeptide (e.g., recombinant polypeptide). Yet, it is contemplated that the secretion signal sequence can be located at other than N-terminus where the secretion signal sequence remains functional.
[0100] The non-naturally occurring polypeptide (e.g., recombinant polypeptide) as described herein can be expressed or generated via a nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide). Thus, another aspect of the disclosure includes an expression vector comprising a nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide). In some embodiments, the expression vector is a bacterial expression vector. In some embodiments, the expression vector is a yeast expression vector. In some embodiments, the expression vector is an insect expression vector. Any suitable expression vector that can induce the protein expression from the inserted nucleic acid encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide). Exemplary bacterial expression vectors may include pGEX vectors where glutathione S- transferase is used as a fusion partner and gene expression is under the control of the tac promoter, or pET vectors (e.g., pET28 vector, etc.) which uses a T7 promoter. Exemplary yeast expression vectors may include pPIC vectors, which uses the AOX1 promoter inducible with methanol. In some embodiments, the expression vector is in a plasmid form (e.g., including bacterial artificial chromosome form, etc.) that are independently present in the host cell (e.g., cells expressing the recombinant polypeptide). In some embodiments, the expression vector is stably integrated into the chromosome of the host cell via random or targeted integration.
[0101] In some embodiments, the nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide) is codon-optimized to be expressed in non-animal cells, preferably in bacterial cells. As used herein, “codon-optimized” means that the codon composition is improved for expression in the heterologous cells (e.g., microbial cells, bacterial cells, etc.) without altering the encoded amino acid sequences. Non-limiting examples of codon- optimized nucleic acid sequences (e.g., encoding a non-naturally occurring polypeptide as described herein) include SEQ ID NOs: 25-30.
[0102] In some embodiments, the expression vector may include one or more selection agent. The selection agents include certain sugars including galactose containing sugars or antibiotics including ampicillin, hygromycin, G418 and others. Enzymes that are used to confer resistance to the selection agent include b-galactosidase or a b-lactamase. Alternatively and/or additionally, the expression vector includes an inducible promoter or a constitutive promoter (e.g., CMV promoter, etc.) such that the nucleic acid encoding the recombinant protein is operatively linked to the inducible promoter or the constitutive promoter. For example, the expression vector may include tetracycline-inducible promoter pTET, araC-ParaBAD inducible promoter, or IPTG inducible lac promoter. As used herein, “operatively linked” promoter and nucleic acid means that the expression of the nucleic acid (e.g., transcription, translation, etc.) is at least under partial control of the promoter.
[0103] In some embodiments, the nucleic acid encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide) (e.g., a nucleic acid of any one of SEQ ID NOs: 1, 3, 5, 7, and 25- 30), and the expression vector may have an overlap of from 20 to 50 bp long, from 20 to 40 bp long, from 20 to 30 bp long, or from 30 to 40 bp long. Such overlap can be added using PCR with aDNA polymerase (e.g., PRIMESTAR® GXL polymerase (www.takarabio.com/products/pcr/gc- rich-pcr/primestar-gxl-dna-polymerase)). Opened expression vector and the insert nucleic acid encoding the non-naturally occurring polypeptide (e.g., recombinant polypeptide) can be assembled together into the final plasmid using any suitable cloning system (e.g., IN-FUSION® Cloning (www.takarabio.com/products/cloning/in-fusion-cloning) or SGI Gibson assembly (us.vwr.com/store/product/17613857/gibson-assembly-hifi-l-step-kit-synthetic-genomics-inc)). [0104] Such prepared expression vector (or plasmid) can be used to generate genetically engineered or modified organisms, or a recombinant cell to produce the non-naturally occurring polypeptides described herein (e.g., collagens, truncated collagens, or collagen fragments). Preferably, the recombinant cells contain at least one copy of a plasmid or a stably integrated heterologous nucleic acid sequence encoding the non-naturally occurring polypeptide (e.g., collagens, truncated collagens, or collagen fragments, preferably collagens, truncated collagens, or collagen fragments of, or derived from, Gallus gallus collagen and/or Acipenser schrenckii collagen). In some embodiments, the recombinant cell is a microbial cell. For example, where the expression vector is bacterial expression vector, the expression vector can be inserted into (e.g., via any suitable transformation method) the bacterial cells for protein expression (e.g., Escherichia coli including BL-21 cells, etc.) to be independently present in the cytoplasm of the bacteria (e.g., as a plasmid form) or to be at least temporarily and/or stably integrated into the bacterial chromosome.
[0105] Consequently, the transformed cells can be cultivated in a suitable media. Preferably, the suitable media includes a minimal media and the cells are frozen in 1.5 aliquots with vegetable glycerin at a ratio of 50:50 of cells of cells to glycerin. For protein expression, one vial of the frozen cultured cells can be cultured in a suitable amount of bacteria culture media (e.g., minimal media, 50ml, 100ml, etc.) for at least 6 hours, at least 8 hours, at least 10 hours, at least 12 hours, at least overnight at at least 36 °C, preferably at about 37 °C by continuously shaking the culture (e.g., at least 100 rpm, at least 200 rpm, at least 250 rpm, etc.). Table 2 and Table 3 show the exemplary formulation of the minimal media that can be used for cell cultivation and culture.
[0106] Table 2: Minimal Media Formulation
Figure imgf000030_0001
[0107] Table 3: Trace metals formulation
Figure imgf000030_0002
[0108] In some embodiments, transformed cells can then be transferred to a larger volume of growth media (e.g., minimal media) and grown for at least 4 hours, at least 5 hours, at least 6 hours, at least 7 hours, at least 8 hours, from 5 to 10 hours, from 5 to 9 hours, from 6 to 9 hours, and/or alternatively until the cell density in the media reaches optical density (OD) of 600.
[0109] Additionally, fermentation process can be performed at various temperature ranging from 22 °C to 33 °C, from 29 °C to 33 °C, from 30 °C to 32 °C, from 23 °C to 29 °C, or from 25 °C to 28 °C. In some embodiments, the temperature of the fermentation can be maintained at a constant temperature and immediately upon completion of fermentation the non-naturally occurring polypeptide can be purified. Alternatively, the temperature of the fermentations can be maintained for a desired period of time and when cell densities of OD600 of 10-20 are reached, then the temperature can be reduced to induce protein production. In such embodiments, typically, the temperature is reduced from 28° C to 25° C. During the fermentation, protein expression in the bacteria can be induced by adding induction reagent. For example, where the expression vector contains lac promoter and the nucleic acid encoding the non-naturally occurring polypeptide (e.g., truncated collagen, collagen fragments, or collagen) is under the control of the lac promoter, the expression of the nucleic acid can be induced by adding isopropyl b-d-l-thiogalactopyranoside (IPTG) at a concentration ranging from 0.1 - 1.5 mM, from 0.1 - 1.0 mM, or from 0.1 - 0.5 mM. Fermentation can be continued for 20-24 hours, or in some embodiments, for 40-60 hours.
[0110] It is contemplated that such generated recombinant cells (e.g., recombinant bacteria transformed with the expression vector) intracellularly express the non-naturally occurring polypeptides (e.g., truncated collagen, collagen fragments, or collagen) encoded by the nucleic acids in the expression vector. Such intracellularly expressed polypeptides (e.g., truncated collagen, collagen fragments, or collagen) can then be secreted (via a secretion signal sequence) to the extracellular space (e.g., into a culture media). Thus, in some embodiments, the culture media can contain secreted recombinant protein (e.g., truncated collagen, collagen fragments, or collagen) encoded by the nucleic acids.
[0111] Thus, another aspect of the disclosure includes a composition including the non-naturally occurring polypeptide (e.g., recombinant collagen, truncated collagen, collagen fragments, or collagen) encoded by the nucleic acids. In some embodiments, the composition may include the recombinant cell comprising an integrated heterologous nucleic acid sequence encoding a non- naturally occurring polypeptide (e.g., collagen, a truncated collagen, or fragment thereof), and/or the culture medium (e.g., growth media, cultivation media, etc.) for the recombinant cell.
[0112] Alternatively and/or additionally, the composition may include purified recombinant proteins from the recombinant cells and/or the culture medium. In some embodiments, the recombinant proteins are purified from the culture medium where the recombinant cells grow and secrete the recombinant proteins thereto. In some embodiments, the recombinant protein is coupled with a tag (e.g., histidine tag, etc) such that the recombinant protein can be purified using affinity purification is known as immobilized metal affinity chromatography (IMAC). Alternatively, the recombinant protein can be purified via column chromatography. For example, the recombinant protein can be purified by acid treatment of homogenized growth media. In such example, the pH of the growth media (e.g., fermentation broth) can be decreased to from 3 to 3.5 using 5-50% sulfuric Acid. The recombinant cells are then separated using centrifugation. Supernatant of the acidified broth can be tested on a polyacrylamide gel and determined whether it contains the recombinant protein in relatively high abundance compared to starting pellet. The recombinant protein slurry obtained is generally high in salts. To obtain volume and salt reduction, concentration and diafiltration steps can be performed using filtration steps. For example, the filtration step can be performed using EMD Millipore Tangential Flow Filtration system with ultrafiltration cassettes of 0.1 m2 each. Total area of filtration in this example can be 0.2 m2 using two cassettes in parallel. A volume reduction of 5x and a salt reduction of 19x can be achieved in the TFF stage. Final collagen slurry can be run on an SDS-PAGE gel to confirm presence of the recombinant protein. The purified recombinant protein can then be analyzed on an SDS-PAGE gel to identify a corresponding thick and clear band observed at the expected sizes for each respective protein. Quantification of titers and purity can be further conducted using reverse phase and size exclusion HPLC chromatography. It is preferred that the purity of the purified recombinant proteins is at least at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%.
[0113] In some embodiments, the composition including the non-naturally occurring polypeptides provided herein (e.g., recombinant proteins and/or purified recombinant proteins) can be formulated for consumption by an individual (e.g., a human, a patient, a person, an animal, etc.). In some embodiments, the non-naturally occurring polypeptides (e.g., recombinant proteins and/or purified recombinant proteins) can be formulated for oral consumption as nutraceutical supplements. In some embodiments, the non-naturally occurring polypeptides (e.g., recombinant proteins and/or purified recombinant proteins) can be formulated for oral consumption as a food product or a food ingredient. In some embodiments, the non-naturally occurring polypeptides can be formulated as a protein supplement. Optionally, in such embodiments, the non-naturally occurring polypeptides (e.g., recombinant proteins and/or purified recombinant proteins) can be mixed with at least one of a carrier molecule, a preservative, and/or additional edible ingredients. Thus, for example, the composition may include vitamins (e.g. vitamin A, vitamin B, vitamin C, vitamin D, vitamin E, etc.), minerals (e.g., calcium, zinc, copper, manganese, chromium, molundenum, boron, etc), sugar (e.g., cellulose, dextrose, maltose, etc.), and/or natural extracts (e.g., herb, ginseng, echinacea, green tea, glucosamine, omega-3, lutein, folic acid, liver oil, fish oil, coffee extracts, etc.). Formulations suitable for consumption by an individual (e.g., a human) include, without limitation, ready-to-mix powders, ready-to-drink beverages, functional shots, supplement tablets and capsules, coffee creamers, bars, bites or baked goods, “no bone” broth, non-dairy frozen novelty, gummies (e.g., candy), chocolates, and meat snacks. Non-limiting examples of formulations containing the non-naturally occurring polypeptides are provided in Examples 4-6.
[0114] A composition, formulation, or product is "nutritional" or "nutritive" if it provides an appreciable amount of nourishment to its intended consumer, meaning the consumer assimilates all or a portion of the composition or formulation into a cell, organ, and/or tissue. Generally, such assimilation into a cell, organ, and/or tissue provides a benefit or utility to the consumer, e.g., by maintaining or improving the health and/or natural function(s) of said cell, organ, and/or tissue. A nutritional composition or formulation that is assimilated as described herein is termed “nutrition”. By way of non-limiting example, a polypeptide is nutritional if it provides an appreciable amount of polypeptide nourishment to its intended consumer, meaning the consumer assimilates all or a portion of the protein, typically in the form of single amino acids or small peptides, into a cell, organ, and/or tissue. “Nutrition” also means the process of providing to a subject, such as a human or other mammal, a nutritional composition, formulation, product, or other material. A nutritional product need not be “nutritionally complete”, meaning if consumed in sufficient quantity, the product provides all carbohydrates, lipids, essential fatty acids, essential amino acids, conditionally essential amino acids, vitamins, and minerals required for health of the consumer. Additionally, a “nutritionally complete protein” contains all protein nutrition required (meaning the amount required for physiological normalcy by the organism) but does not necessarily contain micronutrients such as vitamins and minerals, carbohydrates, or lipids.
[0115] In preferred embodiments, a composition or formulation is nutritional in its provision of polypeptide capable of decomposition (e.g., the breaking of a peptide bond, often termed protein digestion) to single amino acids and/or small peptides (e.g., two amino acids, three amino acids, or four amino acids, possibly up to ten amino acids) in an amount sufficient to provide a “nutritional benefit”. In addition, in certain embodiments provided are nutritional polypeptides that transit across the gastrointestinal wall and are absorbed into the bloodstream as small peptides (e.g., larger than single amino acids but smaller than about ten amino acids) or larger peptides, oligopeptides, or polypeptides (e.g., >11 amino acids). A nutritional benefit in a polypeptide-containing composition can be demonstrated and, optionally, quantified, by a number of metrics. For example, a nutritional benefit is the benefit to a consuming organism equivalent to or greater than at least about 0.5% of a reference daily intake value of protein, such as about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100% or greater than about 100% of a reference daily intake value. Alternatively, a nutritional benefit is demonstrated by the feeling and/or recognition of satiety by the consumer. In other embodiments, a nutritional benefit is demonstrated by incorporation of a substantial amount of the polypeptide component of the composition or formulation into the cells, organs, and/or tissues of the consumer, such incorporation generally meaning that single amino acids or short peptides are used to produce polypeptides de novo intracellularly. A “consumer” or a “consuming organism” means any animal capable of ingesting the product having the nutritional benefit. Typically, the consumer is a mammal such as a healthy human, e.g., a healthy infant, child, adult, or older adult. Alternatively, the consumer is a mammal such as a human (e.g., an infant, child, adult, or older adult) at risk of developing or suffering from a disease, disorder, or condition characterized by (i) the lack of adequate nutrition and/or (ii) the alleviation thereof by the nutritional products of the present disclosure. An “infant” is generally a human under about age 1 or 2, a “child” is generally a human under about age 18, and an “older adult” or “elderly” human is a human aged about 65 or older.
[0116] Herein provided are nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein) capable of transforming health and treating, preventing and reducing the severity of a multitude of diseases, disorders, and conditions associated with amino acid pathophysiology, as they are selected for specific physiologic benefits to improve health and address many nutrition-related conditions, including gastrointestinal malabsorption, muscle wasting, diabetes or pre-diabetes, obesity, oncology, metabolic diseases, and other cellular and systemic diseases. Also provided are the compositions and formulations that contain the nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein), as food, beverages, medical foods, supplements, and pharmaceuticals.
[0117] Nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein) can be evaluated for their physicochemical and functional properties can be evaluated (see, e.g., Example 7). Such properties may include digestibility, allergenicity, thermostability, solubility, aggregation, toxicity, taste, and mouth/feel characteristics.
[0118] In some embodiments, the formulations are incorporated into food products having advantages over similar food products lacking the nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein), or the formulations are incorporated into other products such as beverage products or animal feed products. For example, the food products have a reduced fat content, a reduced sugar content, and/or a reduced calorie content compared to a food product not having the nutritive polypeptide (e.g., non-naturally occurring polypeptides described herein). Preferably, the nutritive polypeptide (e.g., non-naturally occurring polypeptides described herein) is present in the food product such that consumption of a nutritional amount of the food product is satiating. In an embodiment, gelatin, an animal- derived material, is replaced by a non-animal derived product, containing one or more nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein). Typically the nutritive polypeptide (e.g., non-naturally occurring polypeptides described herein) is present in an amount effective to replace gelatin in the product. The gelatin replacement is incorporated into a food product, a beverage product, or an animal feed product, and the formulation is substantially free of non-comestible products.
[0119] Also provided herein are formulations containing a nutritive polypeptide (e.g., non- naturally occurring polypeptides described herein) present in a functional and/or nutritional amount, which increases the viscosity of a food or beverage product, such as formulations containing viscosity-increasing nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein) incorporated into food products having advantages over similar food products lacking the nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein). For example, the food products have a reduced fat content, a reduced sugar content, and/or a reduced calorie content compared to a food product not having the nutritive polypeptide (e.g., non-naturally occurring polypeptides described herein). Viscous nutritive polypeptides (e.g., non-naturally occurring polypeptides described herein) can be used as a nutritionally favorable low calorie substitute for fat. Additionally, it may be desired to add to the compositions and products one or more polysaccharides or emulsifiers, resulting in a further improvement in the creamy mouthfeel.
[0120] In certain embodiments, the non-naturally occurring polypeptides of the disclosure may be combined with other ingredients to provide combination products. Such ingredients may include carbohydrates, lipids, supplemental minerals, supplemental vitamins, excipients or buffering agents, flavoring agents, sweeteners, or coloring agents.
[0121] A “carbohydrate” refers to a sugar or polymer of sugars. The terms “saccharide”, “polysaccharide,” “carbohydrate”, and “oligosaccharide” can be used interchangeably. Most carbohydrates are aldehydes or ketones with many hydroxyl groups, usually one on each carbon atom of the molecule. Carbohydrates generally have the molecular formula CnH2nOn. A carbohydrate can be a monosaccharide, a disaccharide, trisaccharide, oligosaccharide, or polysaccharide. The most basic carbohydrate is a monosaccharide, such as glucose, sucrose, galactose, mannose, ribose, arabinose, xylose, and fructose. Disaccharides are two joined monosaccharides. Exemplary disaccharides include sucrose, maltose, cellobiose, and lactose. Typically, an oligosaccharide includes between three and six monosaccharide units (e.g., raffmose, stachyose), and polysaccharides include six or more monosaccharide units. Exemplary polysaccharides include starch, glycogen, and cellulose. Carbohydrates may contain modified saccharide units such as 2'-deoxyribose wherein a hydroxyl group is removed, 2'-fluororibose wherein a hydroxyl group is replace with a fluorine, or N-acetylglucosamine, a nitrogen- containing form of glucose (e.g., 2'-fluororibose, deoxyribose, and hexose). Carbohydrates may exist in many different forms, for example, conformers, cyclic forms, acyclic forms, stereoisomers, tautomers, anomers, and isomers.
[0122] As used herein a “lipid” includes fats, oils, triglycerides, cholesterol, phospholipids, fatty acids in any form including free fatty acids. Fats, oils and fatty acids can be saturated, unsaturated (cis or trans) or partially unsaturated (cis or trans). In some embodiments the lipid comprises at least one fatty acid selected from lauric acid (12:0), myristic acid (14:0), palmitic acid (16:0), palmitoleic acid (16:1), margaric acid (17:0), heptadecenoic acid (17:1), stearic acid (18:0), oleic acid (18:1), linoleic acid (18:2), linolenic acid (18:3), octadecatetraenoic acid (18:4), arachidic acid (20:0), eicosenoic acid (20:1), eicosadienoic acid (20:2), eicosatetraenoic acid (20:4), eicosapentaenoic acid (20:5) (EPA), docosanoic acid (22:0), docosenoic acid (22:1), docosapentaenoic acid (22:5), docosahexaenoic acid (22:6) (DHA), and tetracosanoic acid (24:0). In some embodiments the composition comprises at least one modified lipid, for example a lipid that has been modified by cooking.
[0123] Additional ingredients also include supplemental minerals or mineral sources. Examples of minerals include, without limitation: chloride, sodium, calcium, iron, chromium, copper, iodine, zinc, magnesium, manganese, molybdenum, phosphorus, potassium, and selenium. Suitable forms of any of the foregoing minerals include soluble mineral salts, slightly soluble mineral salts, insoluble mineral salts, chelated minerals, mineral complexes, non-reactive minerals such as carbonyl minerals, and reduced minerals, and combinations thereof.
[0124] Additional ingredients also include one or more supplemental vitamins. The vitamin can be fat-soluble or water soluble vitamins. Suitable vitamins include but are not limited to vitamin C, vitamin A, vitamin E, vitamin B12, vitamin K, riboflavin, niacin, vitamin D, vitamin B6, folic acid, pyridoxine, thiamine, pantothenic acid, and biotin. Suitable forms of any of the foregoing are salts of the vitamin, derivatives of the vitamin, compounds having the same or similar activity of the vitamin, and metabolites of the vitamin.
[0125] The formulations may also include excipients or buffering agents. Non-limiting examples of suitable excipients include a tastant, a flavorant, a buffering agent, a preservative, a stabilizer, a binder, a compaction agent, a lubricant, a dispersion enhancer, a disintegration agent, a flavoring agent, a sweetener, a coloring agent. Non-limiting examples of suitable buffering agents include sodium citrate, magnesium carbonate, magnesium bicarbonate, calcium carbonate, and calcium bicarbonate.
[0126] The formulations may also include a preservative. Non-limiting examples of suitable preservatives include organic acids that are naturally derived from fermentation (such as citric, ascorbic, propionic acids), antimicrobial peptides (nisin) or other suitable preservatives (such as salt, calcium sorbate, sodium sorbate).
[0127] Binding agents, lubricants, dispersion enhancers, disintegrants and the like may also be used as an excipient. Non-limiting examples of suitable binders include starches, pregelatinized starches, gelatin, polyvinylpyrolidone, cellulose, methylcellulose, sodium carboxymethylcellulose, ethylcellulose, polyacrylamides, polyvinyloxoazolidone, polyvinylalcohols, C12-C18 fatty acid alcohol, polyethylene glycol, polyols, saccharides, oligosaccharides, and combinations thereof. Non-limiting examples of suitable lubricants include magnesium stearate, calcium stearate, zinc stearate, hydrogenated vegetable oils, sterotex, polyoxyethylene monostearate, talc, polyethyleneglycol, sodium benzoate, sodium lauryl sulfate, magnesium lauryl sulfate, and light mineral oil. Non-limiting examples of suitable dispersants include starch, alginic acid, polyvinylpyrrolidones, guar gum, kaolin, bentonite, purified wood cellulose, sodium starch glycolate, isoamorphous silicate, and microcrystalline cellulose as high HLB emulsifier surfactants. Non-limiting examples of suitable non-effervescent disintegrants include starches such as com starch, potato starch, pregelatinized and modified starches thereof, sweeteners, clays, such as bentonite, micro- crystalline cellulose, alginates, sodium starch glycolate, gums such as agar, guar, locust bean, karaya, pecitin, and tragacanth. In some embodiments the disintegrant is an effervescent disintegrant. Non-limiting examples of suitable effervescent disintegrants include sodium bicarbonate in combination with citric acid, and sodium bicarbonate in combination with tartaric acid.
[0128] Additional ingredients may also include flavoring agents, sweeteners, or coloring agents. Flavoring agents incorporated into the outer layer can be chosen from synthetic flavor oils and flavoring aromatics; natural oils; extracts from plants, leaves, flowers, and fruits; and combinations thereof. Non-limiting examples of suitable sweeteners include glucose (com syrup), dextrose, invert sugar, fructose, and mixtures thereof (when not used as a carrier); saccharin and its various salts such as the sodium salt; dipeptide sweeteners such as aspartame; dihydrochalcone compounds, glycyrrhizin; Stevia Rebaudiana (Stevioside); chloro derivatives of sucrose such as sucralose; and sugar alcohols such as sorbitol, mannitol, sylitol, and the like. Non-limiting examples of suitable color agents include food, drug and cosmetic colors (FD&C), drug and cosmetic colors (D&C), and external drug and cosmetic colors (Ext. D&C).
[0129] Solid dosage forms for oral administration include capsules, tablets, caplets, pills, troches, lozenges, powders, and granules. A capsule typically comprises a core material comprising a protein or composition and a shell wall that encapsulates the core material. In some embodiments, the core material comprises at least one of a solid, a liquid, and an emulsion. In some embodiments, the shell wall material comprises at least one of a soft gelatin, a hard gelatin, and a polymer.
[0130] Powders or granules embodying the polypeptides and compositions disclosed herein can be incorporated into a food product. In some embodiments the food product is a drink for oral administration. Non-limiting examples of a suitable drink include fruit juice, a fruit drink, an artificially flavored drink, an artificially sweetened drink, a carbonated beverage, a sports drink, a liquid diary product, a shake, an alcoholic beverage, a caffeinated beverage, infant formula, and so forth. Other suitable means for oral administration include aqueous and nonaqueous solutions, creams, pastes, emulsions, suspensions and slurries, each of which may optionally also contain at least one of suitable solvents, preservatives, emulsifying agents, suspending agents, diluents, sweeteners, coloring agents, a tastant, a flavorant, and flavoring agents.
[0131] Suitable examples of a solid foodstuff include without limitation a food bar, a snack bar, a cookie, a brownie, a muffin, a cracker, a biscuit, a cream or paste, an ice cream bar, a frozen yogurt bar, and the like.
[0132] A formulation can contain a nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein) in an amount based on the concentration of the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein) (e.g., on a weight- to-weight basis), such that the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein) accounts for up to 100% of the weight of the formulation, meaning that all or essentially all of the matter present in the formulation is in the form of the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein). More typically, about 99%, about 98%, about 97%, about 96%, about 95%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or less than about 5% of the weight present in the formulation is in the form of the nutritive polypeptide (e.g., non-naturally occurring polypeptides as described herein). In some embodiments, the formulation contains 10 mg, 100 mg, 500 mg, 750 mg, 1 g, 2 g, 3 g, 4 g, 5 g, 6 g, 7 g, 8 g, 9, 10 g, 15 g, 20 g, 25 g, 30 g, 35 g, 40 g, 45 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, or over 100 g of nutritive polypeptide. [0133] In some embodiments, the polypeptides or compositions are provided in a dosage form.
In some embodiments, the dosage form is designed for administration of at least one polypeptide disclosed herein, wherein the total amount of polypeptide administered is selected from 0.1 g to 1 g, 1 g to 5 g, from 2 g to 10 g, from 5 g to 15 g, from 10 g to 20 g, from 15 g to 25 g, from 20 g to 40 g, from 25 g to 50 g, and from 30 g to 60 g. In some embodiments, the dosage form is designed for administration of at least one protein disclosed herein, wherein the total amount of protein administered is selected from about 0.1 g, 0.1 g to 1 g, 1 g, 2 g, 3 g, 4 g, 5 g, 6 g, 7 g, 8 g, 9 g, 10 g, 15 g, 20 g, 25 g, 30 g, 35 g, 40 g, 45 g, 50 g, 55 g, 60 g, 65 g, 70 g, 75 g, 80 g, 85 g, 90 g, 95 g, and 100 g.
[0134] In some embodiments the protein or composition is consumed at a rate of from 0.1 g to 1 g a day, 1 g to 5 g a day, from 2 g to 10 g a day, from 5 g to 15 g a day, from 10 g to 20 g a day, from 15 g to 30 g a day, from 20 g to 40 g a day, from 25 g to 50 g a day, from 40 g to 80 g a day, from 50 g to 100 g a day, or more.
[0135] In another aspect, this disclosure provides methods of maintaining or increasing at least one of muscle mass, muscle strength, and functional performance in a subject. In some embodiments, the methods comprise providing to the subject a sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure. In some embodiments, the subject is at least one of elderly, critically - medically ill, and suffering from protein-energy malnutrition. In some embodiments, the sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure is consumed by the subject in coordination with performance of exercise. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral, enteral, or parenteral route. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral route. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an enteral route.
[0136] In another aspect, this disclosure provides methods of maintaining or achieving a desirable body mass index in a subject. In some embodiments, the methods comprise providing to the subject a sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure. In some embodiments, the subject is at least one of elderly, critically-medically ill, and suffering from protein-energy malnutrition. In some embodiments, the sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure is consumed by the subject in coordination with performance of exercise. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral, enteral, or parenteral route. [0137] In another aspect, this disclosure provides methods of providing a polypeptide (e.g., of the disclosure) to a subject with protein-energy malnutrition. In some embodiments, the methods comprise providing to the subject a sufficient amount of a polypeptide of this disclosure, a composition of this disclosure, or a composition made by a method of this disclosure. In some embodiments, the polypeptide of this disclosure, composition of this disclosure, or composition made by a method of this disclosure is consumed by the subject by an oral, enteral, or parenteral route.
[0138] The polypeptides of this disclosure are useful for treating sarcopenia or frailty once it develops in a subject or for preventing the onset of sarcopenia or frailty in a subject who is a member of an at risk groups. In some embodiments, all of the polypeptide consumed by the subject is a polypeptide according to this disclosure. In some embodiments, polypeptides according to this disclosure are combined with other sources of protein and/or free amino acids to provide the total protein intake of the subject. In some embodiments, the subject is at least one of elderly, critically-medically ill, and suffering from protein-energy malnutrition. In some embodiments, the polypeptide according to disclosure, the composition according to disclosure, or the composition made by a method according to disclosure is consumed by the subject in coordination with performance of exercise. In some embodiments, the polypeptide according to this disclosure, the composition according to disclosure, or the composition made by a method according to disclosure is consumed by the subject by an oral, enteral, or parenteral route.
[0139] In some embodiments, incorporating at least one polypeptide or composition of this disclosure into the diet of a subject has at least one effect selected from inducing postprandial satiety (including by suppressing hunger), inducing thermogenesis, reducing glycemic response, positively affecting energy expenditure positively affecting lean body mass, reducing the weight gain caused by overeating, and decreasing energy intake. In some embodiments, incorporating at least one polypeptide or composition of this disclosure into the diet of a subject has at least one effect selected from increasing loss of body fat, reducing lean tissue loss, improving lipid profile, and improving glucose tolerance and insulin sensitivity in the subject.
[0140] In some embodiments, the composition including the non-naturally occurring polypeptides (e.g., recombinant proteins and/or purified recombinant proteins) can be formulated for topical application. The topical application can be for medical purpose or cosmetic purpose. In such embodiments, the composition may further include at least one of a carrier molecule (e.g., vehicle), a preservative, and/or additional edible ingredients. Any suitable carrier molecules are contemplated, and the exemplary carrier molecule may include water, oil, alcohol, propylene glycol, or emulsifiers in addition, any suitable preservatives are contemplated, and the exemplary preservatives include zinc oxide, parabens, formaldehyde releasers, isothiazolinones, phenoxyethanol, or organic acids such as benzoic acid, sodium benzoate, or butylene glycol, hexanediol, or potassium sorbate.
[0141] In one aspect, the compositions that comprise non-naturally occurring polypeptides may be personal care products (e.g., a cosmetic). In some embodiments, the compositions are formulated for topical administration. The compositions can contain other cosmetic ingredients suitable for human use. The personal care products may be useful for preventing or treating ultraviolet radiation damage to human skin or hair. The personal care products may be useful for increasing the firmness, elasticity, brightness, hydration, tactile texture or visual texture of skin and/or stimulate collagen production. The personal care products may be useful for reducing redness of the skin. The personal care products may be applied to skin or hair. The compositions include, for example, masks, skin cleaners such as soap, cleansing creams, cleansing lotions, facial cleansers, cleansing milks, cleansing pads, facial washes, facial and body creams and moisturizers, facial serums, facial and body masks, facial toners and mists, eye creams and eye treatments, exfoliator formulas, lip balms and lipsticks, hair shampoo, hair conditioner and body shampoos, hair and scalp serums, hair mists and sprays, eye shadow, concealer, mascara and other color cosmetics.
[0142] The compositions that comprise the non-naturally occurring polypeptide can further comprise at least one additional ingredient comprising a topical carrier or a preservative. The topical carrier may comprise a topical carrier selected from the group consisting of liposome, biodegradable microcapsule, lotion, spray, aerosol, dusting powder, biodegradable polymer, mineral oil, triglyceride oil, silicone oil, glycerin, glycerin monostearate, alcohols, emulsifying agents, liquid petroleum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene, wax, sorbitan monostearate, polysorbate, cetyl ester wax, cetearyl alcohol, 2- octyldodecanol, benzyl alcohol, cyclomethicone, cyclopentasiloxane and water. The preservative may comprise a preservative selected from the group consisting of tocopherol, diiodomethyl-p-tolylsulfone, 2-Bromo-2-nitropropane-l,3-diol, cis isomer l-(3-chloroallyl)- 3,5,7-triaza-l-azoniaadamantane chloride, glutaraldehyde, 4,4-dimethyl oxazolidine, 7- Ethylbicyclooxazolidine, phenoxyethanol, butylene glycol, 1,2 Hexanediol, methyl paraben, sorbic acid, Germaben® II, rosemary extract, and EDTA
[0143] Also provided in certain embodiments herein, are methods of decreasing skin damage, promoting the repair of damaged skin, protecting skin against UV damage, and/or protecting skin cells against the effects of exposure to urban dust. In another embodiment, methods of increasing the firmness, elasticity, brightness, hydration, tactile texture, or visual texture of skin and/or stimulating collagen production are provided. The methods may comprise a step of applying a composition comprising a non-naturally occurring polypeptide of the disclosure to the skin of a subject. Without being bound to a particular theory or mechanism, the non- naturally occurring polypeptide in the composition may decrease skin damage by protecting against UV damage. In some cases, the non-naturally occurring polypeptide in the composition may promote the repair of damaged skin by increasing the viability of cells. In some cases, the non-naturally occurring polypeptide in the composition may decrease skin damage and/or promote repair of cells by increasing procollagen synthesis when applied to skin, and/or promoting the viability of skin cells. In some cases, the non-naturally occurring polypeptide decreases the formation of thymine-thymine (TT) dimer formation.
[0144] The methods provided herein encompass the use of a composition for treatment indicated in the method, such as by the steps provided herein. In embodiments, the disclosure provides the use of a composition provided herein (e.g., a non-naturally occurring polypeptide or a formulation comprising a non-naturally occurring polypeptide) in a method for decreasing skin damage, promoting the repair of damaged skin, protecting skin against UV damage, and/or protecting skin cells against the effects of exposure to urban dust (e.g., such as by administering to the skin of a subject a composition provided herein). In embodiments, the disclosure provides the use of a composition provided herein (e.g., a non-naturally occurring polypeptide or a formulation comprising a non-naturally occurring polypeptide) in a method for increasing the firmness, elasticity, brightness, hydration, tactile texture, or visual texture of skin and/or stimulating collagen production.
[0145] Provided in certain embodiments herein are (e.g., topical) compositions or formulations comprising one or more non-naturally occurring polypeptide provided herein (e.g., for cosmetic use). In some embodiments, the composition provides any suitable amount of polypeptide provided herein, such as in any suitable amount (e.g., an amount suitable to provide a benefit when given or administered to an individual or cell). In some specific embodiments, the composition comprises an amount suitable to provide a beneficial effect to the skin of an individual when (e.g., topically) administered to the skin of the individual. In specific embodiments, the composition comprises between 0.001% and 30% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein. In more specific embodiments, the composition comprises between 0.001% and 20% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 10% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 5% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 2% w/w of a polypeptide (or non- naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 1% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, between 0.001% and 0.5% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein, and between 0.001% and 0.2% w/w of a polypeptide (or non-naturally occurring collagen polypeptide) such as provided herein.
[0146] In various embodiments, the concentration or amount of a non-naturally occurring polypeptide (e.g., recombinant protein) provided herein is in a composition provided herein in any suitable amount and may, e.g., vary depending on the use or formulation (e.g., gel, capsule, liquid, powder, etc.). Exemplary concentrations of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can be at least about 0.01%, at least about 0.05%, at least about 0.1%, at least about 0.2 %, at least about 0.5%, at least about 1%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98% (w/v or w/w) in the composition. Alternatively and/or additionally, the exemplary concentration of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can be about 0.01%, about 0.05%, about 0.1%, about 0.2 %, at least 0.5%, 1%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98% (w/v or w/w) in the composition. Alternatively and/or additionally, the exemplary concentration of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can range from about 0.01% to about 99%, from about 0.05% to about 99%, from about 0.1% to about 99%, from about 0.1% to about 99%, from about 0.5% to about 99%, from about 0.1% to about 10%, from about 1% to about 99%, from about 5% to about 99%, from about 10% to about 99%, from about 15% to about 99%, from about 20% to about 99%, from about 25% to about 99%, from about 30% to about 99%, from about 35% to about 99%, from about 40% to about 99%, from about 45% to about 99%, from about 50% to about 99%, from about 55% to about 99%, from about 60% to about 99%, from about 65% to about 99%, from about 70% to about 99%, from about 75% to about 99%, from about 80% to about 99%, from about 85% to about 99%, from about 90% to about 99%, from about 95% to about 99%, from about 0.1% to about 90%, from about 1% to about 90%, from about 5% to about 90%, from about 10% to about 90%, from about 15% to about 90%, from about 20% to about 90%, from about 25% to about 90%, from about 30% to about 90%, from about 35% to about 90%, from about 40% to about 90%, from about 45% to about 90%, from about 50% to about 90%, from about 55% to about 90%, from about 60% to about 90%, from about 65% to about 90%, from about 70% to about 90%, from about 75% to about 90%, from about 80% to about 90%, from about 85% to about 90%, from about 20% to about 80%, from about 25% to about 80%, from about 30% to about 80%, from about 35% to about 80%, from about 40% to about 80%, from about 45% to about 80%, from about 50% to about 80%, from about 55% to about 80%, from about 60% to about 80%, from about 65% to about 80%, from about 70% to about 80%, from about 75% to about 80%, from about 70% to about 99%, from about 75% to about 99%, from about 80% to about 99%, etc. Alternatively and/or additionally, the exemplary concentration of the non-naturally occurring polypeptides (e.g., recombinant proteins) in the composition can be less than about 95%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, etc.
[0147] Certain aspects of the disclosure include methods of improving the appearance of the skin, the hair, and/or the nails of a subject by administering the composition to the subject. Additionally and/or alternatively, the disclosure includes a method of improving the joint health and/or restoring bone density in a subject. In some embodiments, the subject has or is suspected to have osteoporosis and/or osteoarthritis. Alternatively and/or additionally, the disclosure includes a method of improving gut health, altering or improving the microbiome of a subject, or altering and/or reducing inflammation or tissue repair in a subject. In some embodiments, the composition is administered orally in a dose and schedule sufficient or effective for improving the appearance of the skin, the hair, and/or the nails of a subject, improving the joint health and/or restoring bone density in a subject having osteoporosis and/or osteoarthritis, and/or improving gut health, altering or improving the microbiome of a subject, or altering and/or reducing inflammation or tissue repair in a subject. Any suitable dose is optionally used. In some embodiments, the dose used is from about 0.1 mg/kg to about 200 mg/kg, from about 0.2 mg/kg to about 150 mg/kg, from about 0.5 mg/kg to about 150 mg/kg, from about 0.5 mg/kg to about 100 mg/kg, from about 0.8 mg/kg to about 100 mg/kg, from about 1.0 mg/kg to about 100 mg/kg, from about 1.0 mg/kg to about 90 mg/kg, from about 1.0 mg/kg to about 80 mg/kg, from about 1.0 mg/kg to about 70 mg/kg, from about 1.0 mg/kg to about 60 mg/kg, from about 1.0 mg/kg to about 50 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 1.5 mg/kg, about 2.0 mg/kg, about 2.5 mg/kg, about 3.0 mg/kg, about 3.5 mg/kg, about 4.0 mg/kg, about 4.5 mg/kg, or about 5.0 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, or about 30 mg/kg. In some embodiments, the dose may increase or decrease by the schedule of the administration. For example, the dose for administering to a subject (e.g., human) can be increased or decreased for about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, or about 1.0 mg/kg per each administration (e.g., for 3 consecutive administration, the dose can be increased from 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, respectively, etc.). In another example, the dose for administering to a subject (e.g., human) can be increased and then decreased, or decreased and then increased for about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, or about 1.0 mg/kg per each administration (e.g., for 5 consecutive administration, the dose can be increased from 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, then 2.2 mg/kg, and 2.0 mg/kg, respectively, etc.).
[0148] In some embodiments, the schedule of administration varies depending on the purpose, gender, age, or health condition of the subject. For example, in some embodiments, the composition is administered once a day, twice a day, three times a day, up to 6 times a day, every 2 days, every 3 days, every 4 days, every 5 days, every 6 days, etc. Alternatively and/or additionally, in some embodiments, the composition is administered a plurality of times in an irregular interval, or increased interval, or decreased interval.
[0149] In certain embodiments, the composition is topically applied in a dose and/or schedule sufficient or effective for improving the appearance of the skin, the hair, and/or the nails of a subject, and/or reducing inflammation in a subject. In some instances, the dose varies depending on the target area for the topical application (e.g., hair, skin, wound, nail, etc.), and can range from about 0.1 g/inch2 to about 10 g/inch2, from about 0.1 g/inch2 to about 9 g/inch2, from about 0.1 g/inch2 to about 8 g/inch2, from about 0.1 g/inch2 to about 7 g/inch2, from about 0.1 g/inch2 to about 6 g/inch2, from about 0.1 g/inch2 to about 5 g/inch2, from about 0.1 g/inch2 to about 4 g/inch2, from about 0.1 g/inch2 to about 3 g/inch2, from about 0.5 g/inch2 to about 5 g/inch2, from about 0.5 g/inch2 to about 4 g/inch2, from about 1 g/inch2 to about 4 g/inch2, or from about 1 g/inch2 to about 3 g/inch2, of area for topical application. In certain embodiments, the dose varies depending on the purpose, gender, age, severity of damage on the area, or health condition. For example, the composition can be applied to the target area of the subject at least three times a day, at least twice a day, once a day, up to 6 times a day, every 2 days, every 3 days, every 4 days, every 5 days, every 6 days, etc.
[0150] Skin appearance and quality: In some embodiments, provided herein are methods of improving skin appearance and/or quality, such as by administering an effective amount of a product or composition (e.g., containing a non-naturally occurring polypeptide described herein) provided herein to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally or topically. In some instances, administration results in various changes or effects on the skin of the individual. In some instances, the skin of the individual demonstrates increased proliferation and/or reduced cell death rate (e.g., when tested using a colorimetric assay for assessing cell metabolic activity (e.g., MTT assay)). In some embodiments, the skin demonstrates improved production of extracellular matrix (ECM) components such as collagen, elastin, fibronectin, fibrillin and/or decreased production of matrix degrading proteins (e.g., matrix metalloproteinases (MMPs) and proteases). In certain instances, the skin shows resistance or improved outcome upon exposure to harmful agents like photodamage (e.g., UV irradiation), pollution (e.g., urban dust), and/or harsh skincare actives (e.g., retinoic acid, benzoyl peroxide, salicylic acid). In certain instances, such resistance or improved outcome is shown via improved cell viability or proliferation (or reduced cell death) that can be assessed using MTT viability assay, via improved DNA repair that can be assessed by thymidine-dimer ELISA detection, reduced inflammation that can be assessed by Luminex detection, reduced reactive oxidative stress (ROS) that can be assessed by CM-EEDCFDA (General oxidative stress indicator) detection.
[0151] In some instances, the skin demonstrates reduction in wrinkles and/or fine lines, reduction in skin redness and/or hyperpigmentation, increase in skin brightness, decrease in pore size, decrease in skin roughness, and/or reduction in acne (e.g., when assessed using CLARITY analysis). In certain instances, the skin demonstrates improvement in skin elasticity, increase in skin firmness, increase in skin hydration, increase in skin barrier function, increase in skin collagen and elastin content, and/or increase in dermal density.
[0152] Hair Quality: In some embodiments, provided herein are methods of improving hair appearance and/or quality, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally or topically. In some instances, administration results in various changes or effects on the hair of the individual. In certain instances, the hair demonstrates improved hair fiber thickness and/or density, increases in moisture, faster growth rate, reduced split ends, reduced frizz/increased static control, improved fiber alignment/shine, increased combability, and/or stronger resistance to hair breakage. In some instances, the hair demonstrates improved hair growth, thicker hair fiber diameter, increased combability, reduced hair loss, and/or increased hair tensile strength.
[0153] Nail Quality: In some embodiments, provided herein are methods of improving nail appearance and/or quality, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally or topically. In some instances, administration results in various changes or effects on the nail of the individual. In certain instances, the nail demonstrates improved (reductions in) nail peeling, nail edge irregularities and/or nail roughness, frequency of cracked/chipped nails, and/or increases in nail growth rate.
[0154] Joint health: In some embodiments, provided herein are methods of improving j oint health, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally. In some instances, administration results in various changes or effects in joint health of the individual. In certain instances, the improved joint health is demonstrated by reduction in reported joint pain and/or increase in range of joint mobility.
[0155] Inflammation: In some embodiments, provided herein are methods of improving inflammatory effects, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally or topically. In some instances, administration results in various changes or effects in inflammation in the individual. In certain instances, the improved inflammatory effect is demonstrated by lower cytokine levels in the bloodstream (e.g., assessed by Luminex detection) and/or restore healthy levels of immune cells (e.g., by blood differential counts).
[0156] Gut health: In some embodiments, provided herein are methods of improving gut health, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally. In some instances, administration results in various changes or effects in gut health of the individual. In certain instances, the improved gut health is demonstrated by improved bowel movements and/or decrease in gastrointestinal discomfort/pain.
[0157] Microbiome: In some embodiments, provided herein are methods of altering and/or improving the microbiome, such as by administering an effective amount of a product or composition provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) to an individual (e.g., an individual in need of such improvement). In some embodiments, administration is orally. In some instances, administration results in various changes or effects in the microbiome of the individual. In certain instances, the improved microbiome is demonstrated by increased diversity of microbes and/or increased abundance of beneficial microbes (e.g., assessed by 16S DNA sequencing stool samples).
EXAMPLES
[0158] Example 1. Generation of non-naturally occurring polypeptides of the disclosure. [0159] This example shows the generation of a recombinant polypeptide of the disclosure by genetically engineered microorganisms and purification process of such generated polypeptides. [0160] The polynucleotides of SEQ ID NOs: 1, 3, 5, and 7 were synthesized and at least one of the polynucleotides were inserted into a pET vector. Overlaps between a pET vector and SEQ ID NOs: 1, 3, 5, and 7 were designed to be between 20 and 30 bp long and added using PCR with the enzyme PRIMESTAR® GXL polymerase (www.takarabio.com/products/pcr/gc-rich- pcr/primestar-gxl-dna-polymerase). The opened pET vector and insert DNA (e.g., polynucleotide of SEQ ID NO: 1) were assembled together into the final plasmid using IN-FUSION® Cloning (www.takarabio.com/products/cloning/in-fusion-cloning). In all cases, the nucleic acid sequences were preceded by a secretion signal sequence disclosed as SEQ ID NOs: 9, 11, 13, 15, 17, 19, 21, or 23. Plasmid sequences were verified through Sanger sequencing.
[0161] Cells were transformed with final plasmids and subsequently cultivated in minimal media and frozen in 1.5 aliquots with vegetable glycerin at a ratio of 50:50 of cells to glycerin. One vial of this frozen culture was revived in 50 ml of minimal media overnight at 37 °C, 200 rpm. Formulations of the minimal media in this example are shown in Table 2 and Table 3. Cells were then transferred into 300 ml of minimal media and grown for 6-9 hours to reach an optical density (OD) 600 of 5-10.
[0162] The fermentations were performed at various temperature ranging from 25° to 28° C. For some fermentations, the temperature of the fermentation was maintained at a constant temperature and immediately upon completion of fermentation the polypeptide was purified. For other fermentations, the temperature of the fermentations was maintained for a desired period of time and when cell densities of OD600 of 10-20 were reached, the temperature was reduced to induce protein production. Typically, the temperature was reduced from 28° C to 25° C. Induction was carried out by adding IPTG to the media at concentrations ranging from 0.1 - 0.5 mM. Fermentations were continued for 40-60 hours.
[0163] The recombinant polypeptide was purified as follows: The pH of the fermentation broth was decreased to between 3-3.5 using 5-50% Sulfuric Acid. The cells were then separated using centrifugation or centrifugation followed by microfiltration. Supernatant of the acidified broth was tested on a polyacrylamide gel and found to contain recombinant polypeptide in relatively high abundance compared to starting pellet. To obtain volume and salt reduction, concentration and diafiltration steps were performed ultrafiltration. Final polypeptide slurry was run on an SDS- PAGE gel to confirm presence of the recombinant polypeptide.
[0164] To verify that the desired proteins were produced, supernatants from cultures of microbes carrying SEQ ID NOs: 1, 3, 5, or 7 were collected and purified by decreasing their pH as described above. The acidified broth was analyzed by SDS-PAGE, and bands corresponding to the expected size protein were detected in relative purity. As shown in FIG. 1, a thick and clear band was observed at the expected sizes for each respective protein. Samples were subsequently analyzed for quantifying recombinant polypeptide titers and purity by reverse phase and size exclusion HPLC chromatography and mass spectrometry, which confirmed the correct identity of the respective proteins of interest.
[0165] FIGS. 2A-2C depict SDS-PAGE gels of non-naturally occurring polypeptides of the disclosure before and after treatment at pH 3.0. FIG. 2A depicts an SDS-PAGE gel of fermentation supernatant containing a non-naturally occurring polypeptide having an amino acid sequence of SEQ ID NO: 2 before (Lane 1) and after (Lane 2) treatment at pH 3.0. The expected molecular weight of such polypeptide was about 17.9 kDa. The identity of the polypeptide was confirmed by mass spectrometry (data not shown). FIG. 2B depicts an SDS-PAGE gel of fermentation supernatant containing a non-naturally occurring polypeptide having an amino acid sequence of SEQ ID NO: 8 before (Lane 3) and after (Lane 4) treatment at pH 3.0. The expected molecular weight of such polypeptide was about 17.6 kDa. The identity of the polypeptide was confirmed by mass spectrometry (data not shown). FIG. 2C depicts an SDS-PAGE gel of fermentation supernatant containing a non-naturally occurring polypeptide produced in various bacterial host strains having an amino acid sequence of SEQ ID NO: 8 before (Lanes 3-5) and after (Lanes 6-8) treatment at pH 3.0.
[0166] Example 2. Human clinical study of the non-naturally occurring polypeptides of the disclosure.
[0167] Skin appearance and quality: Patients are recruited and/or cultured human skin cells or patient-derived skin samples are provided to evaluate the benefit of recombinant polypeptides provided herein. Non-naturally occurring polypeptides as described herein (or products containing non-naturally occurring polypeptides as described herein) and control products are administered (orally or topically) to separate (in vitro or in vivo) cohorts to evaluate for various effects on skin. Skin effects are evaluated quantitatively and/or qualitatively. For example, when the composition including the non-naturally occurring polypeptide is applied to or administered to, the cultured human skin cells in vitro (either primary culture or cell line), or human skin tissue ex vivo, the cultured human skin cells or cells in the human skin tissue show increased proliferation or reduced cell death rate (e.g., when tested using a colorimetric assay for assessing cell metabolic activity (e.g., MTT assay)). In some instances, such cultured human skin cells or cells in the human skin tissue contacted or treated with the compositions including the non-naturally occurring polypeptides described herein may show, via RNA-seq transcriptomic analysis or proteomics analysis, increased production of extracellular matrix (ECM) components such as collagen, elastin, fibronectin, fibrillin, and decreased production of matrix-degrading proteins (e.g., matrix metalloproteinases (MMPs) and proteases). Such treated cultured human skin cells or cells in the human skin tissue are evaluated to demonstrate resistance or improved outcome upon exposure to harmful agents like photodamage (e.g., UV irradiation), pollution (e.g., urban dust), and harsh skincare actives (e.g., retinoic acid, benzoyl peroxide, salicylic acid). Such resistance or improved outcome is shown via improved cell viability or proliferation (or reduced cell death) that is assessed using MTT viability assay, via improved DNA repair that is assessed by thymidine-dimer ELISA detection, reduced inflammation that is assessed by Luminex detection, and/or reduced reactive oxidative stress (ROS) that is assessed by CM-EEDCFDA (General oxidative stress indicator) detection.
[0168] In another example, when the composition including a non-naturally occurring polypeptide (e.g., as described herein) is applied to, or administered to the subject orally or topically on the skin, the subject’s skin is evaluated for reduction in wrinkles and fine lines, reduction in skin redness and hyperpigmentation, increase in skin brightness, decrease in pore size, decrease in skin roughness, and reduction in acne (e.g., when assessed using CLARITY analysis). The skin is also further evaluated (before and after administration) to show change in skin elasticity, change in skin firmness, change in skin hydration, change in skin barrier function, change in skin collagen and elastin content, and/or change in dermal density.
[0169] Hair Quality: Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on hair are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are applied to hair or orally administered to a subject, hair quality is measured, such as by measuring changes in hair fiber thickness and density, changes in moisture, changes in growth rate, changes in prevalence of split ends, changes in frizz/increased static control, changes in fiber alignment/shine, changes in combability, and/or changes in resistance to hair breakage (e.g., measured by in vitro hair tress testing). In some instances, clinical testing measures changes in hair growth, hair fiber diameter, combability, hair loss, and/or hair tensile strength.
[0170] Nail Quality: Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on nails are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are applied to nail or orally administered to a subject, nail quality is measured, such as by measuring changes in nail hardness, nail peeling, nail edge irregularities and nail roughness, frequency of cracked/chipped nails, and/or nail growth rate.
[0171] Joint health: Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on joints are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are orally administered to a subject, joint quality is measured, such as by measuring changes in reported joint pain and/or range of joint mobility.
[0172] Inflammation: Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) on inflammation are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are orally administered to a subject, changes in inflammation are measured, cytokine levels in the bloodstream are measured (e.g., assessed by Luminex detection), and/or levels of immune cells are measured (by blood differential counts). [0173] Gut health: Effects of products (e.g., containing a non-naturally occurring polypeptide as described herein) provided herein (e.g., relative to control products) in gut health are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide as described herein) are orally administered to a subject, changes in bowel movements and/or gastrointestinal discomfort/pain are measured.
[0174] Microbiome: Effects of products (e.g., containing a non-naturally occurring polypeptide described herein) provided herein (e.g., relative to control products) in the microbiome are also evaluated. For example, when the products provided herein (e.g., containing a non-naturally occurring polypeptide described herein) are orally administered to a subject, changes in diversity of microbes or abundance of beneficial microbes is measured, which can be assessed by 16S DNA sequencing stool samples. Also, such effect can be shown in vitro as the composition supports growth of beneficial microbes in broth co-cultures.
[0175] Example 3. In vitro studies of non-naturally occurring polypeptides of the disclosure. [0176] This example demonstrates functional effects on cells in vitro after treatment with a non- naturally occurring polypeptide having the amino acid sequence of SEQ ID NO: 2.
A non-naturally occurring polypeptide of SEQ ID NO: 2 increases viability of human dermal fibroblasts.
[0177] Human primary fibroblasts were cultured in media alone (FIG. 3; “A”), or with 0.025% w/w (FIG. 3; “B”), 0.05% w/w (FIG. 3; “C”), or 0.1% w/w (FIG. 3; “D”) of a non-naturally occurring polypeptide having the amino acid sequence of SEQ ID NO: 2 for 24 hours. Cell viability was evaluated using the MTT colorimetric assay. As shown in FIG. 3, fibroblasts treated with the polypeptide of SEQ ID NO: 2 showed an increase in cell viability relative to the media only control.
A non-naturally occurring polypeptide of SEQ ID NO: 2 increases collagen type I production in human dermal fibroblasts. [0178] Human primary fibroblasts were cultured in media alone (FIG. 4; “A”), or with 0.025% w/w (FIG. 4; “B”), 0.05% w/w (FIG. 4; “C”), or 0.1% w/w (FIG. 4; “D”) of a non-naturally occurring polypeptide having the amino acid sequence of SEQ ID NO: 2 for 24 hours. Fibroblast production of collagen type I was determined by analyzing the supernatants with an enzyme- linked immunosorbent assay (ELISA) for pro-collagen type I C-peptide, which is a readout for total secreted collagen type I. As shown in FIG. 4, fibroblasts treated with the polypeptide of SEQ ID NO: 2 secreted higher levels of collagen type I than media control-treated fibroblasts.
A non-naturally occurring polypeptide of SEQ ID NO: 2 increases collagen type I production in human tenocytes.
[0179] Human primary tenocytes were cultured in media alone (FIG. 5; “A”), or with 0.025% w/w (FIG. 5; “B”) or 0.05% w/w (FIG. 5; “C”) of a non-naturally occurring polypeptide having the amino acid sequence of SEQ ID NO: 2 for 24 hours. Tenocyte production of collagen type I was determined by analyzing the supernatants with an enzyme-linked immunosorbent assay (ELISA) for pro-collagen type I C-peptide, which is a readout for total secreted collagen type I. As shown in FIG. 5, tenocytes treated with the polypeptide of SEQ ID NO: 2 secreted higher levels of collagen type I than media control -treated cells.
[0180] Example 4. Sports drink containing a non-naturally occurring polypeptide of the disclosure.
[0181] In this example, a non-naturally occurring polypeptide of the disclosure was formulated in a sports drink.
[0182] Sports drink formulation:
[0183] 10 g polypeptide of SEQ ID NO: 2 / 12 oz serving [0184] Ingredients Listing:
[0185] Water, collagen peptides, sugar, tangerine juice concentrate, salt, citric acid, monopotassium phosphate, sodium citrate, fruit and vegetable juice [for color], natural flavor, stevia
[0186] Variables Tested:
[0187] 1. 10 g vs. 12 g polypeptide of SEQ ID NO: 2 / 12 oz serving
[0188] 2. 0 % - 15 % fruit juice concentrate
[0189] 3. 7 g - 20 g sugar / 12 oz serving
[0190] 4. Sweetener systems: sucrose, monk fruit, stevia
[0191] 5. 0.05 % - 0.30 % citric acid
[0192] Example 5. Gummies containing a non-naturally occurring polypeptide of the disclosure. [0193] In this example, a non-naturally occurring polypeptide of the disclosure was formulated in a gummy.
[0194] 2.5 g polypeptide of SEQ ID NO: 2 & 100 mg hyaluronic acid / 25 g serving [0195] Ingredients Listing:
[0196] Tapioca syrup, cane sugar, water, collagen peptides, citric acid, pectin, sodium citrate, natural flavor, sodium hyaluronate, fruit and vegetable juice [for color]
[0197] Variables Tested:
[0198] 1. Order of addition - polypeptide of SEQ ID NO: 2 needs to be made into a solution and added after the syrup cooking step
[0199] 2. Various levels of polypeptide of SEQ ID NO: 2 (2 %, 6 %, 8 %, 10 %)
[0200] 3. Polypeptide of SEQ ID NO: 2 has a buffering effect; tested different citrate/citric acid levels.
[0201] Example 6. Brownies containing a non-naturally occurring polypeptide of the disclosure.
[0202] In this example, a non-naturally occurring polypeptide of the disclosure was formulated in a brownie.
[0203] 3 g polypeptide of SEQ ID NO: 2 / 40 g serving [0204] Ingredients Listing:
[0205] (Bread) flour, cane sugar, cocoa powder, water, coconut oil, polypeptide of SEQ ID NO: 2, olive oil, glycerin, vanilla extract, baking soda, salt, xanthan, lecithin.
[0206] Variables Tested:
[0207] 1. All-purpose flour vs. bread flour
[0208] 2. Polypeptide of SEQ ID NO: 2 at 3 g, 3.75 g, 5 g, or 9 g / 40 g serving [0209] 3. Reduced sugar 20%, 30%
[0210] Example 7. Properties of non-naturally occurring polypeptides of the disclosure related to nutritional use
[0211] In this example, the non-naturally occurring polypeptide of SEQ ID NO: 2 was evaluated for various properties related to nutritional use.
[0212] Viscosity
[0213] The non-naturally occurring polypeptides provided herein can be evaluated for viscosity in solution. In this example, a polypeptide of SEQ ID NO: 2 was shown to be soluble up to 43% w/w at pH 4.5 and 50% w/w at pH 6.5, using a flow sweep on DHR-II rheometer with 40 mm parallel plate at 25° C. A polypeptide of SEQ ID NO: 2 as a spray dried powder was found to go into solution slower in water at 50° C or higher versus water at ambient temperature. Results are depicted in FIG. 7A and FIG. 7B. [0214] Interactions of a polypeptide of SEQ ID NO: 2 with hydrocolloids and oils was also evaluated. Blends of a polypeptide of SEQ ID NO: 2 and gum arabic were prepared in DI water and evaluated for viscosity in the ratios according to Table 4.
Table 4. Ratios of gum arabic and polypeptide blends
Figure imgf000054_0001
[0215] Blends of a polypeptide of SEQ ID NO: 2 and xanthan were prepared in DI water and evaluated for viscosity in various ratios. FIG. 8 depicts results of this study. SDA represents a polypeptide of SEQ ID NO: 2 spray dried at pH 6.5. SDB represents a polypeptide of SEQ ID NO: 2 spray dried with a feed of 20% solids at pH 4.5.
[0216] Gel hardness
[0217] The non-naturally occurring polypeptides of the disclosure can be evaluated for gel hardness in solution. Briefly, 5% protein solutions (containing a polypeptide of SEQ ID NO: 2) were crosslinked with 100 u transglutaminase enzyme. Protein and enzyme mixtures were deposited in 12-well cell plates and incubated at 50° C for 2 hours. Gels were heated to 100° C for 10 minutes to inactivate transglutaminase enzyme. Gels were cooled at ambient temperature and stored in 4° C overnight. Gel hardness was evaluated by molding 4 mL of gel mixture in 23 mm diameter wells. Gels were brought to ambient temperature prior to measurements, and hardness of gel was recorded as the force at which ½” stainless steel ball probe (TA-18) was depressed 2 mm into the gel at 1 mm/sec using TA.XT Plus Texture Analyzer instrument.
Protein solutions were prepared in DI water or 10 mM sodium phosphate buffer, pH 7.2. Solutions were adjusted to target pH using 1M HC1 or 2N NaOH prior to addition of enzyme. Results of this study are depicted in FIG. 9.
[0218] Protein solutions were prepared in DI water or 10 mM sodium phosphate buffer, pH 7.2. Solutions were adjusted to target pH using 1M HC1 or 2N NaOH prior to addition of enzyme. Results are depicted in FIG. 10A and FIG. 10B. At pH 5.5, crosslinked GL21 gels range in hardness from 27-35 g. Between pH 6.3-6.4, crosslinked polypeptide gels range in hardness from 20-3 lg.
[0219] Emulsion properties
[0220] The non-naturally occurring polypeptides described herein can be evaluated for emulsion properties in solution. Protein solutions at pH 4.5 were mixed with canola oil at a 5: 1 ratio and were homogenized using IKA Ultra Turrax at 10000 rpm for 10 min. Stability of emulsion was evaluated after 24 hours at ambient temperature in 12 mL conical tubes.
[0221] Foamabilitv and Foam stability
[0222] The non-naturally occurring polypeptides described herein can be evaluated for foaming properties in solution. 10 mL of 5% w/w of a polypeptide of SEQ ID NO: 2 solution from various lots was shaken in a conical 50 mL tube for 2 minutes. Volume of foam and time of foam collapse were recorded, and results are depicted in Table 5.
Table 5. Volume of foam and time of foam collapse.
Figure imgf000055_0001
[0223] Sensory notes
[0224] The non-naturally occurring polypeptides of the disclosure can be evaluated for sensory properties, including odor and flavor. Spray dried polypeptide of SEQ ID NO: 2 from various lots was evaluated either dried or in solution, and the results are depicted in Table 6.
Table 6. Sensory notes.
Figure imgf000055_0002
Figure imgf000056_0001
0225] Solubility
[0226] Non-naturally occurring polypeptides of the disclosure can be evaluated for solubility. The effect of agglomeration with lecithin solution on compacted powder forms of a polypeptide of SEQ ID NO: 2 to increase particle size and improve solubility was evaluated. 2.5 g protein powder was dropped into 50 mL water. Wettability was evaluated by observing sinking within 20 seconds. Dissolution was evaluated with 40 seconds of slow stirring and 60 seconds of rest. Results are depicted in Table 7.
Table 7. Solubility of a polypeptide of SEQ ID NO: 2.
Figure imgf000056_0002
Figure imgf000057_0001
[0227] Viscosity of solutions of a polypeptide of SEQ ID NO: 2 at 20% w/w solutions were also determined at 25° C, and results are depicted in FIG. 11.
[0228] 8% w/w protein solution (containing a polypeptide of SEQ ID NO: 2) at pH 5.5 and 100 u transglutaminase enzyme was homogenized with 50% w/w oil at 26000 rpm with Polytron for 1 minute on ice. 4g of mixture was deposited into each well of a 12-well cell plate and incubated for 2 hours at 50° C. Gels were heated to 100° C for 10 minutes to inactivate the enzyme. Gels were cooled at ambient temperature and stored at 4° C overnight. A polypeptide of SEQ ID NO:2 stabilized high oil emulsion during crosslinking reaction to form protein oil gel. Results are depicted in FIG.
[0229] Example 8. Polypeptide sequence confirmation of products and lack of hydroxyproline residues
[0230] Mass spectrometry was used to confirm the sequence of a polypeptide of SEQ ID NO: 2 produced by methods according to this disclosure. Table 8 and Table 9 provide the results of peptide mapping of this polypeptide.
Table 8. Peptide mapping of the polypeptide of SEQ ID NO: 2.
Figure imgf000058_0001
Table 9. Peptide mapping of the polypeptide of SEQ ID NO: 2.
Figure imgf000059_0001
[0231] Analysis was also performed to evaluate any amino acid or peptide modifications present in the produced polypeptide of SEQ ID NO: 2. (Table 10). In a few instances, additional confirmatory analyses were performed to differential methionine oxidation from the presence of hydroxyproline residues. For example, based upon the fragmentation results from MS/MS scans, the tryptic peptide T1 (sequence DTGFPGMPGR) was shown to contain a methionine oxidation rather than a proline hydroxylation. Based on such results, it was conclusively determined that tryptic peptide 1 (Tl) has oxidation at methionine position 7 and no evidence of hydroxyproline at position 5 or 8. Similarly, where there is another methionine in position 83 in tryptic peptide 9 (T9), there were no detectable levels of methionine oxidation, hydroxyproline in positions 77, 85, 92, 95, and 97, or hydroxylysine at position 98 of the polypeptide. Accordingly, the truncated collagen polypeptides of the present disclosure also differ from naturally occurring collagen polypeptides in their lack of hydroxyproline residues. Table 10. Analysis of amino acid and peptide modifications of the polypeptide of SEQ ID NO: 2.
Figure imgf000060_0001
[0232] While preferred embodiments of the present disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the disclosure. It should be understood that various alternatives to the embodiments of the disclosure described herein may be employed in practicing the embodiments of the disclosure. It is intended that the following claims define the scope of the disclosure and that methods and structures within the scope of these claims and their equivalents be covered thereby.

Claims

CLAIMS WHAT IS CLAIMED IS:
1. A non-naturally occurring polypeptide comprising an amino acid sequence having: (i) at least 80% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 80% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
2. The non-naturally occurring polypeptide of claim 1, comprising an amino acid sequence having: (i) at least 85% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C- terminal truncation, or both; or (ii) at least 85% sequence identity to SEQ ID NO: 32 with an N- terminal truncation, a C-terminal truncation, or both.
3. The non-naturally occurring polypeptide of claim 1 or 2, comprising an amino acid sequence having: (i) at least 90% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 90% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
4. The non-naturally occurring polypeptide of any one of claims 1-3, comprising an amino acid sequence having: (i) at least 95% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 95% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
5. The non-naturally occurring polypeptide of any one of claims 1-4, comprising an amino acid sequence having: (i) at least 98% sequence identity to SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) at least 98% sequence identity to SEQ ID NO: 32 with an N-terminal truncation, a C-terminal truncation, or both.
6. The non-naturally occurring polypeptide of any one of claims 1-5, comprising: (i) the amino acid sequence of SEQ ID NO: 31 with an N-terminal truncation, a C-terminal truncation, or both; or (ii) the amino acid sequence of SEQ ID NO: 32 with an N-terminal truncation, a C- terminal truncation, or both.
7. The non-naturally occurring polypeptide of any one of claims 1-6, comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with an N-terminal truncation.
8. The non-naturally occurring polypeptide of claim 7, wherein the N-terminal truncation is an N-terminal truncation of 50 amino acids to 600 amino acids.
9. The non-naturally occurring polypeptide of any one of claims 1-6, comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with a C-terminal truncation.
10. The non-naturally occurring polypeptide of claim 9, wherein the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
11. The non-naturally occurring polypeptide of any one of claims 1-6, comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 31 with both an N-terminal truncation and a C-terminal truncation.
12. The non-naturally occurring polypeptide of claim 11, wherein the N-terminal truncation is an N-terminal truncation of 50 amino acids to 600 amino acids, and the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
13. The non-naturally occurring polypeptide of any one of claims 1-12, comprising the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 6.
14. The non-naturally occurring polypeptide of any one of claims 1-12, consisting of the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 6.
15. The non-naturally occurring polypeptide of any one of claims 1-6, comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with an N-terminal truncation.
16. The non-naturally occurring polypeptide of claim 15, wherein the N-terminal truncation is an N-terminal truncation of 50 amino acids to 750 amino acids.
17. The non-naturally occurring polypeptide of any one of claims 1-6, comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with a C-terminal truncation.
18. The non-naturally occurring polypeptide of claim 17, wherein the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
19. The non-naturally occurring polypeptide of any one of claims 1-6, comprising an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 32 with both an N-terminal truncation and a C-terminal truncation.
20. The non-naturally occurring polypeptide of claim 19, wherein the N-terminal truncation is an N-terminal truncation of 50 amino acids to 750 amino acids, and the C-terminal truncation is a C-terminal truncation of 50 amino acids to 250 amino acids.
21. The non-naturally occurring polypeptide of any one of claims 1-6 or 15-20, comprising the amino acid sequence of SEQ ID NO: 8.
22. The non-naturally occurring polypeptide of any one of claims 1-6 or 15-20, consisting of the amino acid sequence of SEQ ID NO: 8.
23. The non-naturally occurring polypeptide of any one of claims 1-22, wherein the non- naturally occurring polypeptide has a total truncation of 50 amino acids to 900 amino acids.
24. The non-naturally occurring polypeptide of any one of claims 1-23, wherein the non- naturally occurring polypeptide is 50 amino acids to 250 amino acids in length.
25. The non-naturally occurring polypeptide of any one of claims 1-24, wherein the non- naturally occurring polypeptide does not comprise one or more of: a laminin G domain, a Von Willebrand factor type A (vWA) domain, and a fibrillar collagen C-terminal domain.
26. The non-naturally occurring polypeptide of any one of claims 1-25, wherein the non- naturally occurring polypeptide comprises one or more collagen triple helix repeats.
27. The non-naturally occurring polypeptide of any one of claims 1-26, wherein the non- naturally occurring polypeptide is monomeric.
28. The non-naturally occurring polypeptide of any one of claims 1-27, wherein the non- naturally occurring polypeptide does not form a stable triple helix structure of a naturally occurring collagen.
29. The non-naturally occurring polypeptide of any one of claims 1-28, wherein the non- naturally occurring polypeptide is substantially free of other collagen chains.
30. The non-naturally occurring polypeptide of any one of claims 1-29, wherein the non- naturally occurring polypeptide has a non-naturally occurring level of hydroxylation relative to a naturally-occurring collagen.
31. The non-naturally occurring polypeptide of any one of claims 1-30, wherein fewer than 10% of prolines present in the non-naturally occurring polypeptide are hydroxylated.
32. The non-naturally occurring polypeptide of any one of claims 1-31, wherein the non- naturally occurring polypeptide is non-hydroxylated.
33. The non-naturally occurring polypeptide of any one of claims 1-32, wherein the non- naturally occurring polypeptide has a non-naturally occurring level of glycosylation relative to a naturally-occurring collagen.
34. The non-naturally occurring polypeptide of any one of claims 1-33, wherein the non- naturally occurring polypeptide protein comprises less than 5 wt. % glycosylation.
35. A composition comprising between 0.001% and 30% w/w of the non-naturally occurring polypeptide of any one of claims 1-34.
36. The composition of claim 35, wherein the composition is formulated for consumption by an individual.
37. The composition of claim 36, wherein the composition is a nutraceutical.
38. The composition of claim 36 or 37, wherein the individual is a human.
39. A method of improving the appearance of the skin, the hair, and/or the nails of a subject, and/or improving bone, muscle, and/or joint health in the subject, the method comprising: administering to the subject a composition of any one of claims 35-38.
40. The method of claim 39, wherein the administering comprises orally administering to the subject.
41. A recombinant cell containing therein at least one copy of a heterologous nucleic acid sequence encoding a non-naturally occurring polypeptide of any one of claims 1-34.
42. The recombinant cell of claim 41, wherein the recombinant cell is a microbial cell.
43. The recombinant cell of claim 42, wherein the microbial cell is a bacterial cell.
44. The recombinant cell of claim 43, wherein the bacterial cell is of the species Escherichia coli.
45. The recombinant cell of any one of claims 41-44, wherein the recombinant cell lacks an enzyme that hydroxylates one or more amino acids of the non-naturally occurring polypeptide.
46. The recombinant cell of any one of claims 41-45, wherein the recombinant cell lacks prolyl 4-hydroxylase and/or prolyl 3-hydroxylase.
PCT/US2021/014714 2020-01-24 2021-01-22 Animal-free dietary collagen WO2021150959A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
MX2022009036A MX2022009036A (en) 2020-01-24 2021-01-22 Animal-free dietary collagen.
GB2212264.2A GB2610313B (en) 2020-01-24 2021-01-22 Animal-free dietary collagen
CN202180022766.8A CN115298212A (en) 2020-01-24 2021-01-22 Animal diet-free collagen
BR112022014586A BR112022014586A2 (en) 2020-01-24 2021-01-22 DIETARY COLLAGEN NOT DERIVED FROM ANIMALS
JP2022545046A JP2023513435A (en) 2020-01-24 2021-01-22 Animal-free dietary collagen
CA3168802A CA3168802A1 (en) 2020-01-24 2021-01-22 Animal-free dietary collagen
AU2021211721A AU2021211721A1 (en) 2020-01-24 2021-01-22 Animal-free dietary collagen
EP21745159.0A EP4093761A4 (en) 2020-01-24 2021-01-22 Animal-free dietary collagen
US17/171,874 US11174300B2 (en) 2020-01-24 2021-02-09 Animal-free dietary collagen
US17/493,627 US11332505B2 (en) 2020-01-24 2021-10-04 Animal-free dietary collagen
US17/714,896 US20220332775A1 (en) 2020-01-24 2022-04-06 Animal-free dietary collagen

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202062965700P 2020-01-24 2020-01-24
US62/965,700 2020-01-24
US202063117243P 2020-11-23 2020-11-23
US63/117,243 2020-11-23

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/171,874 Continuation US11174300B2 (en) 2020-01-24 2021-02-09 Animal-free dietary collagen

Publications (1)

Publication Number Publication Date
WO2021150959A1 true WO2021150959A1 (en) 2021-07-29

Family

ID=76991717

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/014714 WO2021150959A1 (en) 2020-01-24 2021-01-22 Animal-free dietary collagen

Country Status (11)

Country Link
US (3) US11174300B2 (en)
EP (1) EP4093761A4 (en)
JP (1) JP2023513435A (en)
CN (1) CN115298212A (en)
AU (1) AU2021211721A1 (en)
BR (1) BR112022014586A2 (en)
CA (1) CA3168802A1 (en)
GB (1) GB2610313B (en)
MX (1) MX2022009036A (en)
TW (1) TW202134267A (en)
WO (1) WO2021150959A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11174300B2 (en) 2020-01-24 2021-11-16 Geltor, Inc. Animal-free dietary collagen
WO2023009673A1 (en) * 2021-07-28 2023-02-02 Geltor, Inc. Animal-free cosmetic collagens

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20240039024A (en) * 2021-07-28 2024-03-26 젤터, 인코포레이티드 Pharmaceutical compositions and methods for treating connective tissue conditions with collagen polypeptides

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004052910A1 (en) * 2002-11-14 2004-06-24 Affiliated Hospital Of Academy Of Military Medical Sciences, Pla A full-length polynucleotide coding chicken type ii collagen and the use of it
US20150175969A1 (en) * 2012-09-26 2015-06-25 Fujifilm Corporation Polypeptide, scaffold composition, composition for cartilage tissue restoration, composition for cartilage cell culture, and composition for promoting glycosaminoglycan production
WO2019068018A2 (en) * 2017-09-28 2019-04-04 Geltor, Inc. Recombinant collagen and elastin molecules and uses thereof
WO2019103981A1 (en) * 2017-11-22 2019-05-31 Geltor Inc. Methods and systems for engineering collagen

Family Cites Families (51)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6653450B1 (en) 1993-01-28 2003-11-25 Cohesion Technologies, Inc. Mutated recombinant collagens
JP2000508544A (en) 1996-04-12 2000-07-11 ファイブローゲン,インコーポレーテッド Synthesis of human procollagen and collagen in a recombinant DNA system
FR2757874B1 (en) 1996-12-17 2003-04-25 Biocem RECOMBINANT COLLAGENS AND DERIVED PROTEINS PRODUCED BY PLANTS, THEIR METHODS OF OBTAINING AND THEIR USES
AUPO811797A0 (en) 1997-07-18 1997-08-14 University Of Sydney, The Tropoelastin derivatives
US6428978B1 (en) 1998-05-08 2002-08-06 Cohesion Technologies, Inc. Methods for the production of gelatin and full-length triple helical collagen in recombinant cells
US6992172B1 (en) 1999-11-12 2006-01-31 Fibrogen, Inc. Recombinant gelatins
US6682760B2 (en) 2000-04-18 2004-01-27 Colbar R&D Ltd. Cross-linked collagen matrices and methods for their preparation
TW499433B (en) * 2000-12-27 2002-08-21 Ind Tech Res Inst Novel human Α1-chain collagen
EP1584630A1 (en) 2004-04-08 2005-10-12 Nederlandse Organisatie voor toegepast-natuurwetenschappelijk Onderzoek TNO Method for preparing a modified protein outside a host cell
DE602006015289D1 (en) 2005-02-23 2010-08-19 Fujifilm Mfg Europe Bv NON-GLYCOSYLATED RECOMBINANT COLLAGEN-LIKE POLYPEPTIDES
EP1889062A4 (en) 2005-06-03 2009-12-23 Texas A & M Univ Sys Specific binding sites in collagen for integrins and use thereof
WO2007044945A2 (en) 2005-10-13 2007-04-19 Gu, Jennifer, L. Mineral collagen chelates and methods of making and using same
US7279329B2 (en) 2005-10-17 2007-10-09 Industrial Technology Research Institute Expression system for producing collagen
US8841255B2 (en) 2005-12-20 2014-09-23 Duke University Therapeutic agents comprising fusions of vasoactive intestinal peptide and elastic peptides
ATE455153T1 (en) 2006-03-13 2010-01-15 Becker & Co Naturinwerk COLLAGEN POWDER AND COLLAGEN-BASED THERMOPLASTIC COMPOSITION FOR PRODUCING MOLDED BODIES
EP2054442A2 (en) * 2006-06-14 2009-05-06 Cell-Matrix, Inc. Denatured collagen peptides and uses thereof
US7700126B2 (en) 2006-09-29 2010-04-20 Martin Kean Chong Ng Tropoelastin-based protoelastin biomaterials
US8759487B2 (en) 2007-10-26 2014-06-24 Collplant Ltd. Methods of processing recombinant procollagen
US7910134B2 (en) 2007-10-29 2011-03-22 Ayman Boutros Alloplastic injectable dermal filler and methods of use thereof
US8507652B2 (en) 2008-02-08 2013-08-13 Luis Eduardo da Cruz Pharmaceutical composition, dressing and method for treating skin lesion, intermediate composition and process for preparing said dressing, and use of cerium salt associated with a collagen matrix
GB0820784D0 (en) * 2008-11-13 2008-12-24 Nordic Bioscience As Assessment of protein degradation by measurement of isomerised neo-epitope containing fragments
WO2010091251A2 (en) 2009-02-06 2010-08-12 The University Of Medicine And Dentistry Of New Jersey Modular triple-helical collagen-like products
ES2635494T3 (en) * 2009-03-30 2017-10-04 Nordic Bioscience A/S Fibrosis Biomarker Assay
US8618250B2 (en) 2009-07-17 2013-12-31 The Texas A&M University System Designer collagens and use thereof
US9402857B2 (en) 2009-07-23 2016-08-02 U.S. Nutraceuticals, LLC Composition and method to alleviate joint pain using low molecular weight hyaluronic acid and astaxanthin
DE102010060564A1 (en) 2010-11-15 2012-05-16 Gelita Ag Use of collagen hydrolyzate to improve the health of human skin, hair and / or nails
EP2701508A4 (en) 2011-04-26 2015-01-07 Univ Leland Stanford Junior Production and delivery of a stable collagen
MX351565B (en) 2011-08-03 2017-10-19 Phoenix Tissue Repair Inc COLLAGEN 7 and RELATED METHODS.
TWI592421B (en) 2011-08-09 2017-07-21 双美生物科技股份有限公司 Triple-crosslinked collagen, method of manufacture and use thereof
AU2012312170C1 (en) 2011-09-21 2018-01-04 Shiseido Company, Ltd. Compositions and methods for treating conditions of compromised skin barrier function
US9591853B2 (en) 2013-01-07 2017-03-14 Ramot At Tel-Aviv University Ltd. Jellyfish-derived polymer
TWI657094B (en) 2013-03-21 2019-04-21 全民科學與工業研究機構 Purification of triple helical proteins
WO2015031950A1 (en) 2013-09-09 2015-03-12 Commonwealth Scientific And Industrial Research Organisation Modified bacterial collagen-like proteins
CN107223019A (en) 2013-09-25 2017-09-29 胺细拉健康公司 Composition and preparation and its generation and application method for maintaining and improving muscle quality, intensity and performance
US10232008B1 (en) 2015-10-05 2019-03-19 Michael P. Moran Multi-purpose nutritional supplement composition
CA3002455C (en) 2015-11-09 2024-02-13 Shiseido Americas Corporation Compositions and methods for application over skin
GB201601136D0 (en) 2016-01-21 2016-03-09 Mörgelin Matthias And Abdillahi Suado M Novel polypeptides and medical uses thereof
US10226550B2 (en) 2016-03-11 2019-03-12 Brigham Young University Cationic steroidal antimicrobial compositions for the treatment of dermal tissue
JP6985282B2 (en) 2016-03-16 2021-12-22 フェニックス ティシュー リペア インコーポレイテッドPhoenix Tissue Repair, Inc. Method for purifying type 7 collagen
CN106554410B (en) 2016-06-02 2019-11-26 陕西东大生化科技有限责任公司 A kind of recombination human source collagen and its encoding gene and preparation method
CN106119322B (en) 2016-07-22 2019-10-15 江苏江山聚源生物技术有限公司 A kind of zymotechnique improving recombination human source collagen production level
EP3506929A1 (en) 2016-08-30 2019-07-10 Gelita AG Use of collagen hydrolysate for improving endurance performance and for stimulating lipocatabolism
FR3058142B1 (en) 2016-10-28 2023-11-24 Gelatines Weishardt COMPOSITION OF COLLAGEN PEPTIDES FROM FISH SKIN AND ITS USE AS MEDICINE
CL2016003387A1 (en) 2016-12-29 2018-10-12 Univ De Santiago De Chile Usach Coating and / or edible film for the preservation of meat products
WO2019023555A1 (en) 2017-07-28 2019-01-31 Evelo Biosciences, Inc. Polymer compositions
WO2019046943A1 (en) 2017-09-06 2019-03-14 University Of Ottawa Collagen-like proteins
GB201717134D0 (en) 2017-10-18 2017-12-06 Univ Swansea Monomeric collagen
DE102018104590A1 (en) 2018-02-28 2019-08-29 Gelita Ag Nutraceutical or pharmaceutical composition
WO2020205848A1 (en) * 2019-04-01 2020-10-08 Geltor, Inc. Topical formulations of recombinant collagens
US20220233651A1 (en) 2019-06-03 2022-07-28 Société des Produits Nestlé S.A. Recover dietary supplement
AU2021211721A1 (en) 2020-01-24 2022-08-18 Geltor, Inc. Animal-free dietary collagen

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004052910A1 (en) * 2002-11-14 2004-06-24 Affiliated Hospital Of Academy Of Military Medical Sciences, Pla A full-length polynucleotide coding chicken type ii collagen and the use of it
US20150175969A1 (en) * 2012-09-26 2015-06-25 Fujifilm Corporation Polypeptide, scaffold composition, composition for cartilage tissue restoration, composition for cartilage cell culture, and composition for promoting glycosaminoglycan production
WO2019068018A2 (en) * 2017-09-28 2019-04-04 Geltor, Inc. Recombinant collagen and elastin molecules and uses thereof
WO2019103981A1 (en) * 2017-11-22 2019-05-31 Geltor Inc. Methods and systems for engineering collagen

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4093761A4 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11174300B2 (en) 2020-01-24 2021-11-16 Geltor, Inc. Animal-free dietary collagen
US11332505B2 (en) 2020-01-24 2022-05-17 Geltor, Inc. Animal-free dietary collagen
WO2023009673A1 (en) * 2021-07-28 2023-02-02 Geltor, Inc. Animal-free cosmetic collagens

Also Published As

Publication number Publication date
US11332505B2 (en) 2022-05-17
US11174300B2 (en) 2021-11-16
US20220017581A1 (en) 2022-01-20
EP4093761A1 (en) 2022-11-30
US20210277075A1 (en) 2021-09-09
TW202134267A (en) 2021-09-16
JP2023513435A (en) 2023-03-31
EP4093761A4 (en) 2024-04-17
CA3168802A1 (en) 2021-07-29
CN115298212A (en) 2022-11-04
GB2610313B (en) 2024-07-03
AU2021211721A1 (en) 2022-08-18
GB202212264D0 (en) 2022-10-05
BR112022014586A2 (en) 2022-09-13
US20220332775A1 (en) 2022-10-20
MX2022009036A (en) 2022-11-14
GB2610313A (en) 2023-03-01

Similar Documents

Publication Publication Date Title
US11174300B2 (en) Animal-free dietary collagen
KR101095698B1 (en) Collagen peptide composition and food or beverage containing the same
KR101382758B1 (en) Collagen peptide composition having good blood transfer properties, and food and drink containing same
JP5894341B2 (en) Composition comprising collagen peptide, elastin peptide and proteoglycan
CN109222103A (en) Increase flesh composition and health food
JP4834671B2 (en) Composition effective for prevention and treatment of adult diseases
US20210128640A1 (en) Hyaluronic acid production promoting agent
JP2007261999A (en) Hypotensive peptide derived from royal jelly
CN111093770A (en) Health promoting composition and related application of method using supplement
JP5027361B2 (en) Hyaluronic acid production promoter
JP5712393B2 (en) Collagen absorption promoter and use thereof
JP2006143671A (en) Oral skin aging-preventing/improving agent
JP5394644B2 (en) Muscle enhancer containing asperroside or its analog
JP6456032B2 (en) Sirt1 activator and use of the Sirt1 activator
JP6779851B2 (en) Hyaluronic acid production promoter
JP6547183B2 (en) Composition for prevention or treatment of osteoarthritis comprising triterpene as an active ingredient
JP7060890B2 (en) Hyaluronic acid production promoter
JP6629469B1 (en) An antihypertensive agent comprising a chondroitin sulfate-containing porcine cartilage extract as an active ingredient and a food composition containing the same
KR102673625B1 (en) Peptide, composition, and method for treating, preventing, or ameliorating mood disorder
JP2009102226A (en) Therapeutic agent for spinal cord injury
JP6091067B2 (en) Cell activator and its use
JP2023067042A (en) Dynamic balance-improving agent in walking function, anxiety reducer for falling and walking function-improving agent for people with reduced locomotive function
KR101617770B1 (en) Composition comprising T.s 15-1 protein from Intestinal Parasitic Nematode for anti-aging of skin or wound healing
KR20150110471A (en) Composition, food or drink, visceral fat reducing agent and blood sugar level lowering agent

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21745159

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3168802

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022545046

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022014586

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2021211721

Country of ref document: AU

Date of ref document: 20210122

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 202212264

Country of ref document: GB

Kind code of ref document: A

Free format text: PCT FILING DATE = 20210122

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021745159

Country of ref document: EP

Effective date: 20220824

ENP Entry into the national phase

Ref document number: 112022014586

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220722