WO2021081239A1 - T-cell modulatory chimeric molecules and methods of use thereof - Google Patents
T-cell modulatory chimeric molecules and methods of use thereof Download PDFInfo
- Publication number
- WO2021081239A1 WO2021081239A1 PCT/US2020/056908 US2020056908W WO2021081239A1 WO 2021081239 A1 WO2021081239 A1 WO 2021081239A1 US 2020056908 W US2020056908 W US 2020056908W WO 2021081239 A1 WO2021081239 A1 WO 2021081239A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- amino acid
- acid sequence
- cases
- chimeric molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
Definitions
- T-CELL MODULATORY CHIMERIC MOLECULES AND METHODS OF USE THEREOF CROSS-REFERENCE [0001] This application claims the benefit of U.S. Provisional Patent Application No.62/925,115, filed October 23, 2019, which application is incorporated herein by reference in its entirety.
- INTRODUCTION [0002] An adaptive immune response involves the engagement of the T cell receptor (TCR), present on the surface of a T cell, with a small peptide antigen non-covalently presented on the surface of an antigen presenting cell (APC) by a major histocompatibility complex (MHC; also referred to in humans as a human leukocyte antigen (HLA) complex).
- TCR T cell receptor
- APC antigen presenting cell
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- This engagement represents the immune system’s targeting mechanism and is a requisite molecular interaction for T cell modulation (activation or inhibition) and effector function.
- T cell modulation activation or inhibition
- the targeted T cells are activated through engagement of costimulatory proteins found on the APC with counterpart costimulatory proteins the T cells.
- costimulatory proteins found on the APC with counterpart costimulatory proteins the T cells.
- Both signals – epitope/TCR binding and engagement of APC costimulatory proteins with T cell costimulatory proteins – are required to drive T cell specificity and activation or inhibition.
- the TCR is specific for a given epitope; however, the costimulatory protein not epitope specific and instead is generally expressed on all T cells or on large T cell subsets.
- the present disclosure provides a chimeric molecule comprising: a) a T-cell modulatory multimeric polypeptide (TMMP); and b) a nucleic acid component, where the nucleic acid component comprises a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR) comprising an antibody that binds a cancer-associated antigen.
- TMMP T-cell modulatory multimeric polypeptide
- CAR chimeric antigen receptor
- the TMMP binds to and activates a target T cell; the nucleic acid component is taken up by the target T cell such that the target T cell expresses the CAR on its surface.
- the present disclosure provides methods of making the chimeric molecule.
- the present disclosure provides treatment methods comprising administering the chimeric molecule.
- FIG.1A-1B provide schematic depictions of exemplary embodiments of TMMPs.
- FIG.2A-2B provide schematic depictions of double disulfide-linked TMMPs.
- FIGs.3A-3G provide amino acid sequences (from top to bottom SEQ ID NOs: 376-387) of immunoglobulin Fc polypeptides.
- FIG.4 provides a multiple amino acid sequence alignment of beta-2 microglobulin ( ⁇ 2M) precursors (i.e., including the leader sequence) from Homo sapiens (NP_004039.1; SEQ ID NO:388), Pan troglodytes (NP_001009066.1; SEQ ID NO:388), Macaca mulatta (NP_001040602.1; SEQ ID NO:389), Bos taurus (NP_776318.1; SEQ ID NO:390) and Mus musculus (NP_033865.2; SEQ ID NO:391).
- Amino acids 1-20 are a signal peptide.
- FIGs.5A-5C provide amino acid sequences of full-length human HLA heavy chains of alleles A*0101 (SEQ ID NO:392), A*1101 (SEQ ID NO:393), A*2402 (SEQ ID NO:394), and A*3303 (SEQ ID NO:395) (FIG.5A); full-length human HLA heavy chain of allele B*0702 (FIG.5B; SEQ ID NO:396); and a full-length human HLA-C heavy chain (FIG.5C; SEQ ID NO:397).
- FIG.6 provides an alignment of eleven mature MHC class I heavy chain amino acid sequences without their leader sequences, transmembrane domains, and intracellular domains.
- FIGs.7A-7B provide an alignment of HLA-A heavy chain amino acid sequences (FIG.7A; from top to bottom SEQ ID NOs: 406, 185, 407-413) and a consensus sequence (FIG.7B; SEQ ID NO: 184).
- FIGs.8A-8B provide an alignment of HLA-B heavy chain amino acid sequences (FIG.8A; from top to bottom SEQ ID NOs: 195, 414-419) and a consensus sequence (FIG.8B; SEQ ID NO: 194).
- FIGs.9A-9B provide an alignment of HLA-C heavy chain amino acid sequences (FIG.9A; from top to bottom SEQ ID NOs: 420-424, 199, 425-427) and a consensus sequence (FIG.9B; SEQ ID NO: 198).
- FIG.10 provides a consensus amino acid sequence for each of HLA-E (SEQ ID NO:428), -F (SEQ ID NO:429), and -G (SEQ ID NO:430) heavy chains.
- Variable amino acid (aa) positions are indicated as “X” residues sequentially numbered; the locations of amino acids 84, 139, and 236 are double underlined.
- FIG.11 provides an alignment of consensus amino acid sequences for HLA-A (SEQ ID NO:184), -B (SEQ ID NO:194), -C (SEQ ID NO:198), -E (SEQ ID NO:431), -F (SEQ ID NO:432), and -G (SEQ ID NO:433).
- polynucleotide and nucleic acid used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- the terms ''peptide,” ''polypeptide,” and “protein” are used interchangeably herein, and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
- a polynucleotide or polypeptide has a certain percent "sequence identity" to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences. Sequence identity can be determined in a number of different ways.
- sequences can be aligned using various convenient methods and computer programs (e.g., BLAST, T-COFFEE, MUSCLE, MAFFT, etc.), available over the world wide web at sites including ncbi.nlm.nili.gov/BLAST, ebi.ac.uk/Tools/msa/tcoffee/, ebi.ac.uk/Tools/msa/muscle/, mafft.cbrc.jp/alignment/software/. See, e.g., Altschul et al. (1990), J. Mol. Bioi.215:403-10.
- a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide containing side chains consisting of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; a group of amino acids having acidic side chains consists of glutamate and aspartate; and a group of amino acids having sulfur containing side chains consists of cysteine and methionine.
- Exemplary conservative amino acid substitution groups are: valine- leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine-glycine, and asparagine- glutamine.
- the term “immunological synapse” or “immune synapse” as used herein generally refers to the natural interface between two interacting immune cells of an adaptive immune response including, e.g., the interface between an antigen-presenting cell (APC) or target cell and an effector cell, e.g., a lymphocyte, an effector T cell, a natural killer cell, and the like.
- APC antigen-presenting cell
- effector cell e.g., a lymphocyte, an effector T cell, a natural killer cell, and the like.
- T cell includes all types of immune cells expressing CD3, including T-helper cells (CD4 + cells), cytotoxic T-cells (CD8 + cells), T-regulatory cells (Treg), and NK-T cells.
- immunomodulatory polypeptide includes a polypeptide on an antigen presenting cell (APC) (e.g., a dendritic cell, a B cell, and the like) that specifically binds a cognate co-immunomodulatory polypeptide on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with a major histocompatibility complex (MHC) polypeptide loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- APC antigen presenting cell
- MHC major histocompatibility complex
- An immunomodulatory polypeptide can include, but is not limited to, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, Fas ligand (FasL), inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, HVEM, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
- an “immunomodulatory polypeptide” specifically binds a cognate co-immunomodulatory polypeptide on a T cell.
- An “immunomodulatory domain” (“MOD”) of a TMMP binds a cognate co-immunomodulatory polypeptide, which may be present on a target T cell.
- a T-cell modulatory polypeptide comprises a polypeptide that preferentially binds to and activates target T cells bearing a T cell receptor (TCR) specific for an antigen of interest.
- a T-cell modulatory multimeric polypeptide comprises a multimeric T-cell modulatory polypeptide that preferentially binds to and activates target T cells bearing a T cell receptor (TCR) specific for an antigen of interest.
- a TMMP can comprise at least one heterodimer comprising 2 polypeptide chains: a) a first polypeptide comprising: i) a peptide epitope (e.g., a peptide that is at least 4 amino acids in length (e.g., from 4 amino acids to about 25 amino acids in length); and ii) first MHC polypeptide; b) a second polypeptide comprising a second MHC polypeptide, and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the immunomodulatory polypeptide.
- a first polypeptide comprising: i) a peptide epitope (e.g., a peptide that is at least 4 amino acids in length (e.g., from 4 amino acids to about 25 amino acids in length); and ii) first MHC polypeptide; b) a second polypeptide comprising a second MHC polypeptide, and c) at least one immunomodulatory polypeptide
- a TMP or a TMMP also may be referred to as a “synTac” or an “Immuno-STATTM.”
- “Heterologous,” as used herein, means a nucleotide or polypeptide that is not found in the native nucleic acid or protein, respectively.
- the terms “expression construct,” or “DNA construct” are used interchangeably herein to refer to a DNA molecule comprising a vector and at least one insert.
- affinity refers to the equilibrium constant for the reversible binding of two agents (e.g., an antibody and an antigen) and is expressed as a dissociation constant (KD).
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1,000-fold greater, or more, than the affinity of an antibody for unrelated amino acid sequences.
- Affinity of an antibody to a target protein can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
- nM nanomolar
- pM picomolar
- fM femtomolar
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen- binding fragments.
- binding as used herein (e.g.
- Non-covalent binding refers to a direct association between two molecules, due to, for example, electrostatic, hydrophobic, ionic, and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- Non-covalent binding interactions are generally characterized by a dissociation constant (KD) of less than 10 -6 M, less than 10 -7 M, less than 10 -8 M, less than 10 -9 M, less than 10 -10 M, less than 10 -11 M, less than 10 -12 M, less than 10 -13 M, less than 10 -14 M, or less than 10 -15 M.
- KD dissociation constant
- Affinity refers to the strength of non-covalent binding, increased binding affinity being correlated with a lower KD.
- Specific binding generally refers to binding with an affinity of at least about 10 -7 M or greater, e.g., 5x 10 -7 M, 10 -8 M, 5 x 10 -8 M, 10 -9 M, and greater.
- Non-specific binding generally refers to binding (e.g., the binding of a ligand to a moiety other than its designated binding site or receptor) with an affinity of less than about 10 -7 M (e.g., binding with an affinity of 10- 6 M, 10 -5 M, 10 -4 M). However, in some contexts, e.g., binding between a TCR and a peptide/MHC complex, “specific binding” can be in the range of from 1 ⁇ M to 100 ⁇ M, or from 100 ⁇ M to 1 mM. “Covalent binding” or “covalent bond,” as used herein, refers to the formation of one or more covalent chemical binds between two different molecules.
- treatment means obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease or symptom in a mammal, and includes: (a) preventing the disease or symptom from occurring in a subject which may be predisposed to acquiring the disease or symptom but has not yet been diagnosed as having it; (b) inhibiting the disease or symptom, i.e., arresting its development; and/or (c) relieving the disease, i.e., causing regression of the disease.
- the therapeutic agent may be administered before, during or after the onset of disease or injury.
- the treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues.
- the subject therapy will desirably be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
- the terms "individual,” “subject,” “host,” and “patient,” are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired. Mammals include, e.g., humans, non-human primates, rodents (e.g., rats; mice), lagomorphs (e.g., rabbits), ungulates (e.g., cows, sheep, pigs, horses, goats, and the like), etc.
- antibodies and “immunoglobulin” include antibodies or immunoglobulins of any isotype, fragments of antibodies that retain specific binding to antigen, including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single-chain antibodies (scAb), single domain antibodies (dAb), single domain heavy chain antibodies, a single domain light chain antibodies, nanobodies, bi-specific antibodies, multi-specific antibodies, and fusion proteins comprising an antigen-binding (also referred to herein as antigen binding) portion of an antibody and a non-antibody protein.
- Fab single-chain antibodies
- dAb single domain antibodies
- dAb single domain heavy chain antibodies
- nanobodies bi-specific antibodies
- multi-specific antibodies and fusion proteins comprising an antigen-binding (also referred to herein as antigen binding) portion of an antibody and a non-antibody protein.
- the antibodies can be detectably labeled, e.g., with a radioisotope, an enzyme that generates a detectable product, a fluorescent protein, and the like.
- the antibodies can be further conjugated to other moieties, such as members of specific binding pairs, e.g., biotin (member of biotin-avidin specific binding pair), and the like.
- moieties such as members of specific binding pairs, e.g., biotin (member of biotin-avidin specific binding pair), and the like.
- a monoclonal antibody is an antibody produced by a group of identical cells, all of which were produced from a single cell by repetitive cellular replication.
- an antibody can be monovalent or bivalent.
- An antibody can be an Ig monomer, which is a “Y-shaped” molecule that consists of four polypeptide chains: two heavy chains and two light chains connected by disulfide bonds.
- the term "humanized immunoglobulin” as used herein refers to an immunoglobulin comprising portions of immunoglobulins of different origin, wherein at least one portion comprises amino acid sequences of human origin.
- the humanized antibody can comprise portions derived from an immunoglobulin of nonhuman origin with the requisite specificity, such as a mouse, and from immunoglobulin sequences of human origin (e.g., chimeric immunoglobulin), joined together chemically by conventional techniques (e.g., synthetic) or prepared as a contiguous polypeptide using genetic engineering techniques (e.g., DNA encoding the protein portions of the chimeric antibody can be expressed to produce a contiguous polypeptide chain).
- immunoglobulin of nonhuman origin e.g., chimeric immunoglobulin
- humanized immunoglobulin is an immunoglobulin containing one or more immunoglobulin chains comprising a complementarity-determining region (CDR) derived from an antibody of nonhuman origin and a framework region derived from a light and/or heavy chain of human origin (e.g., CDR-grafted antibodies with or without framework changes). Chimeric or CDR-grafted single chain antibodies are also encompassed by the term humanized immunoglobulin. See, e.g., U.S. Pat. No.4,816,567; European Patent No.0,125,023 B1; U.S. Pat.
- CDR complementarity-determining region
- Nb refers to the smallest antigen binding fragment or single variable domain (VHH) derived from naturally occurring heavy chain antibody and is known to the person skilled in the art. They are derived from heavy chain only antibodies, seen in camelids (Hamers- Casterman et al. (1993) Nature 363:446; Desmyter et al. (1996) Nature Structural Biol.3:803; and Desmyter et al. (2015) Curr. Opin. Struct. Biol.32:1). In the family of "camelids” immunoglobulins devoid of light polypeptide chains are found.
- “Camelids” comprise old world camelids (Camelus bactrianus and Camelus dromedarius) and new world camelids (for example, Llama paccos, Llama glama, Llama guanicoe and Llama vicugna).
- a single variable domain heavy chain antibody is referred to herein as a nanobody or a VHH antibody.
- “Antibody fragments” comprise a portion of an intact antibody, for example, the antigen binding or variable region of the intact antibody.
- antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng.8(10): 1057-1062 (1995)); domain antibodies (dAb; Holt et al. (2003) Trends Biotechnol.21:484); single-chain antibody molecules; and multi-specific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, a designation reflecting the ability to crystallize readily.
- Fv is the minimum antibody fragment that contains a complete antigen-recognition and - binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRS of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
- the “Fab” fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes.
- immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these classes can be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The subclasses can be further divided into types, e.g., IgG2a and IgG2b.
- Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding.
- a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding.
- CDR complementarity determining region
- CDR-H1 refers, respectively, to the first, second, and third CDRs in a heavy chain variable region.
- CDR-1 refers, respectively, to the first, second and third CDRs of either chain’s variable region.
- CDR-1 refers, respectively, to the first, second and third CDRs of either chain’s variable region.
- CAR chimeric antigen receptor
- CAR used interchangeably herein, refer to artificial multi-module molecules capable of triggering or inhibiting the activation of an immune cell which generally but not exclusively comprise an extracellular domain (e.g., a ligand/antigen binding domain), a transmembrane domain and one or more intracellular signaling domains.
- CAR is not limited specifically to CAR molecules but also includes CAR variants.
- CAR variants include split CARs wherein the extracellular portion (e.g., the ligand binding portion) and the intracellular portion (e.g., the intracellular signaling portion) of a CAR are present on two separate molecules.
- CAR variants also include ON-switch CARs which are conditionally activatable CARs, e.g., comprising a split CAR wherein conditional hetero-dimerization of the two portions of the split CAR is pharmacologically controlled.
- CAR variants also include bispecific CARs, which include a secondary CAR binding domain that can either amplify or inhibit the activity of a primary CAR.
- CAR variants also include inhibitory chimeric antigen receptors (iCARs) which may, e.g., be used as a component of a bispecific CAR system, where binding of a secondary CAR binding domain results in inhibition of primary CAR activation.
- CAR molecules and derivatives thereof i.e., CAR variants are described, e.g., in PCT Application No. US2014/016527; Fedorov et al. Sci Transl Med (2013) ;5(215):215ra172; Glienke et al. Front Pharmacol (2015) 6:21; Kakarla & Gottschalk 52 Cancer J (2014) 20(2):151-5; Riddell et al. Cancer J (2014) 20(2):141-4; Pegram et al.
- T-cell modulatory multimeric polypeptide includes a plurality of such polypeptides and reference to “the chimeric antigen receptor” includes reference to one or more chimeric antigen receptors and equivalents thereof known to those skilled in the art, and so forth.
- the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.
- certain features of the invention which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment.
- the present disclosure provides a chimeric molecule comprising: a) a T-cell modulatory multimeric polypeptide (TMMP); and b) a nucleic acid component, where the nucleic acid component comprises a nucleic acid comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), where the CAR comprises an antibody that binds a cancer-associated antigen.
- TMMP T-cell modulatory multimeric polypeptide
- CAR chimeric antigen receptor
- the present disclosure provides methods of making the chimeric molecule.
- the present disclosure provides treatment methods comprising administering the chimeric molecule.
- the TMMP present in a chimeric molecule of the present disclosure comprises a heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope, wherein the peptide epitope is a peptide having a length of at least 4 amino acids (e.g., from 4 amino acids to about 25 amino acids); and ii) a first major histocompatibility complex (MHC) polypeptide; b) a second polypeptide comprising a second MHC polypeptide; and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one immunomodulatory polypeptide.
- MHC major histocompatibility complex
- the TMMP activates a target T-cell that comprises a T-cell receptor (TCR) that binds to the peptide epitope present in the TMMP.
- TCR T-cell receptor
- the TMMP present in a chimeric molecule of the present disclosure comprises a peptide epitope that is not a cancer-associated antigen.
- the peptide epitope present in the TMMP is a viral peptide (a peptide of an antigen encoded by a virus) or a bacterial peptide.
- a viral epitope is an epitope present in a viral antigen encoded by a virus that infects a majority of the human population, where such viruses include, e.g., cytomegalovirus (CMV), Epstein- Barr virus (EBV), human papilloma virus (HPV), adenovirus, and the like.
- CMV cytomegalovirus
- EBV Epstein- Barr virus
- HPV human papilloma virus
- adenovirus adenovirus
- the target T-cell is activated by the TMMP.
- the target T-cell also takes up the nucleic acid component of the chimeric molecule, and expresses the encoded CAR on its surface.
- the activated, CAR-expressing target T-cell (“activated CAR-T cell”) exhibits cytotoxic activity toward a cancer cell expressing a cancer-associated antigen recognized and bound by the CAR.
- the present disclosure provides a chimeric molecule comprising: a) a T-cell modulatory multimeric polypeptide (TMMP); and b) a nucleic acid component covalently attached to the TMMP.
- TMMP T-cell modulatory multimeric polypeptide
- the TMMP comprises: a) a first polypeptide comprising: i) a peptide epitope, wherein the peptide epitope is a peptide having a length of at least 4 amino acids (e.g., from 4 amino acids to about 25 amino acids); and ii) a first major histocompatibility complex (MHC) polypeptide; b) a second polypeptide comprising a second MHC polypeptide; and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one immunomodulatory polypeptide.
- MHC major histocompatibility complex
- the TMMP optionally also includes an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold, where the first and/or the second polypeptide comprises the Ig Fc polypeptide or the non-Ig scaffold.
- the nucleic acid component covalently attached to the TMMP comprises one or more nucleic acids comprising nucleotide sequences encoding a chimeric antigen receptor (CAR).
- the CAR comprises an antigen- binding domain that binds to a cancer-associated antigen.
- a chimeric molecule of the present disclosure contacts a T-cell comprising a TCR specific for the peptide epitope present in the TMMP, the chimeric molecule is taken up by the T-cell (e.g., by endocytosis), to produce a modified T-cell.
- the nucleic acid portion of the chimeric molecule is transcribed in the modified T-cell, and the encoded CAR is synthesized by the modified T-cell, such that the CAR is expressed on the surface of the modified T-cell.
- a chimeric molecule of the present disclosure when a chimeric molecule of the present disclosure contacts a T-cell comprising a TCR specific for the peptide epitope present in the TMMP, the binding of the TMMP to the T-cell activates the T-cell.
- contacting a T-cell with a chimeric molecule of the present disclosure generates a modified, activated T-cell.
- the activated T-cell can, by virtue of the CAR expressed on its surface, bind to and kill a cancer cell that expresses on its surface the cancer-associated antigen to which the CAR binds.
- a chimeric molecule of the present disclosure can generate a CAR-T cell without the need to remove T cells from an individual and modify them in vitro to express a CAR.
- a chimeric molecule of the present disclosure comprises a TMMP comprising a heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope, wherein the peptide epitope is a peptide having a length of at least 4 amino acids (e.g., from 4 amino acids to about 25 amino acids); and ii) a first major histocompatibility complex (MHC) polypeptide; b) a second polypeptide comprising a second MHC polypeptide; and c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one immunomodulatory polypeptide.
- MHC major histocompatibility complex
- the TMMP optionally also includes an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold, where the first and/or the second polypeptide comprises the Ig Fc polypeptide or the non-Ig scaffold.
- Ig immunoglobulin
- peptide epitope means a peptide that, when complexed with MHC polypeptides, presents an epitope to a TCR.
- a peptide epitope has a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- a peptide epitope can present one or more epitopes to one or more TCRs.
- the peptide epitope present in a TMMP presents an infectious disease-associated epitope (e.g., a virus-encoded peptide).
- a TMMP comprises a heterodimeric polypeptide comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first MHC polypeptide; b) a second polypeptide comprising a second MHC polypeptide; c) at least one immunomodulatory polypeptide, where the first and/or the second polypeptide comprises the at least one (i.e., one or more) immunomodulatory polypeptide; and, optionally, d) an Ig Fc polypeptide or a non-Ig scaffold, where the first and/or the second polypeptide comprises the Ig Fc polypeptide or the non-Ig scaffold.
- the at least one immunomodulatory polypeptide is wild-type, i.e., comprises an amino acid sequence of a naturally- occurring immunomodulatory polypeptide.
- at least one of the one or more immunomodulatory polypeptides is a variant immunomodulatory polypeptide that exhibits reduced affinity to a cognate co-immunomodulatory polypeptide compared to the affinity of a corresponding wild-type immunomodulatory polypeptide for the cognate co-immunomodulatory polypeptide.
- the peptide epitope present in a TMMP of the present disclosure binds to a T-cell receptor (TCR) on a T cell with an affinity of at least 100 ⁇ M (e.g., at least 10 ⁇ M, at least 1 ⁇ M, at least 100 nM, at least 10 nM, or at least 1 nM).
- TCR T-cell receptor
- a TMMP of the present disclosure binds to a first T cell with an affinity that is at least 25% higher than the affinity with which the TMMP binds a second T cell, where the first T cell expresses on its surface the cognate co-immunomodulatory polypeptide and a TCR that binds the epitope with an affinity of at least 100 ⁇ M, and where the second T cell expresses on its surface the cognate co-immunomodulatory polypeptide but does not express on its surface a TCR that binds the epitope with an affinity of at least 100 ⁇ M (e.g., at least 10 ⁇ M, at least 1 ⁇ M, at least 100 nM, at least 10 nM, or at least 1 nM).
- a TMMP present in a chimeric molecule of the present disclosure is: [0044] A) a heterodimer comprising: a) a first polypeptide comprising a first MHC polypeptide; and b) a second polypeptide comprising a second MHC polypeptide, wherein the first polypeptide or the second polypeptide comprises a peptide epitope, wherein the first polypeptide and/or the second polypeptide comprises one or more immunomodulatory polypeptides that can be the same or different, and wherein at least one of the one or more immunomodulatory polypeptides may be a wild-type immunomodulatory polypeptide or a variant of a wild-type immunomodulatory polypeptide, wherein the variant immunomodulatory polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions compared to the amino acid sequence of the corresponding wild-type immunomodulatory polypeptide; wherein the first polypeptide and
- the epitope present in a TMMP of a chimeric molecule of the present disclosure binds to a TCR on a T cell with an affinity of from about 10 -4 M to about 5 x 10 -4 M, from about 5 x 10 -4 M to about 10 -5 M, from about 10 -5 M to 5 x 10 -5 M, from about 5 x 10 -5 M to 10 -6 M, from about 10 -6 M to about 5 x 10 -6 M, from about 5 x 10 -6 M to about 10 -7 M, from about 10 -7 M to about 5 x 10 -7 M, from about 5 x 10 -7 M to about 10 -8 M, or from about 10 -8 M to about 10 -9 M.
- the epitope present in a TMMP of the present disclosure binds to a TCR on a T cell with an affinity of from about 1 nM to about 5 nM, from about 5 nM to about 10 nM, from about 10 nM to about 50 nM, from about 50 nM to about 100 nM, from about 0.1 ⁇ M to about 0.5 ⁇ M, from about 0.5 ⁇ M to about 1 ⁇ M, from about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10 ⁇ M to about 25 ⁇ M, from about 25 ⁇ M to about 50 ⁇ M, from about 50 ⁇ M to about 75 ⁇ M, from about 75 ⁇ M to about 100 ⁇ M.
- an immunomodulatory polypeptide present in a TMMP of a chimeric molecule of the present disclosure comprises a wild-type (naturally-occurring) amino acid sequence.
- an immunomodulatory polypeptide present in a TMMP of a chimeric molecule of the present disclosure binds to its cognate co-immunomodulatory polypeptide with an affinity that it at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the affinity of a corresponding wild-type immunomodulatory polypeptide for the cognate co-immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide present in a TMMP of a chimeric molecule of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from 1 nM to 100 nM, or from 100 nM to 100 ⁇ M.
- a variant immunomodulatory polypeptide present in a TMMP of a chimeric molecule of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10 ⁇ M to about 15 ⁇ M, from
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 1 nM to about 5 nM, from about 5 nM to about 10 nM, from about 10 nM to about 50 nM, from about 50 nM to about 100 nM [0055]
- the combination of the reduced affinity of the immunomodulatory polypeptide for its cognate co-immunomodulatory polypeptide, and the affinity of the epitope for a TCR provides for enhanced selectivity of a TMMP.
- a TMMP binds selectively to a first T cell that displays both: i) a TCR specific for the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP, compared to binding to a second T cell that displays: i) a TCR specific for an epitope other than the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP.
- a TMMP of the present disclosure binds to the first T cell with an affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 2.5-fold, at least 5-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 50-fold, at least 100-fold, or more than 100-fold, higher than the affinity to which it binds the second T cell.
- a chimeric molecule of the present disclosure when administered to an individual in need thereof, induces both an epitope-specific T cell response and an epitope non-specific T cell response.
- a chimeric molecule of the present disclosure when administered to an individual in need thereof, induces an epitope-specific T cell response by modulating the activity of a first T cell that displays both: i) a TCR specific for the epitope present in the TMMP; ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP; and induces an epitope non-specific T cell response by modulating the activity of a second T cell that displays: i) a TCR specific for an epitope other than the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP.
- the ratio of the epitope-specific T cell response to the epitope-non-specific T cell response is at least 2:1, at least 5:1, at least 10:1, at least 15:1, at least 20:1, at least 25:1, at least 50:1, or at least 100:1.
- the ratio of the epitope-specific T cell response to the epitope-non-specific T cell response is from about 2:1 to about 5:1, from about 5:1 to about 10:1, from about 10:1 to about 15:1, from about 15:1 to about 20:1, from about 20:1 to about 25:1, from about 25:1 to about 50:1, or from about 50:1 to about 100:1, or more than 100:1.
- Modulating the activity” of a T cell can include one or more of: i) activating a cytotoxic (e.g., CD8 + ) T cell; ii) inducing cytotoxic activity of a cytotoxic (e.g., CD8 + ) T cell; iii) inducing production and release of a cytotoxin (e.g., a perforin; a granzyme; a granulysin) by a cytotoxic (e.g., CD8 + ) T cell; iv) inhibiting activity of an autoreactive T cell; and the like.
- a cytotoxic e.g., CD8 +
- a cytotoxic activity of a cytotoxic e.g., CD8 +
- a cytotoxin e.g., a perforin; a granzyme; a granulysin
- TMMP binds with higher avidity to a first T cell that displays both: i) a TCR specific for the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP, compared to the avidity to which it binds to a second T cell that displays: i) a TCR specific for an epitope other than the epitope present in the TMMP; and ii) a co-immunomodulatory polypeptide that binds to the immunomodulatory polypeptide present in the TMMP.
- Binding affinity between an immunomodulatory polypeptide and its cognate co- immunomodulatory polypeptide can be determined by bio-layer interferometry (BLI) using purified immunomodulatory polypeptide and purified cognate co-immunomodulatory polypeptide.
- Binding affinity between a TMMP and its cognate co-immunomodulatory polypeptide can be determined by BLI using purified TMMP and the cognate co-immunomodulatory polypeptide.
- BLI methods are well known to those skilled in the art. See, e.g., Lad et al. (2015) J. Biomol. Screen.20(4):498-507; and Shah and Duncan (2014) J. Vis. Exp.18:e51383.
- a BLI assay can be carried out using an Octet RED 96 (Pal FortéBio) instrument, or a similar instrument, as follows.
- a TMMP e.g., a TMMP of the present disclosure; a control TMMP (where a control TMMP comprises a wild-type immunomodulatory polypeptide)
- the immobilized TMMP is the “target.” Immobilization can be effected by immobilizing a capture antibody onto the insoluble support, where the capture antibody immobilizes the TMMP.
- immobilization can be effected by immobilizing anti-Fc (e.g., anti-human IgG Fc) antibodies onto the insoluble support, where the immobilized anti-Fc antibodies bind to and immobilize the TMMP (where the TMMP comprises an IgFc polypeptide).
- a co- immunomodulatory polypeptide is applied, at several different concentrations, to the immobilized TMMP, and the instrument’s response recorded.
- Assays are conducted in a liquid medium comprising 25mM HEPES pH 6.8, 5% poly(ethylene glycol) 6000, 50 mM KCl, 0.1% bovine serum albumin, and 0.02% Tween 20 nonionic detergent.
- Binding of the co-immunomodulatory polypeptide to the immobilized TMMP is conducted at 30°C.
- an anti-MHC Class I monoclonal antibody can be used as a positive control for binding affinity.
- anti-HLA Class I monoclonal antibody W6/32 (American Type Culture Collection No. HB-95; Parham et al. (1979) J. Immunol.123:342), which has a K D of 7 nM, can be used.
- a standard curve can be generated using serial dilutions of the anti-MHC Class I monoclonal antibody.
- the co-immunomodulatory polypeptide, or the anti-MHC Class I mAb, is the “analyte.”
- BLI analyzes the interference pattern of white light reflected from two surfaces: i) from the immobilized polypeptide (“target”); and ii) an internal reference layer.
- a change in the number of molecules (“analyte”; e.g., co-immunomodulatory polypeptide; anti-HLA antibody) bound to the biosensor tip causes a shift in the interference pattern; this shift in interference pattern can be measured in real time.
- the two kinetic terms that describe the affinity of the target/analyte interaction are the association constant (k a ) and dissociation constant (k d ).
- the BLI assay is carried out in a multi-well plate. To run the assay, the plate layout is defined, the assay steps are defined, and biosensors are assigned in Octet Data Acquisition software. The biosensor assembly is hydrated. The hydrated biosensor assembly and the assay plate are equilibrated for 10 minutes on the Octet instrument. Once the data are acquired, the acquired data are loaded into the Octet Data Analysis software. The data are processed in the Processing window by specifying method for reference subtraction, y-axis alignment, inter-step correction, and Savitzky-Golay filtering.
- KD values for each data trace can be averaged if within a 3-fold range.
- KD error values should be within one order of magnitude of the affinity constant values; R 2 values should be above 0.95. See, e.g., Abdiche et al. (2008) J. Anal. Biochem.377:209.
- the affinity of a TMMP for a cognate co-immunomodulatory polypeptide is determined using BLI, as described above.
- the ratio of: i) the binding affinity of a control TMMP (where the control comprises a wild-type immunomodulatory polypeptide) to a cognate co-immunomodulatory polypeptide to ii) the binding affinity of a TMMP of the present disclosure comprising a variant of the wild-type immunomodulatory polypeptide to the cognate co-immunomodulatory polypeptide, when measured by BLI (as described above), is at least 1.5:1, at least 2:1, at least 5:1, at least 10:1, at least 15:1, at least 20:1, at least 25:1, at least 50:1, at least 100:1, at least 500:1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 :1, at least 10 4 :1, at least 10 5 :1, or at least 10 6 :1.
- the ratio of: i) the binding affinity of a control TMMP (where the control comprises a wild-type immunomodulatory polypeptide) to a cognate co-immunomodulatory polypeptide to ii) the binding affinity of a TMMP comprising a variant of the wild-type immunomodulatory polypeptide to the cognate co- immunomodulatory polypeptide, when measured by BLI, is in a range of from 1.5:1 to 10 6 :1, e.g., from 1.5:1 to 10:1, from 10:1 to 50:1, from 50:1 to 10 2 :1, from 10 2 :1 to 10 3 :1, from10 3 :1 to 10 4 :1, from 10 4 :1 to 10 5 :1, or from 10 5 :1 to 10 6 :1.
- a control TMMP comprises a wild-type IL-2 polypeptide
- a TMMP of a chimeric molecule of the present disclosure comprises a variant IL-2 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type IL-2 polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type IL-2 polypeptide
- a TMMP of a chimeric molecule of the present disclosure comprises a variant IL-2 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type IL-2 polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type CD80 polypeptide
- a TMMP of the present disclosure comprises a variant CD80 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD80 polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type CD80 polypeptide
- a TMMP of the present disclosure comprises a variant CD80 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD80 polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type 4-1BBL polypeptide
- a TMMP of the present disclosure comprises a variant 4-1BBL polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type 4-1BBL polypeptide) as the immunomodulatory polypeptide
- a control TMMP comprises a wild-type CD86 polypeptide
- a TMMP of the present disclosure comprises a variant CD86 polypeptide (comprising from 1 to 10 amino acid substitutions relative to the amino acid sequence of the wild-type CD86 polypeptide) as the immunomodulatory polypeptide
- Binding affinity of a TMMP of the present disclosure to a target T cell can be measured in the following manner: A) contacting a TMMP of the present disclosure with a target T-cell expressing on its surface: i) a cognate co-immunomodulatory polypeptide that binds the parental wild-type immunomodulatory polypeptide; and ii) a T-cell receptor that binds to the epitope, where the TMMP comprises an epitope tag, such that the TMMP binds to the target T-cell; B) contacting the target T-cell- bound TMMP with a fluorescently labeled binding agent (e.g., a fluorescently labeled antibody) that binds to the epitope tag, generating a TMMP/target T-cell/binding agent complex; C) measuring the mean fluorescence intensity (MFI) of the TMMP/target T-cell/binding agent complex using flow cytometry.
- MFI mean fluorescence intensity
- the epitope tag can be, e.g., a FLAG tag, a hemagglutinin tag, a c-myc tag, a poly(histidine) tag, etc.
- the MFI measured over a range of concentrations of the TMMP library member provides a measure of the affinity.
- the MFI measured over a range of concentrations of the TMMP library member provides a half maximal effective concentration (EC 50 ) of the TMMP.
- the EC 50 of a TMMP of the present disclosure for a target T cell is in the nM range; and the EC50 of the TMMP for a control T cell (where a control T cell expresses on its surface: i) a cognate co-immunomodulatory polypeptide that binds the parental wild-type immunomodulatory polypeptide; and ii) a T-cell receptor that does not bind to the epitope present in the TMMP) is in the ⁇ M range.
- the ratio of the EC 50 of a TMMP of the present disclosure for a control T cell to the EC 50 of the TMMP for a target T cell is at least 1.5:1, at least 2:1, at least 5:1, at least 10:1, at least 15:1, at least 20:1, at least 25:1, at least 50:1, at least 100:1, at least 500:1, at least 10 2 :1, at least 5 x 10 2 :1, at least 10 3 :1, at least 5 x 10 3 :1, at least 10 4 :1, at lease 10 5 :1, or at least 10 6 :1.
- the ratio of the EC 50 of a TMMP of the present disclosure for a control T cell to the EC 50 of the TMMP for a target T cell is an expression of the selectivity of the TMMP.
- a TMMP of the present disclosure exhibits selective binding to target T-cell, compared to binding of the TMMP library member to a control T cell that comprises: i) the cognate co-immunomodulatory polypeptide that binds the parental wild-type immunomodulatory polypeptide; and ii) a T-cell receptor that binds to an epitope other than the epitope present in the TMMP library member.
- a peptide epitope present in a TMMP of a chimeric molecule of the present disclosure can have a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids in length (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 amino acids, from 6 to 18 amino acids, from 8 to 15 amino acids, from 8 to 12 amino acids, from 5 to 10 amino acids, from 10 to 20 amino acids, and from 15 to 25 amino acids in length).
- a TMMP of a chimeric molecule of the present disclosure comprises any of a variety of peptide epitopes.
- a peptide epitope present in a TMMP of the present disclosure is a peptide that, when complexed with MHC polypeptides, presents an epitope to a T-cell receptor (TCR).
- TCR T-cell receptor
- An epitope-specific T cell binds an epitope having a given amino acid sequence, i.e., a “reference” amino acid sequence, but does not substantially bind an epitope that differs from the reference amino acid sequence.
- an epitope-specific T cell binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- An epitope-specific T cell can bind an epitope having a reference amino acid sequence, i.e., for which it is specific, with an affinity of at least 10 -7 M, at least 10 -8 M, at least 10 -9 M, or at least 10 -10 M.
- the epitope peptide present in a TMMP of a chimeric molecule of the present disclosure presents an epitope specific to an HLA-A, -B, -C, -E, -F, or -G allele.
- the epitope peptide present in a TMMP presents an epitope restricted to HLA-A*0101, A*0201, A*0301, A*1101, A*2301, A*2402, A*2407, A*3303, and/or A*3401.
- the epitope peptide present in a TMMP presents an epitope restricted to HLA- B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and/or B*5301.
- the epitope peptide present in a TMMP presents an epitope restricted to C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*702, C*0801, and/or C*1502.
- the peptide epitope is a viral epitope.
- a viral epitope is an epitope present in a viral antigen encoded by a virus that infects a majority of the human population, where such viruses include, e.g., cytomegalovirus (CMV), Epstein-Barr virus (EBV), human papilloma virus, influenza virus, adenovirus, and the like.
- the peptide epitope is a bacterial epitope, e.g., a bacterial epitope that is included in a vaccine and to which a majority of the human population has immunity.
- a TMMP present in a chimeric molecule of the present disclosure comprises a CMV peptide epitope, i.e., a peptide that when in an MHC/peptide complex (e.g., an HLA/peptide complex), presents a CMV epitope (i.e., an epitope present in a CMV antigen) to a T cell.
- a CMV peptide epitope i.e., a peptide that when in an MHC/peptide complex (e.g., an HLA/peptide complex)
- an MHC/peptide complex e.g., an HLA/peptide complex
- a CMV peptide epitope has a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- a given CMV epitope-specific T cell binds an epitope having a reference amino acid sequence of a given CMV epitope, but does not substantially bind an epitope that differs from the reference amino acid sequence.
- a given CMV epitope-specific T cell binds a CMV epitope having a reference amino acid sequence, and binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- a given CMV epitope-specific T cell can bind an epitope for which it is specific with an affinity of at least 10 -7 M, at least 10 -8 M, at least 10 -9 M, or at least 10 -10 M.
- a CMV peptide epitope present in a TMMP of a chimeric molecule of the present disclosure is a peptide from CMV pp65.
- a CMV peptide epitope present in a TMMP of a chimeric molecule of the present disclosure is a peptide from CMV gB (glycoprotein B).
- a CMV peptide epitope present in a TMMP of a chimeric molecule of the present disclosure is a peptide of a CMV polypeptide having a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within aa
- a CMV peptide epitope present in a TMMP of a chimeric molecule of the present disclosure has the amino acid sequence NLVPMVATV (SEQ ID NO:172) and has a length of 9 amino acids.
- a CMV peptide epitope present in a TMMP of a chimeric molecule of the present disclosure is a peptide having a length of at least 4 amino acids, e.g., from 4 amino acids to about 25 amino acids (e.g., 4 amino acids (aa), 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, 10 aa, 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, 20 aa, 21 aa, 22 aa, 23 aa, 24 aa, or 25 aa, including within a range of from 4 to 20 aa., from 6 to 18 aa., from 8 to 15 aa.
- the CMV epitope present in a TMMP of a chimeric molecule of the present disclosure presents an epitope specific to an HLA-A, -B, -C, -E, -F, or -G allele.
- the epitope peptide present in a TMMP presents an epitope restricted to HLA-A*0101, A*0201, A*0301, A*1101, A*2301, A*2402, A*2407, A*3303, and/or A*3401.
- the CMV epitope present in a TMMP of the present disclosure presents an epitope restricted to HLA- B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and/or B*5301.
- a TMMP of the present disclosure presents an epitope restricted to C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*702, C*0801, and/or C*1502.
- a TMMP of the present disclosure comprises: a) a CMV peptide epitope having amino acid sequence NLVPMVATV (SEQ ID NO:172) and having a length of 9 amino acids; b) an HLA-A*0201 class I heavy chain polypeptide; and c) a ⁇ 2M polypeptide.
- HPV epitopes An HPV peptide suitable for inclusion in a TMMP of a chimeric molecule of the present disclosure can be a peptide of an HPV E6 polypeptide or an HPV E7 polypeptide.
- the HPV epitope can be an epitope of HPV of any of a variety of genotypes, including, e.g., HPV16, HPV18, HPV31, HPV33, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58, HPV59, HPV68, HPV73, or HPV82.
- the epitope is an HPV E6 epitope.
- the epitope is an HPV E7 epitope.
- An HPV epitope present in a TMMP of a chimeric molecule of the present disclosure is a peptide specifically bound by a T-cell, i.e., the epitope is specifically bound by an HPV epitope-specific T cell.
- An epitope-specific T cell binds an epitope having a reference amino acid sequence, but does not substantially bind an epitope that differs from the reference amino acid sequence.
- an epitope-specific T cell binds an epitope having a reference amino acid sequence, and binds an epitope that differs from the reference amino acid sequence, if at all, with an affinity that is less than 10 -6 M, less than 10 -5 M, or less than 10 -4 M.
- An epitope-specific T cell can bind an epitope for which it is specific with an affinity of at least 10 -7 M, at least 10 -8 M, at least 10 -9 M, or at least 10 -10 M.
- HPV E6 peptides suitable for inclusion in a TMMP of a chimeric molecule of the present disclosure include, but are not limited to, E618-26 (KLPQLCTEL; SEQ ID NO:124); E6 26-34 (LQTTIHDII; SEQ ID NO:125); E649-57 (VYDFAFRDL; SEQ ID NO:126); E652-60 (FAFRDLCIV; SEQ ID NO:127); E675-83 (KFYSKISEY; SEQ ID NO:128); and E680-88 (ISEYRHYCY; SEQ ID NO:129).
- HPV E7 peptides suitable for inclusion in a TMMP of a chimeric molecule of the present disclosure include, but are not limited to, E77-15 (TLHEYMLDL; SEQ ID NO:130); E7 [0087]
- a suitable HPV peptide is an HPV E6 peptide that binds HLA-A24 (e.g., is an HLA-A2401-restricted epitope).
- Non-limiting examples include: VYDFAFRDL (SEQ ID NO:126); [0088] In some cases, a suitable HPV peptide is selected from the group consisting of: [0089] In some cases, a suitable HPV peptide presents an HLA-A*2401-restricted epitope.
- HPV peptides presenting an HLA-A*2401-restricted epitope are: VYDFAFRDL (SEQ ID NO:126); RAHYNIVTF (SEQ ID NO:133); CDSTLRLCV (SEQ ID NO:134); and LCVQSTHVDI (SEQ ID NO:135).
- an HPV peptide suitable for inclusion in a TMMP of a chimeric molecule of the present disclosure is VYDFAFRDL (SEQ ID NO:126). In some cases, an HPV peptide suitable for inclusion in a TMMP of a chimeric molecule of the present disclosure is RAHYNIVTF (SEQ ID NO:132). In some cases, an HPV peptide suitable for inclusion in a TMMP of the present disclosure is CDSTLRLCV (SEQ ID NO:134). In some cases, an HPV peptide suitable for inclusion in a TMMP of a chimeric molecule of the present disclosure is LCVQSTHVDI (SEQ ID NO:135).
- Influenza virus peptides that are suitable for inclusion as a peptide epitope of a TMMP of a chimeric molecule of the present disclosure include peptides of from 4 amino acids to 25 amino acids in length of an influenza polypeptide, e.g., an influenza polypeptide that is included in a vaccine, or that is present in an influenza virus that infects a human.
- an influenza virus peptide that is suitable for inclusion as a peptide epitope of a TMMP of a chimeric molecule of the present disclosure can be a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus nucleoprotein.
- an influenza virus peptide that is suitable for inclusion as a peptide epitope of a TMMP of a chimeric molecule of the present disclosure can be a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus hemagglutinin polypeptide.
- an influenza virus peptide that is suitable for inclusion as a peptide epitope of a TMMP of a chimeric molecule of the present disclosure can be a peptide of from 4 amino acids to 25 amino acids in length of an influenza A virus Matrix protein 1.
- an influenza virus peptide that is suitable for inclusion as a peptide epitope of a TMMP of a chimeric molecule of the present disclosure can be a peptide of from 4 amino acids to 25 amino acids in length of an influenza virus neuraminidase polypeptide.
- the peptide is a peptide that presents an immunodominant influenza virus protein epitope.
- a suitable influenza peptide is a peptide having the sequence GILGFVFTL (SEQ ID NO:160) and having a length of 9 amino acids.
- Tetanus epitopes that are suitable for inclusion as a peptide epitope of a TMMP of a chimeric molecule of the present disclosure include peptides of from 4 amino acids to 25 amino acids in length of a tetanus toxin.
- suitable tetanus peptides include, but are not limited to, MHC polypeptides
- a TMMP of a chimeric molecule of the present disclosure includes MHC polypeptides.
- MHC polypeptides are meant to include MHC polypeptides of various species, including human MHC (also referred to as human leukocyte antigen (HLA)) polypeptides, rodent (e.g., mouse, rat, etc.) MHC polypeptides, and MHC polypeptides of other mammalian species (e.g., lagomorphs, non-human primates, canines, felines, ungulates (e.g., equines, bovines, ovines, caprines, etc.), and the like.
- human MHC also referred to as human leukocyte antigen (HLA)
- rodent e.g., mouse, rat, etc.
- MHC polypeptides of other mammalian species e.g., lagomorphs, non-human primates, canines, felines, ungulates (e.g., equines, bovines, ovines, caprines, etc.), and the like.
- MHC polypeptide is meant to include Class I MHC polypeptides (e.g., ⁇ -2 microglobulin and MHC class I heavy chain).
- the first MHC polypeptide is an MHC Class I ⁇ 2M ( ⁇ 2M) polypeptide
- the second MHC polypeptide is an MHC Class I heavy chain (H chain) (“MHC-H”)
- MHC-H MHC Class I heavy chain
- the first MHC polypeptide is an MHC Class I heavy chain polypeptide
- the second MHC polypeptide is a ⁇ 2M polypeptide.
- both the ⁇ 2M and MHC-H chain are of human origin; i.e., the MHC- H chain is an HLA heavy chain, or a variant thereof.
- a TMMP of the present disclosure does not include membrane anchoring domains (transmembrane regions) of an MHC Class I heavy chain, or a part of MHC Class I heavy chain sufficient to anchor the resulting TMMP to a cell (e.g., eukaryotic cell such as a mammalian cell) in which it is expressed.
- the MHC Class I heavy chain present in a TMMP of the present disclosure does not include a signal peptide, a transmembrane domain, or an intracellular domain (cytoplasmic tail) associated with a native MHC Class I heavy chain.
- the MHC Class I heavy chain present in a TMMP of the present disclosure includes only the ⁇ 1, ⁇ 2, and ⁇ 3 domains of an MHC Class I heavy chain.
- the MHC Class I heavy chain present in a TMMP of the present disclosure has a length of from about 270 amino acids (aa) to about 290 aa.
- the MHC Class I heavy chain present in a TMMP of the present disclosure has a length of 270 aa, 271 aa, 272 aa, 273 aa, 274 aa, 275 aa, 276 aa, 277 aa, 278 aa, 279 aa, 280 aa, 281 aa, 282 aa, 283 aa, 284 aa, 285 aa, 286 aa, 287 aa, 288 aa, 289 aa, or 290 aa.
- an MHC polypeptide of a TMMP is a human MHC polypeptide, where human MHC polypeptides are also referred to as “human leukocyte antigen” (“HLA”) polypeptides.
- HLA human leukocyte antigen
- an MHC polypeptide of a TMMP is a Class I HLA polypeptide, e.g., a ⁇ 2-microglobulin polypeptide, or a Class I HLA heavy chain polypeptide.
- Class I HLA heavy chain polypeptides include HLA-A heavy chain polypeptides, HLA-B heavy chain polypeptides, HLA-C heavy chain polypeptides, HLA-E heavy chain polypeptides, HLA-F heavy chain polypeptides, and HLA-G heavy chain polypeptides.
- an MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the amino acid sequence of any of the human HLA heavy chain polypeptides depicted in FIGs.5-11.
- the MHC Class I heavy chain has a length of 270 aa, 271 aa, 272 aa, 273 aa, 274 aa, 275 aa, 276 aa, 277 aa, 278 aa, 279 aa, 280 aa, 281 aa, 282 aa, 283 aa, 284 aa, 285 aa, 286 aa, 287 aa, 288 aa, 289 aa, or 290 aa.
- an MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises 1-30, 1-5, 5-10, 10-15, 15-20, 20-25 or 25-30 amino acid insertions, deletions, and/or substitutions (in addition to those locations indicated as being variable in the heavy chain consensus sequences) of any one of the amino acid sequences depicted in FIGs 5-11.
- the MHC Class I heavy chain does not include transmembrane or cytoplasmic domains.
- a MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 25-300 (lacking all, or substantially all, of the leader, transmembrane and cytoplasmic sequence) or amino acids 25-365 (lacking the leader) of a human HLA-A heavy chain polypeptides depicted in any one of FIG.5A, 5B, and 5C.
- FIGs.5A, 5B and 5C provide amino acid sequences of human leukocyte antigen (HLA) Class I heavy chain polypeptides.
- FIG.5A entry: 3A.1 is the HLA-A heavy chain (HLA-A*01:01:01:01 or A*0101) (NCBI accession NP_001229687.1), SEQ ID NO:392; entry 3A.2 is from HLA-A*1101 SEQ ID NO:393; entry 3A.3 is from HLA-A*2402 SEQ ID NO:394 and entry 3A.4 is from HLA-A*3303 SEQ ID NO:395.
- FIG.5B provides the sequence HLA-B*07:02:01 (HLA-B*0702) NCBI GenBank Accession NP_005505.2 (see also GenBank Accession AUV50118.1.).
- FIG.5C provides the sequence HLA- C*0701 (GenBank Accession NP_001229971.1) (HLA-C*07:01:01:01 or HLA-Cw*070101, HLA-Cw*07 see GenBank Accession CAO78194.1).
- FIG.6 provides an alignment of eleven mature MHC class I heavy chain amino acid sequences without their leader sequences or transmembrane domains or intracellular domains.
- the aligned sequences are human HLA-A, HLA-B, and HLA-C, a mouse H2K protein sequence, three variants of HLA-A (var.1, var.2C, and var.2CP), and 3 human HLA-A variants (HLA-A*1101; HLA-A*2402; and HLA-A*3303).
- Indicated in the alignment are the locations (84 and 139 of the mature proteins) where cysteine residues may be introduced (e.g., by substitution) for the formation of a disulfide bond to stabilize the MHC H chain – ⁇ 2M complex.
- position 236 (of the mature polypeptide), which may be substituted by a cysteine residue that can form an inter-chain disulfide bond with ⁇ 2M (e.g., at aa 12).
- ⁇ 2M e.g., at aa 12
- the seventh HLA-A sequence shown in the alignment shows the sequence of variant 2 substituted with C residues at positions 84, 139 and 236.
- the boxes flanking residues 84, 139 and 236 show the groups of five amino acids on either sides of those six sets of five residues, denoted aac1 (for “amino acid cluster 1”), aac2 (for “amino acid cluster 2”), aac3 (for “amino acid cluster 3”), aac4 (for “amino acid cluster 4”), aac5 (for “amino acid cluster 5”), and aac6 (for “amino acid cluster 6”), that may be replaced by 1 to 5 amino acids selected independently from (i) any naturally occurring amino acid or (ii) any naturally occurring amino acid except proline or glycine.
- aac1 for “amino acid cluster 1”
- aac2 for “amino acid cluster 2”
- aac3 for “amino acid cluster 3”
- aac4 for “amino acid cluster 4”
- aac5 for “amino acid cluster 5”
- aac1 (amino acid cluster 1) may be the amino acid sequence GTLRG (SEQ ID NO:174) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., L replaced by I, V, A or F);
- aac2 (amino acid cluster 2) may be the amino acid sequence YNQSE (SEQ ID NO:175) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aac3 (amino acid cluster 3) may be the amino acid sequence TAADM (SEQ ID NO:176) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., T replaced by S, A replaced by G, D replaced by E, and/or M replaced by L, V, or I);
- FIGs.7-9 provide alignments of mature HLA class I heavy chain amino acid sequences (without leader sequences or transmembrane domains or intracellular domains).
- the aligned amino acid sequences in FIG.7A are HLA-A class I heavy chains of the following alleles: A*0101, A*0201, A*0301, A*1101, A*2301, A*2402, A*2407, A*3303, and A*3401.
- the aligned amino acid sequences in FIG.8A are HLA-B class I heavy chains of the following alleles: B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and B*5301.
- the aligned amino acid sequences in FIG.9A are HLA-C class I heavy chains of the following alleles: C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*0801, and C*1502.
- locations (84 and 139 of the mature proteins) where cysteine residues may be introduced (e.g., by substitution) for the formation of a disulfide bond to stabilize the HLA H chain – ⁇ 2M complex.
- position 236 (of the mature polypeptide), which may be substituted by a cysteine residue that can form an inter-chain disulfide bond with ⁇ 2M (e.g., at aa 12).
- the boxes flanking residues 84, 139 and 236 show the groups of five amino acids on either sides of those six sets of five residues, denoted aac1 (for “amino acid cluster 1”), aac2 (for “amino acid cluster 2”), aac3 (for “amino acid cluster 3”), aac4 (for “amino acid cluster 4”), aac5 (for “amino acid cluster 5”), and aac6 (for “amino acid cluster 6”), that may be replaced by 1 to 5 amino acids selected independently from (i) any naturally occurring amino acid or (ii) any naturally occurring amino acid except proline or glycine.
- aac1 for “amino acid cluster 1”
- aac2 for “amino acid cluster 2”
- aac3 for “amino acid cluster 3”
- aac4 for “amino acid cluster 4”
- aac5 for “amino acid cluster 5”
- FIGs.7A, 8A, and 9A provide alignments of the amino acid sequences of mature HLA- A, -B, and -C class I heavy chains, respectively.
- the sequences are provided for the extracellular portion of the mature protein (without leader sequences or transmembrane domains or intracellular domains).
- the positions of aa residues 84, 139, and 236 and their flanking residues (aac1 to aac6) that may be replaced by 1 to 5 amino acids selected independently from (i) any naturally occurring amino acid or (ii) any naturally occurring amino acid except proline or glycine ae also shown.
- FIG.7B, 8B, and 9B provide consensus amino acid sequences for the HLA-A, -B, and -C sequences, respectively, provide in FIG.7A, 8A, and 9A.
- the consensus sequences show the variable amino acid positions as “X” residues sequentially numbered and the locations of amino acids 84, 139 and 236 double underlined.
- aac1 (amino acid cluster 1) may be the amino acid sequence GTLRG (SEQ ID NO:174) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., L replaced by I, V, A or F);
- aac2 (amino acid cluster 2) may be the amino acid sequence YNQSE (SEQ ID NO:175) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aac3 (amino acid cluster 3) may be the amino acid sequence TAADM (SEQ ID NO:176) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., T replaced by S, A replaced by G, D replaced by E, and/or M replaced by L, V, or I);
- aac1 (amino acid cluster 1) may be the amino acid sequence RNLRG (SEQ ID NO:180) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by T or I; and/or L replaced by A; and/or the second R replaced by L; and/or the G replaced by R);
- aac2 (amino acid cluster 2) may be the amino acid sequence YNQSE (SEQ ID NO:175) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aac3 (amino acid cluster 3) may be the amino acid sequence TAADT (SEQ ID NO:181) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., the first T replaced by S; and/or
- aac1 (amino acid cluster 1) may be the amino acid sequence RNLRG (SEQ ID NO:180) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by K; and/or L replaced by A or I; and/or the second R replaced by H; and/or the G replaced by T or S);
- aac2 (amino acid cluster 2) may be the amino acid sequence YNQSE (SEQ ID NO:175) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., N replaced by Q, Q replaced by N, and/or E replaced by D);
- aac3 (amino acid cluster 3) may be the amino acid sequence TAADT (SEQ ID NO:181) or that sequence with one or two amino acids deleted or substituted with other naturally occurring amino acids (e.g., the first T replaced by S; and
- a TMMP of the present disclosure comprises an HLA-A heavy chain polypeptide.
- the HLA-A heavy chain peptide sequences, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, the alleles: A*0101, A*0201, A*0301, A*1101, A*2301, A*2402, A*2407, A*3303, and A*3401, which are aligned without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences in FIG.7A. Any of those alleles may comprise a mutation at one or more of positions 84, 139 and/or 236 (as shown in FIG.
- a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- HLA-A sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the sequence of those HLA-A alleles may also be employed (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- a TMMP of the present disclosure comprises an HLA-A heavy chain polypeptide comprising the following HLA-A consensus amino acid sequence:
- an MHC Class I heavy chain polypeptide of a TMMP can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A heavy chain amino acid sequence:
- an HLA-A heavy chain polypeptide suitable for inclusion in a TMMP of the present disclosure comprises the following amino acid sequence: is also referred to as “HLA-A*0201” or simply “HLA-A02.”
- the C-terminal Pro is not included in a TMMP of the present disclosure.
- an HLA-A02 polypeptide suitable for inclusion in a TMMP of the present disclosure comprises the following amino acid sequence: 2) HLA-A (Y84A; A236C) [00109]
- the MHC Class I heavy chain polypeptide comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A heavy chain (Y84A; A236C) amino acid sequence: acid 236 is Cys.
- an HLA-A heavy chain polypeptide suitable for inclusion in a TMMP of the present disclosure is an HLA-A02 (Y84A; A236C) polypeptide comprising the following amino acid sequence: [00111] In some cases, an HLA-A heavy chain polypeptide suitable for inclusion in a TMMP of the present disclosure is an HLA-A02 (Y84A; A236C) polypeptide comprising the following amino acid sequence: 3) HLA-A (Y84C; A139C) [00112] In some cases, the MHC Class I heavy chain polypeptide comprises Y84C and A139C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A heavy chain (Y84C; A139C) amino acid sequence: acid 139 is Cys.
- Cys-84 forms an intrachain disulfide bond with Cys-139.
- an MHC Class I heavy chain polypeptide of a TMMP can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA- A11 heavy chain amino acid sequence:
- Such an MHC Class I heavy chain may be prominent in Asian populations, including populations of individuals of Asian descent.
- the MHC Class I heavy chain polypeptide is an HLA-A11 allele that comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A A11 heavy chain (Y84A; A236C) amino acid sequence: where amino acid 84 is Ala and amino acid 236 is Cys.
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A24 heavy chain amino acid sequence: ( ) Such an MHC Class I heavy chain may be prominent in Asian populations, including populations of individuals of Asian descent. In some cases, amino acid 84 is an Ala.
- amino acid 84 is a Cys. In some cases, amino acid 236 is a Cys. In some cases, amino acid 84 is an Ala and amino acid 236 is a Cys. In some cases, amino acid 84 is an Cys and amino acid 236 is a Cys.
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-A33 heavy chain amino acid sequence: ( ) Such an MHC Class I heavy chain may be prominent in Asian populations, including populations of individuals of Asian descent.
- amino acid 84 is an Ala.
- amino acid 84 is a Cys.
- amino acid 236 is a Cys.
- amino acid 84 is an Ala and amino acid 236 is a Cys. In some cases, amino acid 84 is an Cys and amino acid 236 is a Cys. 8) HLA-B [00117] In some cases, a TMMP of the present disclosure comprises an HLA-B heavy chain polypeptide.
- HLA-B heavy chain peptide sequences, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, the alleles: B*0702, B*0801, B*1502, B*3802, B*4001, B*4601, and B*5301, which are aligned without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences in FIG.8A.
- any of those alleles may comprise a mutation at one or more of positions 84, 139 and/or 236 (as shown in FIG.8A) selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- a HLA-B polypeptide comprising an amino acid sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the sequence of those HLA-B alleles may also be employed (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- a TMMP of the present disclosure comprises an HLA-B heavy chain polypeptide comprising the following HLA-B consensus amino acid sequence: S; X24 is R or S; X25 is S or T; X26 is L or W; X27 is E OR V; X28 is R, D, L or W; X29 is A or T; X30 is L, E or T; X31 is E or D; X32 is K or T; X33 is E or Q; and X34 is I or V.
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-B heavy chain amino acid sequence: [00121]
- the MHC Class I heavy chain polypeptide is an HLA-B polypeptide that comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-B heavy chain (Y84A; A236C) amino acid sequence: 236 is Cys.
- the Cys-236 forms an interchain disulfide bond with Cys-12 of a variant ⁇ 2M polypeptide that comprises an R12C substitution.
- HLA-B Y84C; A139C
- the MHC Class I heavy chain polypeptide comprises Y84C and A139C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-B heavy chain (Y84C; A139C) amino acid sequence: GEEQRYTCHVQHEGLPKPLTLRWEP (SEQ ID NO:197), where amino acid 84 is Cys and amino acid 139 is Cys.
- Cys-84 forms an intrachain disulfide bond with Cys-139.
- a MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises an amino acid sequence of HLA-B*0702 (SEQ ID NO:195) in FIG.8A, or a sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100%, amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the HLA-B heavy chain polypeptide of TMMP of the present disclosure may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine substitution at position 84 (Y84A); a tyrosine to cysteine substitution at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-B heavy chain polypeptide of TMMP of the present disclosure comprises Y84A and A236C substitutions. In some cases, the HLA-B*0702 heavy chain polypeptide of TMMP of the present disclosure comprises Y84C and A139C substitutions. In some cases, the HLA-B heavy chain polypeptide of TMMP of the present disclosure comprises Y84C, A139C, and A236C substitutions. 12) HLA-C [00124] In some cases, a TMMP of the present disclosure comprises an HLA-C heavy chain polypeptide.
- HLA-C heavy chain polypeptide, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, the alleles: C*0102, C*0303, C*0304, C*0401, C*0602, C*0701, C*0801, and C*1502, which are aligned without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences in FIG.9A.
- any of those alleles may comprise a mutation at one or more of positions 84, 139 and/or 236 (as shown in FIG.9A) selected from: a tyrosine to alanine substitution at position 84 (Y84A); a tyrosine to cysteine substitution at position 84 (Y84C); an alanine to cysteine substitution at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- an HLA-C polypeptide comprising an amino acid sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of the sequence of those HLA-C alleles may also be employed (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- a TMMP of the present disclosure comprises an HLA-C heavy chain polypeptide comprising the following HLA-C consensus amino acid sequence: [00127]
- an MHC Class I heavy chain polypeptide of a TMMP of the present disclosure can comprise an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-C heavy chain amino acid sequence: [00128]
- the MHC Class I heavy chain polypeptide is an HLA-C polypeptide that comprises Y84A and A236C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-C heavy chain (Y84A; A236C) amino acid sequence: acid 236 is Cys.
- the Cys-236 forms an interchain disulfide bond with Cys-12 of a variant ⁇ 2M polypeptide that comprises an R12C substitution.
- HLA-C (Y84C; A139C)
- the MHC Class I heavy chain polypeptide comprises Y84C and A139C substitutions.
- the MHC Class I heavy chain polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following human HLA-C heavy chain (Y84C; A139C) amino acid sequence: [00130]
- a MHC Class I heavy chain polypeptide of a TMMP of the present disclosure comprises an amino acid sequence of HLA-C*0701 of FIG.9A (labeled HLA-C in FIG.6), or an amino acid sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20-25, or
- the HLA-C heavy chain polypeptide of a TMMP of the present disclosure may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine substitution at position 84 (Y84A); a tyrosine to cysteine substitution at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the HLA-C heavy chain polypeptide of a TMMP of the present disclosure comprises Y84A and A236C substitutions. In some cases, the HLA-C*0701 heavy chain polypeptide of a TMMP or its epitope conjugate comprises Y84C and A139C substitutions. In some cases, the HLA-C heavy chain polypeptide of a TMMP of the present disclosure comprises Y84C, A139C, and A236C substitutions.
- Non-classical HLA-E, -F, and -G MHC Class I heavy chains [00131] In some cases, a TMMP of the present disclosure comprises a non-classical MHC Class I heavy chain polypeptide.
- non-classical HLA heavy chain polypeptides, or portions thereof, that may be that may be incorporated into a TMMP of the present disclosure include, but are not limited to, those of HLA-E, -F, and -G alleles.
- Amino acid sequences for HLA-E, -F, and -G heavy chain polypeptides, (and the HLA-A, B and C alleles) may be found on the world wide web hla.alleles.org/ nomenclature/index.html, the European Bioinformatics Institute (www(dot)ebi(dot)ac(dot)uk), which is part of the European Molecular Biology Laboratory(EMBL), and at the National Center for Biotechnology Information (www(dot)ncbi(dot)nlm(dot)nih(dot)gov).
- Non-limiting examples of suitable HLA-E alleles include, but are not limited to, HLA- E*0101 (HLA-E*01:01:01:01), HLA-E*01:03(HLA-E*01:03:01:01), HLA-E*01:04, HLA-E*01:05, HLA-E*01:06, HLA-E*01:07, HLA-E*01:09, and HLA-E*01:10.
- suitable HLA-F alleles include, but are not limited to, HLA-F*0101 (HLA-F*01:01:01:01), HLA-F*01:02, HLA- F*01:03(HLA-F*01:03:01:01), HLA-F*01:04, HLA-F*01:05, and HLA-F*01:06.
- HLA-G alleles include, but are not limited to, HLA-G*0101 (HLA-G*01:01:01:01), HLA-G*01:02, HLA-G*01:03(HLA-G*01:03:01:01), HLA-G*01:04 (HLA-G*01:04:01:01), HLA- G*01:06, HLA-G*01:07, HLA-G*01:08, HLA-G*01:09: HLA-G*01:10, HLA-G*01:10, HLA-G*01:11, HLA-G*01:12, HLA-G*01:14, HLA-G*01:15, HLA-G*01:16, HLA-G*01:17, HLA-G*01:18: HLA- G*01:19, HLA-G*01:20, and HLA-G*01:22.
- FIG.10 Consensus sequences for those HLA E, -F and -G alleles without all, or substantially all, of the leader, transmembrane and cytoplasmic sequences are provided in FIG.10, and aligned with consensus sequences of the above-mentioned HLA-A, -B and -C alleles in FIG.11.
- FIG.11 provides a consensus sequence for each of HLA-E, -F, and -G with the variable aa positions indicated as “X” residues sequentially numbered and the locations of aas 84, 139 and 236 double underlined.
- FIG.11 provides an alignment of the consensus amino acid sequences for HLA-A, -B, - C, -E, -F, and -G, which are given in FIGs.7-11. Variable residues in each sequence are listed as “X” with the sequential numbering removed. As indicated in FIG.6, the locations of aas 84, 139 and 236 are indicated with their flanking five-amino acid clusters that may be replaced by 1 to 5 amino acids selected independently from (i) any naturally occurring amino acid or (ii) any naturally occurring amino acid except proline or glycine are also shown.
- any of the above-mentioned HLA-E, -F, and/or -G alleles may comprise a substitution at one or more of positions 84, 139 and/or 236 as shown in FIG.11 for the consensus sequences.
- the substitutions may be selected from a: position 84 tyrosine to alanine (Y84A) or cysteine (Y84C), or, in the case of HLA-F, an R84A or R84C substitution; a position 139 alanine to cysteine (A139C), or, in the case of HLA-F, a V139C; and an alanine to cysteine substitution at position 236 (A236C).
- an HLA-E, -F and /or -G sequence having at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%) or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of any of the consensus sequences of set forth in FIG.11 may also be employed (e.g., the sequences may comprise 1-25, 1-5, 5-10, 10-15, 15- 20, 20-25, or 25-30 amino acid insertions, deletions, and/or substitutions in addition to changes at variable residues listed therein).
- a MHC Class I heavy chain polypeptide present in a TMMP of the present disclosure comprises an amino acid sequence of MOUSE H2K (SEQ ID NO:401) (MOUSE H2K in FIG.6), or a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% amino acid sequence identity to all or part (e.g., 50, 75, 100, 150, 200, or 250 contiguous amino acids) of that sequence (e.g., it may comprise 1-25, 1-5, 5-10, 10-15, 15-20, 20- 25, or 25-30 amino acid insertions, deletions, and/or substitutions).
- the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure may comprise a mutation at one or more of positions 84, 139 and/or 236 selected from: a tyrosine to alanine at position 84 (Y84A); a tyrosine to cysteine at position 84 (Y84C); an alanine to cysteine at position 139 (A139C); and an alanine to cysteine substitution at position 236 (A236C).
- the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure comprises Y84A and A236C substitutions.
- the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure comprises Y84C and A139C substitutions. In some cases, the MOUSE H2K heavy chain polypeptide of a TMMP of the present disclosure comprises Y84C, A139C and A236C substitutions. Exemplary combinations [00137] Table 2, below, presents various combinations of MHC Class I heavy chain sequence modifications that can be incorporated in a TMMP of the present disclosure. TABLE 2
- a ⁇ 2-microglobulin ( ⁇ 2M) polypeptide of a TMMP of the present disclosure can be a human ⁇ 2M polypeptide, a non-human primate ⁇ 2M polypeptide, a murine ⁇ 2M polypeptide, and the like.
- a ⁇ 2M polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to a ⁇ 2M amino acid sequence depicted in FIG.4. In some instances, a ⁇ 2M polypeptide comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to amino acids 21 to 119 of a ⁇ 2M amino acid sequence depicted in FIG.4.
- a suitable ⁇ 2M polypeptide comprises the following amino acid sequence: and the HLA Class I heavy chain polypeptide comprises the following amino acid sequence: indicated as ⁇ C ⁇ form an disulfide bond between the ⁇ 1 and ⁇ 2-1 helices and tII residue forms a disulfide bond with the ⁇ 2M polypeptide cysteine at position 12.
- aa1 is “amino acid cluster 1”
- aa2 is “amino acid cluster 2”
- aa3 is “amino acid cluster 3”
- aa4 is “amino acid cluster 4”
- aa5 is “amino acid cluster 5”
- aa6 is “amino acid cluster 6”; see, e.g., FIG.6.
- an MHC polypeptide comprises a single amino acid substitution relative to a reference MHC polypeptide (where a reference MHC polypeptide can be a wild-type MHC polypeptide), where the single amino acid substitution substitutes an amino acid with a cysteine (Cys) residue.
- cysteine residues when present in an MHC polypeptide of a first polypeptide of a TMMP of the present disclosure, can form a disulfide bond with a cysteine residue present in a second polypeptide chain of a TMMP of the present disclosure.
- a first MHC polypeptide in a first polypeptide of a TMMP of the present disclosure, and/or the second MHC polypeptide in the second polypeptide of a TMMP of the present disclosure includes an amino acid substitution to substitute an amino acid with a cysteine, where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with a cysteine in the second MHC polypeptide, where a cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide, or where the substituted cysteine in the first MHC polypeptide forms a disulfide bond with the substituted cysteine in the second MHC polypeptide.
- one of following pairs of residues in an HLA ⁇ 2- microglobulin and an HLA Class I heavy chain is substituted with cysteines (where residue numbers are those of the mature polypeptide): 1) ⁇ 2M residue 12, HLA Class I heavy chain residue 236; 2) ⁇ 2M residue 12, HLA Class I heavy chain residue 237; 3) ⁇ 2M residue 8, HLA Class I heavy chain residue 234; 4) ⁇ 2M residue 10, HLA Class I heavy chain residue 235; 5) ⁇ 2M residue 24, HLA Class I heavy chain residue 236; 6) ⁇ 2M residue 28, HLA Class I heavy chain residue 232; 7) ⁇ 2M residue 98, HLA Class I heavy chain residue 192; 8) ⁇ 2M residue 99, HLA Class I heavy chain residue 234; 9) ⁇ 2M residue 3, HLA Class I heavy chain residue 120; 10) ⁇ 2M residue 31, HLA Class I heavy chain residue 96; 11) ⁇ 2M residue 53, HLA Class I heavy chain residue 35
- the amino acid numbering of the MHC/HLA Class I heavy chain is in reference to the mature MHC/HLA Class I heavy chain, without a signal peptide.
- residue 236 of the mature HLA-A amino acid sequence is substituted with a Cys.
- residue 236 of the mature HLA-B amino acid sequence is substituted with a Cys.
- residue 236 of the mature HLA-C amino acid sequence is substituted with a Cys.
- residue 32 (corresponding to Arg-12 of mature ⁇ 2M) of an amino acid sequence depicted in FIG.4 is substituted with a Cys.
- a ⁇ 2M polypeptide comprises the amino acid sequence: IQRTPKIQVY . In some cases, a ⁇ 2M polypeptide comprises the amino acid sequence: IQRTPKIQVY SCHPAENGKS NFLNCYVSGF [00146] In some cases, an HLA Class I heavy chain polypeptide comprises the amino acid sequence: [00147] In some cases, an HLA Class I heavy chain polypeptide comprises the amino acid sequence: [00148] In some cases, an HLA Class I heavy chain polypeptide comprises the amino acid sequence: [00149] In some cases, the ⁇ 2M polypeptide comprises the following amino acid sequence: [00150] IQRTPKIQVY SCHPAENGKS NFLNCYVSGF HPSDIEVDLLKNGERIEKVE HSDLSFSKDW SFYLLYYTEF TPTEKDEYAC RVNHVTLSQP KIVKWDRDM (SEQ ID NO:202); and the HLA Class I heavy chain polypeptide of a TMMP of the present
- the ⁇ 2M polypeptide comprises the amino acid sequence: IQRTPKIQVYSCHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLL YYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM (SEQ ID NO:202).
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are disulfide linked to one another through: i) a Cys residue present in a linker connecting the peptide epitope and a ⁇ 2M polypeptide in the first polypeptide chain; and ii) a Cys residue present in an MHC Class I heavy chain in the second polypeptide chain.
- the Cys residue present in the MHC Class I heavy chain is a Cys introduce as a Y84C substitution.
- the linker connecting the peptide epitope and the ⁇ 2M polypeptide in the first polypeptide chain is GCGGS(G4S)n (SEQ ID NO:206), where n is 1, 2, 3, 4, 5, 6, 7, 8, or 9.
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGSGGGGS (SEQ ID NO:207).
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:208). Examples of disulfide-linked first and second polypeptides of a TMMP of the present disclosure are depicted schematically in FIG.1A-1B.
- an immunomodulatory polypeptide present in a TMMP of a chimeric molecule of the present disclosure is a wild-type immunomodulatory polypeptide.
- an immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant immunomodulatory polypeptide that has reduced affinity for a co-immunomodulatory polypeptide, compared to the affinity of a corresponding wild-type immunomodulatory polypeptide for the co- immunomodulatory polypeptide.
- Suitable immunomodulatory domains that exhibit reduced affinity for a co-immunomodulatory domain can have from 1 amino acid (aa) to 20 aa differences from a wild-type immunomodulatory domain.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure differs in amino acid sequence by 1 aa, 2 aa, 3 aa, 4 aa, 5 aa, 6 aa, 7 aa, 8 aa, 9 aa, or 10 aa, from a corresponding wild-type immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure differs in amino acid sequence by 11 aa, 12 aa, 13 aa, 14 aa, 15 aa, 16 aa, 17 aa, 18 aa, 19 aa, or 20 aa, from a corresponding wild-type immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions, compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes a single amino acid substitution compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 2 amino acid substitutions (e.g., no more than 2 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 3 amino acid substitutions (e.g., no more than 3 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 4 amino acid substitutions (e.g., no more than 4 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide. In some cases, variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 5 amino acid substitutions (e.g., no more than 5 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 6 amino acid substitutions (e.g., no more than 6 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide. In some cases, variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 7 amino acid substitutions (e.g., no more than 7 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 8 amino acid substitutions (e.g., no more than 8 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 9 amino acid substitutions (e.g., no more than 9 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 10 amino acid substitutions (e.g., no more than 10 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 11 amino acid substitutions (e.g., no more than 11 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 12 amino acid substitutions (e.g., no more than 12 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 13 amino acid substitutions (e.g., no more than 13 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 14 amino acid substitutions (e.g., no more than 14 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 15 amino acid substitutions (e.g., no more than 15 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 16 amino acid substitutions (e.g., no more than 16 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 17 amino acid substitutions (e.g., no more than 17 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 18 amino acid substitutions (e.g., no more than 18 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 19 amino acid substitutions (e.g., no more than 19 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- variant immunomodulatory polypeptide present in a TMMP of the present disclosure includes 20 amino acid substitutions (e.g., no more than 20 amino acid substitutions) compared to a corresponding reference (e.g., wild-type) immunomodulatory polypeptide.
- a variant immunomodulatory polypeptide suitable for inclusion in a TMMP of the present disclosure exhibits reduced affinity for a cognate co-immunomodulatory polypeptide, compared to the affinity of a corresponding wild-type immunomodulatory polypeptide for the cognate co-immunomodulatory polypeptide.
- Exemplary pairs of immunomodulatory polypeptide and cognate co-immunomodulatory polypeptide include, but are not limited to: [00167] a) 4-1BBL (immunomodulatory polypeptide) and 4-1BB (cognate co- immunomodulatory polypeptide); [00168] b) PD-L1 (immunomodulatory polypeptide) and PD1 (cognate co-immunomodulatory polypeptide); [00169] c) IL-2 (immunomodulatory polypeptide) and IL-2 receptor (cognate co- immunomodulatory polypeptide); [00170] d) CD80 (immunomodulatory polypeptide) and CD86 (cognate co-immunomodulatory polypeptide); [00171] e) CD86 (immunomodulatory polypeptide) and CD28 (cognate co-immunomodulatory polypeptide); [00172] f) OX40L (CD252)
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from 100 nM to 100 ⁇ M.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM,
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure exhibits reduced affinity for a cognate co-immunomodulatory polypeptide.
- a TMMP of the present disclosure that comprises a variant immunomodulatory polypeptide exhibits reduced affinity for a cognate co-immunomodulatory polypeptide.
- a TMMP of the present disclosure that comprises a variant immunomodulatory polypeptide has a binding affinity for a cognate co- immunomodulatory polypeptide that is from 100 nM to 100 ⁇ M.
- a TMMP of the present disclosure that comprises a variant immunomodulatory polypeptide has a binding affinity for a cognate co-immunomodulatory polypeptide that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M, to about 1 ⁇ M to about 5 ⁇ M, from about 5 ⁇ M to about 10 ⁇ M, from about 10 ⁇ M to about 15 ⁇ M, from about 15 ⁇ M to about 20
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant CD80 polypeptide. Wild-type CD80 binds to CD28. Wild-type CD80 also binds to CD86. [00188]
- a wild-type amino acid sequence of the ectodomain of human CD80 can be as follows: disclosure comprises a variant CD80 polypeptide, a “cognate co-immunomodulatory polypeptide” is a CD28 polypeptide comprising the amino acid sequence of SEQ ID NO:436.
- a wild-type CD28 amino acid sequence can be as follows: MLRLLLALNL [00192]
- a wild-type CD28 amino acid sequence can be as follows: MLRLLLALNL [00193]
- a variant CD80 polypeptide exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD80 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:4 for CD28.
- a variant CD80 polypeptide binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD80 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:4 for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NO:436, 437, or 438).
- a variant CD80 polypeptide has a binding affinity to CD28 that is from 100 nM to 100 ⁇ M.
- a variant CD80 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900
- a variant CD80 polypeptide has a single amino acid substitution compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has from 2 to 10 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 2 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 3 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435.
- a variant CD80 polypeptide has 4 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 5 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 6 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 7 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 8 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435.
- a variant CD80 polypeptide has 9 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435. In some cases, a variant CD80 polypeptide has 10 amino acid substitutions compared to the CD80 amino acid sequence set forth in SEQ ID NO:435.
- Suitable CD80 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences: any amino acid other than Asn.
- X is Ala; any amino acid other than Asn.
- X is Ala; any amino acid other than Ile.
- X is Ala; CD86 variants
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant CD86 polypeptide. Wild-type CD86 binds to CD28.
- a “cognate co- immunomodulatory polypeptide” is a CD28 polypeptide comprising the amino acid sequence of SEQ ID NO:5.
- the amino acid sequence of the full ectodomain of a wild-type human CD86 can be as [00217]
- a variant CD86 polypeptide exhibits reduced binding affinity to CD28, compared to the binding affinity of a CD86 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:226 or SEQ ID NO:227 for CD28.
- a variant CD86 polypeptide binds CD28 with a binding affinity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a CD86 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:226 or SEQ ID NO:227 for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NO:436, 437, or 438).
- a variant CD86 polypeptide has a binding affinity to CD28 that is from 100 nM to 100 ⁇ M.
- a variant CD86 polypeptide of the present disclosure has a binding affinity for CD28 (e.g., a CD28 polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:5, 6, or 7) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about
- a variant CD86 polypeptide has a single amino acid substitution compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has from 2 to 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 2 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 3 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226.
- a variant CD86 polypeptide has 4 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 5 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 6 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 7 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 8 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226.
- a variant CD86 polypeptide has 9 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. In some cases, a variant CD86 polypeptide has 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:226. [00220] In some cases, a variant CD86 polypeptide has a single amino acid substitution compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has from 2 to 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227.
- a variant CD86 polypeptide has 2 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 3 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 4 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 5 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 6 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227.
- a variant CD86 polypeptide has 7 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 8 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 9 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227. In some cases, a variant CD86 polypeptide has 10 amino acid substitutions compared to the CD86 amino acid sequence set forth in SEQ ID NO:227.
- Suitable CD86 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences: X2 is any amino acid other than Asp, and X3 is any amino acid other than His .
- X1 is Ala
- X2 is Ala
- X3 is Ala
- X1 is any amino acid other than Asn
- X2 is any amino acid other than Asp
- X3 is any amino acid other than His .
- X1 is Ala
- X2 is Ala
- X3 is Ala.
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant 4-1BBL polypeptide.
- Wild-type 4-1BBL binds to 4-1BB (CD137).
- a wild-type 4-1BBL amino acid sequence can be as follows: MEYASDASLD
- a variant 4-1BBL polypeptide is a variant of the tumor necrosis factor (TNF) homology domain (THD) of human 4-1BBL.
- TNF tumor necrosis factor
- a wild-type amino acid sequence of the THD of human 4-1BBL can be, e.g., one of GGCEL (SEQ ID NO:434).
- a “cognate co-immunomodulatory polypeptide” is a 4-1BB polypeptide comprising the amino acid sequence of SEQ ID NO:434.
- a variant 4-1BBL polypeptide exhibits reduced binding affinity to 4-1BB, compared to the binding affinity of a 4-1BBL polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:252-255.
- a variant 4-1BBL polypeptide of the present disclosure binds 4-1BB with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of a 4-1BBL polypeptide comprising the amino acid sequence set forth in one of SEQ ID NOs:252-255 for a 4-1BB polypeptide (e.g., a 4-1BB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:434), when assayed under the same conditions.
- a 4-1BB polypeptide e.g., a 4-1BB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:43
- a variant 4-1BBL polypeptide has a binding affinity to 4-1BB that is from 100 nM to 100 ⁇ M.
- a variant 4-1BBL polypeptide has a binding affinity for 4-1BB (e.g., a 4-1BB polypeptide comprising the amino acid sequence set forth in SEQ ID NO:14) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to about 1 ⁇ M
- a variant 4-1BBL polypeptide has a single amino acid substitution compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has from 2 to 10 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 2 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:10-13. In some cases, a variant 4-1BBL polypeptide has 3 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255.
- a variant 4-1BBL polypeptide has 4 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 5 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 6 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 7 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255.
- a variant 4-1BBL polypeptide has 8 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4- 1BBL polypeptide has 9 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255. In some cases, a variant 4-1BBL polypeptide has 10 amino acid substitutions compared to the 4-1BBL amino acid sequence set forth in one of SEQ ID NOs:252-255.
- Suitable 4-1BBL variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences:
- a variant immunomodulatory polypeptide present in a TMMP of the present disclosure is a variant IL-2 polypeptide.
- Wild-type IL-2 binds to IL-2 receptor (IL-2R), i.e., a heterotrimeric polypeptide comprising IL-2R ⁇ , IL-2R ⁇ , and IL-2R ⁇ .
- IL-2R IL-2 receptor
- Wild-type IL2 binds to an IL2 receptor (IL2R) on the surface of a cell.
- An IL2 receptor is in some cases a heterotrimeric polypeptide comprising an alpha chain (IL-2R ⁇ ; also referred to as CD25), a beta chain (IL-2R ⁇ ; also referred to as CD122: and a gamma chain (IL-2R ⁇ ; also referred to as CD132).
- IL-2R ⁇ alpha chain
- IL-2R ⁇ beta chain
- IL-2R ⁇ gamma chain
- Amino acid sequences of human IL-2R ⁇ , IL2R ⁇ , and IL-2R ⁇ can be as follows.
- a “cognate co-immunomodulatory polypeptide” is an IL-2R comprising polypeptides comprising the amino acid sequences of SEQ ID NO:16, 17, and 18.
- a variant IL-2 polypeptide exhibits reduced binding affinity to IL-2R, compared to the binding affinity of a IL-2 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:15.
- a variant IL-2 polypeptide binds IL-2R with a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less, at least 50% less, at least 55% less, at least 60% less, at least 65% less, at least 70% less, at least 75% less, at least 80% less, at least 85% less, at least 90% less, at least 95% less, or more than 95% less, than the binding affinity of an IL-2 polypeptide comprising the amino acid sequence set forth in SEQ ID NO:340 for an IL-2R (e.g., an IL-2R comprising polypeptides comprising the amino acid sequence set forth in SEQ ID NOs:341-343), when assayed under the same conditions.
- a binding affinity that is at least 10% less, at least 15% less, at least 20% less, at least 25%, at least 30% less, at least 35% less, at least 40% less, at least 45% less
- a variant IL-2 polypeptide has a binding affinity to IL-2R that is from 100 nM to 100 ⁇ M.
- a variant IL-2 polypeptide has a binding affinity for IL-2R (e.g., an IL-2R comprising polypeptides comprising the amino acid sequence set forth in SEQ ID NOs:16-18) that is from about 100 nM to 150 nM, from about 150 nM to about 200 nM, from about 200 nM to about 250 nM, from about 250 nM to about 300 nM, from about 300 nM to about 350 nM, from about 350 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, from about 900 nM to
- a variant IL-2 polypeptide has a single amino acid substitution compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has from 2 to 10 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 2 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 3 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340.
- a variant IL-2 polypeptide has 4 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 5 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 6 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 7 amino acid substitutions compared to the IL- 2 amino acid sequence set forth in SEQ ID NO:340.
- a variant IL-2 polypeptide has 8 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 9 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. In some cases, a variant IL-2 polypeptide has 10 amino acid substitutions compared to the IL-2 amino acid sequence set forth in SEQ ID NO:340. [00352] Suitable IL-2 variants include a polypeptide that comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to any one of the following amino acid sequences: some cases, X is Ala.
- X is Thr. In some cases, X is Asn. In some cases, X is Cys. In some cases, X is Gln. In some cases, X is Met. In some cases, X is Val. In some cases, X is Trp; some cases, X is Ala. In some cases, X is Arg. In some cases, X is Asn. In some cases, X is Asp. In some cases, X is Cys. In some cases, X is Glu. In some cases, X is Gln. In some cases, X is Gly. In some cases, X is Ile. I n some cases, X is Lys. In some cases, X is Leu. In some cases, X is Met.
- X is Phe. In some cases, X is Pro. In some cases, X is Ser. In some cases, X is Thr. In some cases, X is Tyr. In some cases, X is Trp. In some cases, X is Val; where X2 is any amino acid other than Asp; and where X3 is any amino acid other than Phe. In some cases, X1 is Ala. In some cases, X2 is Ala. In some cases, X3 is Ala. In some cases, X1 is Ala; X2 is Ala; and X3 is Ala; where X 2 is any amino acid other than Asp; and where X 3 is any amino acid other than Phe. In some cases, X 1 is Ala.
- X 2 is Ala. In some cases, X 3 is Ala. In some cases, X 1 is Ala; X 2 is Ala; and X 3 is Ala; where X 2 is any amino acid other than Phe; and where X 3 is any amino acid other than Gln. In some cases, X1 is Ala. In some cases, X2 is Ala. In some cases, X3 is Ala.
- X1 is Ala.
- X2 is Ala.
- X3 is Ala.
- X1 is Ala.
- X2 is Ala.
- X3 is Ala.
- X4 is Ala.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- X 1 is Ala; X 2 is Ala; X 3 is Ala; and X 4 is Ala; where X 2 is any amino acid other than Asp; where X 3 is any amino acid other than Phe; where X 4 is any amino acid other than Tyr; and where X 5 is any amino acid other than Gln.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- X 4 is Ala.
- X 5 is Ala.
- X 1 is Ala.
- X 2 is Ala.
- X 3 is Ala.
- Scaffold polypeptides [00370]
- a TMMP of the present disclosure can comprise an Fc polypeptide, or can comprise another suitable scaffold polypeptide.
- Suitable scaffold polypeptides include antibody-based scaffold polypeptides and non- antibody-based scaffolds.
- Non-antibody-based scaffolds include, e.g., albumin, an XTEN (extended recombinant) polypeptide, transferrin, an Fc receptor polypeptide, an elastin-like polypeptide (see, e.g., Hassouneh et al.
- Methods Enzymol.502:215 e.g., a polypeptide comprising a pentapeptide repeat unit of (Val-Pro-Gly-X-Gly; SEQ ID NO:361), where X is any amino acid other than proline), an albumin-binding polypeptide, a silk-like polypeptide (see, e.g., Valluzzi et al. (2002) Philos Trans R Soc Lond B Biol Sci.357:165), a silk-elastin-like polypeptide (SELP; see, e.g., Megeed et al. (2002) Adv Drug Deliv Rev.54:1075), and the like.
- a polypeptide comprising a pentapeptide repeat unit of (Val-Pro-Gly-X-Gly; SEQ ID NO:361), where X is any amino acid other than proline
- an albumin-binding polypeptide e.g., a silk-like polypeptide (see, e
- Suitable XTEN polypeptides include, e.g., those disclosed in WO 2009/023270, WO 2010/091122, WO 2007/103515, US 2010/0189682, and US 2009/0092582; see also Schellenberger et al. (2009) Nat Biotechnol.27:1186).
- Suitable albumin polypeptides include, e.g., human serum albumin.
- Suitable scaffold polypeptides will in some cases be a half-life extending polypeptides. Thus, in some cases, a suitable scaffold polypeptide increases the in vivo half-life (e.g., the serum half- life) of the TMMP, compared to a control TMMP lacking the scaffold polypeptide.
- a scaffold polypeptide increases the in vivo half-life (e.g., the serum half-life) of the TMMP, compared to a control TMMP lacking the scaffold polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5- fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- the in vivo half-life e.g., the serum half-life
- an Fc polypeptide increases the in vivo half-life (e.g., the serum half-life) of the TMMP, compared to a control TMMP lacking the Fc polypeptide, by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 50%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 100-fold, or more than 100-fold.
- Fc polypeptides [00373]
- the first and/or the second polypeptide chain of a TMMP of the present disclosure comprises an Fc polypeptide.
- the Fc polypeptide of a TMMP of the present disclosure can be a human IgG1 Fc, a human IgG2 Fc, a human IgG3 Fc, a human IgG4 Fc, etc.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to an amino acid sequence of an Fc region depicted in FIG. 3A-3G.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG1 Fc polypeptide depicted in FIG.3A.
- the Fc region comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG1 Fc polypeptide depicted in FIG.3A; and comprises a substitution of N77; e.g., the Fc polypeptide comprises an N77A substitution.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG2 Fc polypeptide depicted in FIG.3A; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 99-325 of the human IgG2 Fc polypeptide depicted in FIG.3A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG3 Fc polypeptide depicted in FIG. 3A; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 19-246 of the human IgG3 Fc polypeptide depicted in FIG.3A.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgM Fc polypeptide depicted in FIG.3B; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 1-276 to the human IgM Fc polypeptide depicted in FIG.3B.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgA Fc polypeptide depicted in FIG.3C; e.g., the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 1-234 to the human IgA Fc polypeptide depicted in FIG.3C.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to the human IgG4 Fc polypeptide depicted in FIG.3C.
- the Fc polypeptide comprises an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or 100%, amino acid sequence identity to amino acids 100 to 327 of the human IgG4 Fc polypeptide depicted in FIG.3C.
- the IgG4 Fc polypeptide comprises the following amino acid sequence: [00376]
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc).
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc), except for a substitution of N297 (N77 of the amino acid sequence depicted in FIG.3A) with an amino acid other than asparagine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3C (human IgG1 Fc comprising an N297A substitution, which is N77 of the amino acid sequence depicted in FIG.3A).
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc), except for a substitution of L234 (L14 of the amino acid sequence depicted in FIG.3A) with an amino acid other than leucine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc), except for a substitution of L235 (L15 of the amino acid sequence depicted in FIG.3A) with an amino acid other than leucine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3E.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3F.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.5G (human IgG1 Fc comprising an L234A substitution and an L235A substitution, corresponding to positions 14 and 15 of the amino acid sequence depicted in FIG.3G).
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc), except for a substitution of P331 (P111 of the amino acid sequence depicted in FIG.3A) with an amino acid other than proline; in some cases, the substitution is a P331S substitution.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc), except for substitutions at L234 and L235 (L14 and L15 of the amino acid sequence depicted in FIG.3A) with amino acids other than leucine.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3A (human IgG1 Fc), except for substitutions at L234 and L235 (L14 and L15 of the amino acid sequence depicted in FIG.3A) with amino acids other than leucine, and a substitution of P331 (P111 of the amino acid sequence depicted in FIG.3A) with an amino acid other than proline.
- the Fc polypeptide present in a TMMP comprises the amino acid sequence depicted in FIG.3E (human IgG1 Fc comprising L234F, L235E, and P331S substitutions (corresponding to amino acid positions 14, 15, and 111 of the amino acid sequence depicted in FIG.3E).
- the Fc polypeptide present in a TMMP is an IgG1 Fc polypeptide that comprises L234A and L235A substitutions (substitutions of L14 and L15 of the amino acid sequence depicted in FIG.3A with Ala), as depicted in FIG.3G.
- a TMMP of the present disclosure can include one or more linkers, where the one or more linkers are between one or more of: i) an MHC Class I polypeptide and an Ig Fc polypeptide, where such a linker is referred to herein as “L1”; ii) an immunomodulatory polypeptide and an MHC Class I polypeptide, where such a linker is referred to herein as “L2”; iii) a first immunomodulatory polypeptide and a second immunomodulatory polypeptide, where such a linker is referred to herein as “L3”; iv) a peptide antigen (“epitope”) and an MHC Class I polypeptide; v) an MHC Class I polypeptide and a dimerization polypeptide (e.g., a first or a second member of a dimerizing pair); and vi) a dimerization polypeptide (e.g., a first or a second member of a dimerizing pair); and
- Suitable linkers can be readily selected and can be of any of a number of suitable lengths, such as from 1 amino acid to 25 amino acids, from 3 amino acids to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids.
- a suitable linker can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length.
- a linker has a length of from 25 amino acids to 50 amino acids, e.g., from 25 to 30, from 30 to 35, from 35 to 40, from 40 to 45, or from 45 to 50 amino acids in length.
- Exemplary linkers include glycine polymers (G)n, glycine-serine polymers (including, for example, (GS)n, (GSGGS)n (SEQ ID NO:363) and (GGGS)n (SEQ ID NO:364), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art.
- Glycine and glycine-serine polymers can be used; both Gly and Ser are relatively unstructured, and therefore can serve as a neutral tether between components. Glycine polymers can be used; glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem.11173-142 (1992)).
- Exemplary linkers can comprise amino acid sequences including, but not limited to, GGSG (SEQ ID NO:365), GGSGG (SEQ ID NO:366), GSGSG (SEQ ID NO:367), GSGGG (SEQ ID NO:368), GGGSG (SEQ ID NO:369), GSSSG (SEQ ID NO:370), and the like.
- Exemplary linkers can include, e.g., Gly(Ser4)n (SEQ ID NO:371), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- a linker comprises the amino acid sequence (GSSSS)n (SEQ ID NO:371), where n is 4.
- a linker comprises the amino acid sequence (GSSSS)n (SEQ ID NO:371), where n is 5. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 1. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 2. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 3. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 4.
- a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 5. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 6. In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 7, In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 8, In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 9, In some cases, a linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is 10.
- a linker comprises the amino acid sequence AAAGG (SEQ ID NO:372).
- a linker polypeptide, present in a first polypeptide of a TMMP of the present disclosure includes a cysteine residue that can form a disulfide bond with a cysteine residue present in a second polypeptide of a TMMP of the present disclosure.
- a suitable linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:208).
- a suitable linker can comprise the amino acid sequence GCGGS(G4S)n (SEQ ID NO:206), where n is 1, 2, 3, 4, 5, 6, 7, 8, or 9.
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGSGGGGS (SEQ ID NO:207).
- the linker comprises the amino acid sequence GCGGSGGGGSGGGGS (SEQ ID NO:208).
- Multiple disulfide bonded TMMPs [00382]
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by at least two disulfide bonds (i.e., two interchain disulfide bonds). Examples of such multiple disulfide-linked TMMP are depicted schematically in FIG.2A and 2B.
- a heterodimeric TMMP can be dimerized, such that disulfide bonds link the IgFc polypeptides in the two heterodimeric TMMPs.
- a heterodimeric TMMP can be dimerized, such that disulfide bonds link the IgFc polypeptides in the two heterodimeric TMMPs.
- FIG.2A and 2B Such an arrangement is depicted schematically in FIG.2A and 2B, where disulfide bonds are represented by dashed lines.
- the at least two disulfide bonds described in the multiple disulfide-linked TMMPPs in this section are not referring to disulfide bonds linking IgFc polypeptides in dimerized TMMPs.
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by at least two disulfide bonds (i.e., two interchain disulfide bonds).
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by 2 interchain disulfide bonds.
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by 3 interchain disulfide bonds.
- the first polypeptide and the second polypeptide of a TMMP of the present disclosure are linked to one another by 4 interchain disulfide bonds.
- a linker comprising a Cys In some cases where a peptide epitope in a first polypeptide of a TMMP of the present disclosure is linked to a ⁇ 2M polypeptide by a linker comprising a Cys, at least one of the at least two disulfide bonds links a Cys in the linker to a Cys in an MHC Class I heavy chain in the second polypeptide.
- a peptide epitope in a first polypeptide of a TMMP of the present disclosure is linked to an MHC Class I heavy chain polypeptide by a linker
- at least one of the at least two disulfide bonds links a Cys in the linker to a Cys in a ⁇ 2M polypeptide present in the second polypeptide.
- a multiple disulfide-linked TMMP of the present disclosure can comprise, for example: a) a first polypeptide comprising: i) a peptide epitope (e.g., a peptide of from 4 amino acids to about 25 amino acids in length, that is bound by a TCR when the peptide is complexed with MHC polypeptides); and ii) a first MHC polypeptide, where the first polypeptide comprises a peptide linker between the KRAS peptide and the first MHC polypeptide, where the peptide linker comprises a Cys residue, and where the first MHC polypeptide is a ⁇ 2M polypeptide that comprises an amino acid substitution that introduces a Cys residue; b) and a second polypeptide comprising a second MHC polypeptide, where the second MHC polypeptide is a Class I heavy chain comprising a Y84C substitution
- the peptide linker comprises the amino acid sequence GCGGS (SEQ ID NO:373). In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is an integer from 1 to 10. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 1. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 2. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 3.
- the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 4. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 5. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 6. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 7. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 8.
- the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 9. In some cases, the peptide linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is 10. [00387] In some cases, the peptide linker comprises the amino acid sequence CGGGS (SEQ ID NO:374). In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is an integer from 1 to 10. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 1.
- the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 2. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 3. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 4. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 5. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 6.
- the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 7. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 8. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 9. In some cases, the peptide linker comprises the amino acid sequence CGGGS(GGGGS)n (SEQ ID NO:375), where n is 10.
- a chimeric molecule of the present disclosure can be dimerized; i.e., the present disclosure provides a chimeric molecule comprising a dimer of a TMMP.
- the present disclosure provides a chimeric molecule comprising a TMMP comprising: A) a first heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first major histocompatibility complex (MHC) polypeptide; and b) a second polypeptide comprising: i) a second MHC polypeptide, wherein the first heterodimer comprises one or more immunomodulatory polypeptides; and B) a second heterodimer comprising: a) a first polypeptide comprising: i) a peptide epitope; and ii) a first MHC polypeptide; and b) a second polypeptide comprising: i) a second polypeptide comprising: i) a
- the nucleic acid component is attached to the first heterodimer and the second heterodimer.
- the two TMMPs are identical to one another in amino acid sequence.
- the first heterodimer and the second heterodimer are covalently linked to one another via a C-terminal region of the second polypeptide of the first heterodimer and a C-terminal region of the second polypeptide of the second heterodimer.
- first heterodimer and the second heterodimer are covalently linked to one another via the C-terminal amino acid of the second polypeptide of the first heterodimer and the C-terminal region of the second polypeptide of the second heterodimer; for example, in some cases, the C-terminal amino acid of the second polypeptide of the first heterodimer and the C-terminal region of the second polypeptide of the second heterodimer are linked to one another, either directly or via a linker.
- the linker can be a peptide linker.
- the peptide linker can have a length of from 1 amino acid to 200 amino acids (e.g., from 1 amino acid (aa) to 5 aa, from 5 aa to 10 aa, from 10 aa to 25 aa, from 25 aa to 50 aa, from 50 aa to 100 aa, from 100 aa to 150 aa, or from 150 aa to 200 aa).
- the peptide epitope of the first heterodimer and the peptide epitope of the second heterodimer comprise the same amino acid sequence.
- the first MHC polypeptide of the first and the second heterodimer is an MHC Class I ⁇ 2-microglobulin, and wherein the second MHC polypeptide of the first and the second heterodimer is an MHC Class I heavy chain.
- the immunomodulatory polypeptide of the first heterodimer and the immunomodulatory polypeptide of the second heterodimer comprise the same amino acid sequence.
- the immunomodulatory polypeptide of the first heterodimer and the immunomodulatory polypeptide of the second heterodimer are variant immunomodulatory polypeptides that comprise from 1 to 10 amino acid substitutions compared to a corresponding parental wild-type immunomodulatory polypeptide, and wherein the from 1 to 10 amino acid substitutions result in reduced affinity binding of the variant immunomodulatory polypeptide to a cognate co-immunomodulatory polypeptide.
- the immunomodulatory polypeptide of the first heterodimer and the immunomodulatory polypeptide of the second heterodimer are each independently selected from the group consisting of IL-2, 4-1BBL, PD-L1, CD80, CD86, ICOS-L, OX-40L, FasL, JAG1 (CD339), TGF ⁇ , CD70, and ICAM. Examples, of suitable MHC polypeptides, immunomodulatory polypeptides, and peptide epitopes are described below.
- the first and/or the second polypeptide comprises: i) an Ig Fc polypeptide or a non-Ig scaffold; and ii) a tumor- targeting polypeptide.
- a CAR generally comprises: a) an extracellular domain comprising an antigen-binding domain (antigen-binding polypeptide); b) a transmembrane region; and c) a cytoplasmic domain comprising an intracellular signaling domain (intracellular signaling polypeptide).
- a CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a transmembrane region; and c) a cytoplasmic domain comprising: i) a co-stimulatory polypeptide; and ii) an intracellular signaling domain.
- a CAR comprises hinge region between the extracellular antigen- binding domain and the transmembrane domain.
- a CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a hinge region; c) a transmembrane region; and d) a cytoplasmic domain comprising an intracellular signaling domain.
- a CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a hinge region; c) a transmembrane region; and d) a cytoplasmic domain comprising: i) a co-stimulatory polypeptide; and ii) an intracellular signaling domain.
- a CAR is a single polypeptide chain. In some cases, a CAR comprises two polypeptide chains.
- CARs specific for a variety of tumor antigens are known in the art; for example CD171- specific CARs (Park et al., Mol Ther (2007) 15(4):825-833), EGFRvIII-specific CARs (Morgan et al., Hum Gene Ther (2012) 23(10):1043-1053), EGF-R-specific CARs (Kobold et al., J.
- a CAR comprises an extracellular domain comprising an antigen-binding domain.
- the antigen-binding domain present in a CAR can be any antigen-binding polypeptide, a wide variety of which are known in the art.
- the antigen-binding domain is a single chain Fv (scFv).
- antibody-based recognition domains cAb VHH (camelid antibody variable domains) and humanized versions
- sdAb VH (single domain antibody variable domains) and “camelized” antibody variable domains are suitable.
- the antigen-binding domain is a nanobody.
- the antigen bound by the antigen-binding domain of a CAR is selected from: a MUC1 polypeptide, an LMP2 polypeptide, an epidermal growth factor receptor (EGFR) vIII polypeptide, a HER-2/neu polypeptide, a melanoma antigen family A, 3 (MAGE A3) polypeptide, a p53 polypeptide, a mutant p53 polypeptide, an NY-ESO-1 polypeptide, a folate hydrolase (prostate-specific membrane antigen; PSMA) polypeptide, a carcinoembryonic antigen (CEA) polypeptide, a melanoma antigen recognized by T-cells (melanA/MART1) polypeptide, a Ras polypeptide, a gp100 polypeptide, a proteinase3 (PR1) polypeptide, a bcr-abl polypeptide, a tyrosinase polypeptide, a surviv
- the antigen is a human papilloma virus (HPV) antigen. In some cases, the antigen is an alpha-feto protein (AFP) antigen. In some cases, the antigen is a Wilms tumor-1 (WT1) antigen.
- the antigen-binding polypeptide of a CAR can bind any of a variety of cancer- associated antigens, including, e.g., antigens of the immunoglobulin superfamily (see, e.g., Barclay (2003) Seminars in Immunology 15:215); antigens of the tumor necrosis factor (TNF) superfamily (see, e.g., Aggarwal et al.
- TNF tumor necrosis factor
- the antigen-binding polypeptide of a CAR can bind any of a variety of cancer- associated antigens, including, e.g., CD19, CD20, CD38, CD30, Her2/neu, ERBB2, CA125, MUC-1, prostate-specific membrane antigen (PSMA), CD44 surface adhesion molecule, mesothelin, carcinoembryonic antigen (CEA), epidermal growth factor receptor (EGFR), EGFRvIII, vascular endothelial growth factor receptor-2 (VEGFR2), B-cell maturation antigen (BCMA), high molecular weight-melanoma associated antigen (HMW-MAA), MAGE-A1, IL-13R-a2, GD2, and the like.
- cancer- associated antigens including, e.g., CD19, CD20, CD38, CD30, Her2/neu, ERBB2, CA125, MUC-1, prostate-specific membrane antigen (PSMA), CD44 surface adhesion molecule, mesothelin
- Cancer- associated antigens also include, e.g., 4-1BB, 5T4, adenocarcinoma antigen, alpha-fetoprotein (AFP), BAFF, B-lymphoma cell, C242 antigen, CA-125, carbonic anhydrase 9 (CA-IX), C-MET, CCR4, CD152, CD19, CD20, CD200, CD22, CD221, CD23 (IgE receptor), CD28, CD30 (TNFRSF8), CD33, CD4, CD40, CD44 v6, CD51, CD52, CD56, CD74, CD80, CEA, CNTO888, CTLA-4, DRS, EGFR, EpCAM, CD3, FAP, fibronectin extra domain-B, folate receptor 1, GD2, GD3 ganglioside, glycoprotein 75, GPNMB, HER2/neu, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, IgG1, L1- CAM, IL-13, IL
- the cancer-associated antigen bound by the antigen-binding polypeptide of a CAR is selected from AFP, BCMA, CD10, CD117, CD123, CD133, CD128, CD171, CD19, CD20, CD22, CD30, CD33, CD34, CD38, CD5, CD56, CD7, CD70, CD80, CD86, CEA, CLD18, CLL-1, cMet, EGFR, EGFRvIII, EpCAM, EphA2, GD-2, glypican-3, GPC3, HER-2, kappa immunoglobulin, LeY, LMP1, mesothlin, MG7, MUC1, NKG2D ligand, PD-L1, PSCA, PSMA, ROR1, ROR1R, TACI, and VEGFR2.
- the cancer-associated antigen is BCMA. In some cases, the cancer-associated antigen is MUC1. In some cases, the cancer-associated antigen is CD19. In some cases, the cancer-associated antigen is AFP.
- VH and VL amino acid sequences of various cancer-associated antigen-binding antibodies are known in the art, as are the light chain and heavy chain CDRs of such antibodies. See, e.g., Ling et al. (2016) Frontiers Immunol.9:469; WO 2005/012493; US 2019/0119375; US 2013/0066055. The following are non-limiting examples of antibodies that bind cancer-associated antigens.
- an anti-Her2 antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00403] In some cases, an anti-Her2 antibody comprises a light chain variable region (VL) present in the light chain amino acid sequence provided above; and a heavy chain variable region (VH) present in the heavy chain amino acid sequence provided above.
- VL light chain variable region
- VH heavy chain variable region
- an anti-Her2 antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: ID NO:4).
- an anti-Her2 antibody comprises, in order from N-terminus to C-terminus: a) a VH comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: ID NO:4); b) a linker; and c) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: described elsewhere herein and include, e.g., (GGGGS)n (SEQ ID NO:5), where n is an integer from 1 to 10 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10).
- an anti-Her2 antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- the V H and V L CDRs are as defined by Kabat (see, e.g., Table 1, above; and Kabat 1991).
- the V H and V L CDRs are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-Her2 antibody can comprise a VL CDR1 having the amino acid sequence RASQDVNTAVA (SEQ ID NO:6); a VL CDR2 having the amino acid sequence SASFLY (SEQ ID NO:7); a VL CDR3 having the amino acid sequence QQHYTTPP (SEQ ID NO:8); a VH CDR1 having the amino acid sequence GFNIKDTY (SEQ ID NO:9); a VH CDR2 having the amino acid sequence IYPTNGYT (SEQ ID NO:10); and a VH CDR3 having the amino acid sequence SRWGGDGFYAMDY (SEQ ID NO:11).
- an anti-Her2 antibody is a scFv antibody.
- an anti-Her2 scFv can comprise an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- an anti-Her2 antibody comprises: a) a light chain variable region (VL) comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: (VH) comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00410]
- an anti-Her2 antibody comprises a VL present in the light chain amino acid sequence provided above; and a VH present in the heavy chain amino acid sequence provided above.
- an anti-Her2 antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: ) [00411]
- an anti-Her2 antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- an anti-HER2 antibody can comprise a VL CDR1 having the amino acid
- an anti-Her2 antibody is a scFv.
- an anti-Her2 scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: 2)
- Anti-CD19 [00415]
- Anti-CD19 antibodies are known in the art; and the VH and VL, or the VH and VL CDRs, of any anti-CD19 antibody can be included in a CAR. See e.g., WO 2005/012493.
- an anti-CD19 antibody includes a VL CDR1 comprising the amino acid ( ) i i h i id the amino acid sequence DASNLVS (SEQ ID NO:24); a VL CDR3 comprising the amino acid sequence QQSTEDPWT (SEQ ID NO:25); a VH CDR1 comprising the amino acid sequence SYWMN (SEQ ID NO:26); a VH CDR2 comprising the amino acid sequence QIWPGDGDTNYNGKFKG (SEQ ID NO:27); and a VH CDR3 comprising the amino acid sequence RETTTVGRYYYAMDY (SEQ ID NO:28).
- an anti-CD19 antibody is a scFv.
- an anti- CD19 scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: ) 3) Anti-mesothelin [00418]
- Anti-mesothelin antibodies are known in the art; and the VH and VL, or the VH and VL CDRs, of any anti-mesothelin antibody can be included in a CAR.
- an anti-mesothelin antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: Q Q ( Q ); [00421] b) a heavy chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00423] In some cases, an anti-mesothelin antibody comprises a VL present in the light chain amino acid sequence provided above; and a VH present in the heavy chain amino acid sequence provided above.
- an anti-mesothelin antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: Q ( Q ); ) comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: ) [00424]
- an anti-mesothelin antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- V H and V L CDRs are as defined by Kabat (see, e.g., Table 1, above; and Kabat 1991). In some cases, the V H and V L CDRs are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-mesothelin antibody can comprise a VL CDR1 having the amino acid sequence TGTSSDIGGYNSVS (SEQ ID NO:34); a VL CDR2 having the amino acid sequence ID NO:36); a VH CDR1 having the amino acid sequence GYSFTSYWIG (SEQ ID NO:37); a VH CDR2 having the amino acid sequence WMGIIDPGDSRTRYSP (SEQ ID NO:38); and a VH CDR3 having the amino acid sequence GQLYGGTYMDG (SEQ ID NO:39).
- An anti-mesothelin antibody can be a scFv.
- an anti- mesothelin scFv can comprise the following amino acid sequence: NO:40), where VH CDR1, CDR2, and CDR3 are underlined; and VL CDR1, CDR2, and CDR3 are bolded and underlined.
- an anti-mesothelin scFv can comprise the following amino acid sequence: CDR3 are underlined; and VL CDR1, CDR2, and CDR3 are bolded and underlined.
- Anti-BCMA B-cell maturation antigen
- VH and VL, or the VH and VL CDRs, of any anti-BCMA antibody can be included in a CAR. See, e.g., WO 2014/089335; US 2019/0153061; and WO 2017/093942.
- an anti-BCMA antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00431] b) a heavy chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: ( Q ) [00432]
- an anti-BCMA antibody comprises a VL present in the light chain amino acid sequence provided above; and a VH present in the heavy chain amino acid sequence provided above.
- an anti-BCMA antibody can comprise: a) a VL comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: NO:44); and b) a VH comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence: [00435]
- an anti-BCMA antibody comprises VL CDR1, VL CDR2, and VL CDR3 present in the light chain amino acid sequence provided above; and VH CDR1, CDR2, and CDR3 present in the heavy chain amino acid sequence provided above.
- the VH and VL CDRs are as defined by Kabat (see, e.g., Table 1, above; and Kabat 1991). In some cases, the VH and VL CDRs are as defined by Chothia (see, e.g., Table 1, above; and Chothia 1987).
- an anti-BCMA antibody can comprise a VL CDR1 having the amino acid sequence SSNIGSNT (SEQ ID NO:46), a VL CDR2 having the amino acid sequence NYH, a VL CDR3 having the amino acid sequence AAWDDSLNGWV (SEQ ID NO:47)), a VH CDR1 having the amino acid sequence GFTFGDYA (SEQ ID NO:48), a VH CDR2 having the amino acid sequence SRSKAYGGTT (SEQ ID NO:49), and a VH CDR3 having the amino acid sequence ASSGYSSGWTPFDY (SEQ ID NO:50).
- An anti-BCMA antibody can be a scFv.
- an anti-BCMA scFv can comprise the following amino acid sequence: [00438]
- an anti-BCMA scFv can comprise the following amino acid sequence: [00439]
- an anti-BCMA antibody can comprise a VL CDR1 having the amino acid sequence SASQDISNYLN (SEQ ID NO:53); a VL CDR2 having the amino acid sequence YTSNLHS (SEQ ID NO:54); a VL CDR3 having the amino acid sequence QQYRKLPWT (SEQ ID NO:55); a VH CDR1 having the amino acid sequence NYWMH (SEQ ID NO:56); a VH CDR2 having the amino acid sequence ATYRGHSDTYYNQKFKG (SEQ ID NO:57); and a VH CDR3 having the amino acid sequence GAIYNGYDVLDN (SEQ ID NO:58).
- an anti-BCMA antibody comprises: a) a light chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00441]
- an anti-BCMA antibody comprises: a) a heavy chain comprising an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00442]
- an anti-BCMA antibody (e.g., an antibody referred to in the literature as belantamab) comprises a light chain comprising the amino acid sequence: DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKLLIYYTSNLHSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQYRKLPWTFGQGTKLEIKR (SEQ ID NO:61); and a heavy
- the anti-BCMA antibody is GSK2857916 (belantamab- mafodotin), where monomethyl auristatin F (MMAF) is linked via a maleimidocaproyl linker to the anti- BCMA antibody belantamab.
- MMAF monomethyl auristatin F
- Anti-MUC1 an antigen-binding polypeptide present in a CAR is a single-chain Fv specific for MUC1. See, e.g., Singh et al. (2007) Mol. Cancer Ther.6:562; Thie et al. (2011) PLoSOne 6:e15921; Imai et al. (2004) Leukemia 18:676; Posey et al.
- an antigen-binding polypeptide present in a CAR is a scFv specific for the MUC1 peptide VTSAPDTRPAPGSTAPPAHG (SEQ ID NO:61).
- a TTP is a scFv specific for the MUC1 peptide SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:62).
- an antigen-binding polypeptide present in a CAR is a scFv specific for the MUC1 peptide SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:63).
- a TTP is a scFv specific for the MUC1 peptide LAFREGTINVHDVETQFNQY (SEQ ID NO:64).
- an antigen-binding polypeptide present in a CAR is a scFv specific for the MUC1 peptide SNIKFRPGSVVVQLTLAAFREGTIN (SEQ ID NO:65).
- an anti-MUC1 antibody can comprise: a VH CDR1 having the amino acid sequence RYGMS (SEQ ID NO:66); a VH CDR2 having the amino acid sequence TISGGGTYIYYPDSVKG (SEQ ID NO:67); a VH CDR3 having the amino acid sequence DNYGRNYDYGMDY (SEQ ID NO:68); a VL CDR1 having the amino acid sequence SATSSVSYIH (SEQ ID NO:69); a VL CDR2 having the amino acid sequence STSNLAS (SEQ ID NO:70); and a VL CDR3 having the amino acid sequence QQRSSSPFT (SEQ ID NO:71). See, e.g., US 2018/0112007.
- an anti-MUC1 antibody can comprise a VH CDR1 having the amino acid sequence GYAMS (SEQ ID NO:72); a VH CDR2 having the amino acid sequence TISSGGTYIYYPDSVKG (SEQ ID NO:73); a VH CDR3 having the amino acid sequence LGGDNYYEYFDV (SEQ ID NO:74); a VL CDR1 having the amino acid sequence RASKSVSTSGYSYMH (SEQ ID NO:75); a VL CDR2 having the amino acid sequence LASNLES (SEQ ID NO:76); and a VL CDR3 having the amino acid sequence QHSRELPFT (SEQ ID NO:77). See, e.g., US 2018/0112007.
- an anti-MUC1 antibody can comprise a VH CDR1 having the amino acid sequence DYAMN (SEQ ID NO:78); a VH CDR2 having the amino acid sequence VISTFSGNINFNQKFKG (SEQ ID NO:79); a VH CDR3 having the amino acid sequence SDYYGPYFDY (SEQ ID NO:80); a VL CDR1 having the amino acid sequence RSSQTIVHSNGNTYLE (SEQ ID NO:81); a VL CDR2 having the amino acid sequence KVSNRFS (SEQ ID NO:82); and a VL CDR3 having the amino acid sequence (FQGSHVPFT (SEQ ID NO:83).
- an anti-MUC1 antibody can comprise a VH CDR1 having the amino acid sequence GYAMS (SEQ ID NO:72); a VH CDR2 having the amino acid sequence TISSGGTYIYYPDSVKG (SEQ ID NO:73); a VH CDR3 having the amino acid sequence LGGDNYYEY (SEQ ID NO:84); a VL CDR1 having the amino acid sequence TASKSVSTSGYSYMH (SEQ ID NO:85); a VL CDR2 having the amino acid sequence LVSNLES (SEQ ID NO:86); and a VL CDR3 having the amino acid sequence QHIRELTRSE (SEQ ID NO:87).
- an antigen-binding polypeptide present in a CAR is specific for a MUC16 polypeptide present on a cancer cell. See, e.g., US 2018/0118848; and US 2018/0112008.
- a MUC16-specific antigen-binding polypeptide is a scFv.
- a MUC16-specific antigen- binding polypeptide is a nanobody.
- an anti-MUC16 antibody can comprise a VH CDR1 having the amino acid sequence GFTFSNYY (SEQ ID NO:88); a VH CDR2 having the amino acid sequence ISGRGSTI (SEQ ID NO:89); a VH CDR3 having the amino acid sequence VKDRGGYSPY (SEQ ID NO:90); a VL CDR1 having the amino acid sequence QSISTY (SEQ ID NO:91); a VL CDR2 having the amino acid sequence TAS; and a VL CDR3 having the amino acid sequence QQSYSTPPIT (SEQ ID NO:92). See, e.g., US 2018/0118848.
- a suitable CAR comprises a scFv specific for CD19.
- an anti-CD19 scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence:
- a suitable CAR comprises a scFv specific for mesothelin.
- an anti-mesothelin scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00453] In some cases, an anti-mesothelin scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00454] In some cases, a suitable CAR comprises a scFv specific for B-cell maturation antigen (BCMA).
- BCMA B-cell maturation antigen
- an anti-BCMA scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00455]
- an anti-BCMA scFv comprises an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the following amino acid sequence: [00456]
- a CAR can include a hinge region between the extracellular domain and the transmembrane domain.
- the term “hinge region” refers to a flexible polypeptide connector region (also referred to herein as “hinge” or “spacer”) providing structural flexibility and spacing to flanking polypeptide regions and can consist of natural or synthetic polypeptides.
- the hinge region can include complete hinge region derived from an antibody of a different class or subclass from that of the CH1 domain.
- the term “hinge region” can also include regions derived from CD8 and other receptors that provide a similar function in providing flexibility and spacing to flanking regions.
- the hinge region can have a length of from about 4 amino acids to about 50 amino acids, e.g., from about 4 aa to about 10 aa, from about 10 aa to about 15 aa, from about 15 aa to about 20 aa, from about 20 aa to about 25 aa, from about 25 aa to about 30 aa, from about 30 aa to about 40 aa, or from about 40 aa to about 50 aa.
- an immunoglobulin hinge region can include one of the following amino acid sequences: DKTHT (SEQ ID NO:93); CPPC (SEQ ID NO:94); ELKTPLGDTTHTCPRCP (SEQ ID NO:102) (human IgG3 hinge); SPNMVPHAHHAQ (SEQ ID NO:103) (human IgG4 hinge); and the like.
- the hinge region can comprise an amino acid sequence derived from human CD8; e.g., the hinge region can comprise the amino acid sequence: TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO:104), or a variant thereof.
- Transmembrane domain Any transmembrane (TM) domain that provides for insertion of a polypeptide into the cell membrane of a eukaryotic (e.g., mammalian) cell is suitable for use.
- the transmembrane region of a CAR can be derived from (i.e.
- CD28 comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8 (e.g., CD8 alpha, CD8 beta), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R .alpha., ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103
- the transmembrane domain can be synthetic, in which case it can comprise predominantly hydrophobic residues such as leucine and valine. In some cases, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- the TM sequence IYIWAPLAGTCGVLLLSLVITLYC (SEQ ID NO:105) can be used.
- TM sequences include: a) CD8 beta derived TM: LGLLVAGVLVLLVSLGVAIHLCC (SEQ ID NO:106); b) CD4 derived TM: ALIVLGGVAGLLLFIGLGIFFCVRC (SEQ ID NO:107); c) CD3 zeta derived TM: LCYLLDGILFIYGVILTALFLRV (SEQ ID NO:108); d) CD28 derived TM: WVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO:109); e) CD134 (OX40) derived TM: VAAILGLGLVLGLLGPLAILLALYLL (SEQ ID NO:110); and f) CD7 derived TM: ALPAALAVISFLLGLGLGVACVLA (SEQ ID NO:111).
- Intracellular domain – co-stimulatory polypeptide The intracellular portion (cytoplasmic domain) of a CAR can comprise one or more co- stimulatory polypeptides.
- suitable co-stimulatory polypeptides include, but are not limited to, 4-1BB (CD137), CD28, ICOS, OX-40, BTLA, CD27, CD30, GITR, and HVEM.
- Suitable co-stimulatory polypeptides include, e.g.: 1) a 4-1BB polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO:112); 2) a CD28 polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO:113); 3) an ICOS polypeptide having at least 90%, at least 95%, at least 98%, or 100%, amino acid sequence identity to the following amino acid sequence: TKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL (SEQ ID NO:114); 4) an OX40 polypeptide having at least 90%, at least 95%, at least 98%, or
- the co-stimulatory polypeptide can have a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- Intracellular domain – signaling polypeptide [00462]
- the intracellular portion of a CAR can comprise a signaling polypeptide.
- Suitable signaling polypeptides include, e.g., an immunoreceptor tyrosine-based activation motif (ITAM)- containing intracellular signaling polypeptide.
- ITAM immunoreceptor tyrosine-based activation motif
- An ITAM motif is YX 1 X 2 L/I (SEQ ID NO:121), where X 1 and X2 are independently any amino acid.
- the intracellular signaling domain of a subject CAR comprises 1, 2, 3, 4, or 5 ITAM motifs.
- an ITAM motif is repeated twice in an intracellular signaling domain, where the first and second instances of the ITAM motif are separated from one another by 6 to 8 amino acids, e.g., (YX1X2L/I)(X3)n(YX1X2L/I) (SEQ ID NO:122), where n is an integer from 6 to 8, and each of the 6-8 X3 can be any amino acid.
- the intracellular signaling domain of a CAR comprises 3 ITAM motifs.
- a suitable intracellular signaling domain can be an ITAM motif-containing portion that is derived from a polypeptide that contains an ITAM motif.
- a suitable intracellular signaling domain can be an ITAM motif-containing domain from any ITAM motif-containing protein.
- a suitable intracellular signaling domain need not contain the entire sequence of the entire protein from which it is derived.
- suitable ITAM motif-containing polypeptides include, but are not limited to: DAP12; FCER1G (Fc epsilon receptor I gamma chain); CD3D (CD3 delta); CD3E (CD3 epsilon); CD3G (CD3 gamma); CD3Z (CD3 zeta); and CD79A (antigen receptor complex-associated protein alpha chain).
- a chimeric molecule of the present disclosure comprises a nucleic acid covalently linked to a TMMP, where the nucleic acid comprises a nucleotide sequence encoding a CAR.
- the nucleic acid is DNA.
- the nucleic acid is an expression vector (e.g., a recombinant expression vector).
- the recombinant expression vector is a viral construct, e.g., a recombinant adeno-associated virus (AAV) construct, a recombinant adenoviral construct, and the like.
- the nucleic acid is an RNA.
- the nucleic acid is a viral RNA construct.
- the RNA is a retroviral construct comprising a nucleotide sequence encoding a CAR.
- the RNA is a lentiviral construct comprising a nucleotide sequence encoding a CAR.
- the nucleic acid is an mRNA.
- mRNAs [00467]
- the nucleic acid component of a chimeric molecule of the present disclosure is an mRNA.
- the mRNA is covalently linked to the C-terminus of the first polypeptide of the heterodimer of the TMMP.
- the mRNA is covalently linked to the C- terminus of second polypeptide of the heterodimer of the TMMP. In some cases, the mRNA is covalently linked to the C-terminus of an Fc polypeptide present in the TMMP.
- the mRNA can include one or more of the following features: i) a 5’cap structure; ii) a poly(adenosine) (polyA) tail (i.e., a polyA tract at the 3’ end of the mRNA; iii) a 5’ untranslated region (5’ UTR); and iv) a 3’ untranslated region (3’ UTR).
- an mRNA can be produced using any known method, including, e.g., in vitro transcription. See, e.g., Van Hoecke and Roose (2019) J. Transl. Med. 17:54.
- the mRNA comprises one or more modifications.
- the mRNA component of a chimeric molecule of the present disclosure can comprise one or more of: i) a modified base; ii) a modified sugar; and iii) a modified backbone.
- An mRNA comprises nucleosides.
- the base of one or more nucleosides of the mRNA is modified.
- the sugar of one or more nucleosides of the mRNA is modified.
- both the base and the sugar of one or more nucleosides of the mRNA is modified.
- suitable mRNA modifications include modified nucleic acid backbones and non-natural internucleoside linkages. Nucleic acids having modified backbones include those that retain a phosphorus atom in the backbone and those that do not have a phosphorus atom in the backbone.
- Suitable modified backbones containing a phosphorus atom therein include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3'-alkylene phosphonates, 5'- alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, phosphorodiamidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, selenophosphates and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein one or more internucleotide linkages is a 3' to 3', 5' to 5' or 2' to
- Suitable mRNAs having inverted polarity comprise a single 3' to 3' linkage at the 3'-most internucleotide linkage i.e. a single inverted nucleoside residue which may be a basic (the nucleobase is missing or has a hydroxyl group in place thereof).
- Various salts such as, for example, potassium or sodium salts
- mixed salts, and free acid forms can also be included.
- MMI type internucleoside linkages are disclosed in the above referenced U.S. Pat. No. 5,489,677. Suitable amide internucleoside linkages are disclosed in t U.S. Pat. No.5,602,240.
- mRNAs having morpholino backbone structures as described in, e.g., U.S. Pat. No.5,034,506.
- an mRNA comprises a 6-membered morpholino ring in place of a ribose ring.
- a phosphorodiamidate or other non-phosphodiester internucleoside linkage replaces a phosphodiester linkage.
- Suitable modified polynucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages.
- morpholino linkages formed in part from the sugar portion of a nucleoside
- siloxane backbones sulfide, sulfoxide and sulfone backbones
- formacetyl and thioformacetyl backbones methylene formacetyl and thioformacetyl backbones
- riboacetyl backbones alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH2 component parts.
- the mRNA component of a chimeric molecule of the present disclosure can include one or more substituted sugar moieties.
- Suitable polynucleotides comprise a sugar substituent group selected from: OH; F; O-, S-, or N-alkyl; O-, S-, or N-alkenyl; O-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted C.sub.1 to C10 alkyl or C2 to C10 alkenyl and alkynyl.
- Particularly suitable are O((CH2)nO) mCH3, O(CH2)nOCH3, O(CH2)nNH2, O(CH 2 ) n CH 3 , O(CH 2 ) n ONH 2 , and O(CH 2 ) n ON((CH 2 ) n CH 3 ) 2 , where n and m are from 1 to about 10.
- Suitable polynucleotides comprise a sugar substituent group selected from: C 1 to C 10 lower alkyl, substituted lower alkyl, alkenyl, alkynyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH 3 , OCN, Cl, Br, CN, CF 3 , OCF 3 , SOCH 3 , SO 2 CH 3 , ONO 2 , NO 2 , N 3 , NH 2 , heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of an mRNA, or a group for improving the pharmacodynamic properties of an mRNA, and other substituents having similar properties.
- a sugar substituent group selected from: C 1 to C 10 lower alkyl, substituted lower alkyl, alkeny
- a suitable modification includes 2'-methoxyethoxy (2'-O-CH 2 CH 2 OCH 3 , also known as 2'- O-(2-methoxyethyl) or 2'-MOE) i.e., an alkoxyalkoxy group.
- a further suitable modification includes 2'- dimethylaminooxyethoxy, i.e., a O(CH 2 ) 2 ON(CH 3 ) 2 group, also known as 2'-DMAOE, and 2'- dimethylaminoethoxyethoxy (also known in the art as 2'-O-dimethyl-amino-ethoxy-ethyl or 2'- DMAEOE), i.e., 2'-O-CH 2 -O-CH 2 -N(CH 3 ) 2 .
- a suitable 2'-arabino modification is 2'-F.
- Similar modifications may also be made at other positions on the mRNA, particularly the 3' position of the sugar on the 3' terminal nucleoside or in 2'-5' linked mRNA and the 5' position of 5' terminal nucleotide.
- a guide RNA may also include nucleobase (often referred to in the art simply as “base”) modifications or substitutions.
- nucleobases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U).
- nucleobases include tricyclic pyrimidines such as phenoxazine cytidine(1H-pyrimido(5,4-b)(1,4)benzoxazin-2(3H)-one), phenothiazine cytidine (1H-pyrimido(5,4- b)(1,4)benzothiazin-2(3H)-one), G-clamps such as a substituted phenoxazine cytidine (e.g.9-(2- aminoethoxy)-H-pyrimido(5,4-(b) (1,4)benzoxazin-2(3H)-one), carbazole cytidine (2H-pyrimido(4,5- b)indol-2-one), pyridoindole cytidine (H-pyrido(3',2':4,5)pyrrolo(2,3-d)pyrimidin-2-one).
- tricyclic pyrimidines such as phen
- Heterocyclic base moieties may also include those in which the purine or pyrimidine base is replaced with other heterocycles, for example 7-deaza-adenine, 7-deazaguanosine, 2- aminopyridine and 2-pyridone.
- Additional suitable modified bases include 5-substituted pyrimidines, 6- azapyrimidines and N-2, N-6 and O-6 substituted purines, including 2-aminopropyladenine, 5- propynyluracil and 5-propynylcytosine.5-methylcytosine substitutions are suitable base substitutions, e.g., when combined with 2'-O-methoxyethyl sugar modifications.
- Suitable modified nucleosides that can be incorporated in an mRNA include pseudouridine, 2-thiouridine, 5-methylpyridine, N 1 - methylpseudouridine, and 5-methylcytidine.
- Cleavable linkers [00479] A chimeric molecule of the present disclosure comprises a nucleic acid covalently linked to a TMMP. In some cases, the nucleic acid is linked to the TMMP via a non-cleavable linker. In some cases, the nucleic acid is linked to the TMMP via a cleavable linker.
- Suitable cleavable linkers include acid-labile linkers, peptidase-sensitive linkers (proteolytically cleavable linkers), photolabile linkers, dimethyl linkers, and disulfide-containing linkers.
- the cleavable linker is cleaved by intracellular conditions.
- the cleavable linker is cleaved by lysosomal conditions.
- the cleavable linker is acid labile, e.g., is cleaved by low pH conditions (e.g., in low pH environment of the lysosome or endosome).
- An example of an acid-labile linker is one comprising a bis- sialyl ether.
- a cleavable linker can comprise a cathepsin-labile substrate.
- a cleavable linker include a linker having an -S-S- (disulfide) bond, where the disulfide bond can be cleaved under intracellular reducing environment, where such linkers include a SS linker and a DMSS linker); a linker having a hydrazone bond, where the hydrazone bond can be cleaved by low pH in an endosome; a linker having an ortho ester bond in the structure; and a linker having a peptide bond being cleaved by cathepsin B in the structure (for example, a linker having a valine-citrulline dipeptide (a Val-Cit linker)).
- the linker comprises a valine-citrulline dipeptide (a “Val-Cit” linker). In some cases, the linker comprises a disulfide (S-S) group. In some cases, the linker comprises a dimethyl SS (DMSS) group. [00480] In some cases, the linker is a proteolytically cleavable linker.
- the proteolytically cleavable linker can comprise a matrix metalloproteinase (MMP) cleavage site, e.g., a cleavage site for a MMP selected from collagenase-1, -2, and -3 (MMP-1, -8, and -13), gelatinase A and B (MMP-2 and -9), stromelysin 1, 2, and 3 (MMP-3, -10, and -11), matrilysin (MMP-7), and membrane metalloproteinases (MT1-MMP and MT2-MMP).
- MMP matrix metalloproteinase
- the cleavage sequence of MMP-9 is Pro- X-X-Hy (SEQ ID NO:439; wherein, X represents an arbitrary residue; Hy, a hydrophobic residue), e.g., Pro-X-X-Hy-(Ser/Thr) (SEQ ID NO:440), e.g., Pro-Leu/Gln-Gly-Met-Thr-Ser (SEQ ID NO:441) or Pro- Leu/Gln-Gly-Met-Thr (SEQ ID NO:442).
- protease cleavage site is a plasminogen activator cleavage site, e.g., a uPA or a tissue plasminogen activator (tPA) cleavage site.
- the cleavage site is a furin cleavage site.
- Specific examples of cleavage sequences of uPA and tPA include sequences comprising Val-Gly-Arg.
- protease cleavage site that can be included in a proteolytically cleavable linker is a tobacco etch virus (TEV) protease cleavage site, e.g., ENLYTQS (SEQ ID NO:443), where the protease cleaves between the glutamine and the serine.
- TSV tobacco etch virus
- Another example of a protease cleavage site that can be included in a proteolytically cleavable linker is an enterokinase cleavage site, e.g., DDDDK (SEQ ID NO:444), where cleavage occurs after the lysine residue.
- protease cleavage site that can be included in a proteolytically cleavable linker is a thrombin cleavage site, e.g., LVPR (SEQ ID NO:445).
- Additional suitable linkers comprising protease cleavage sites include linkers comprising one or more of the following amino acid sequences: LEVLFQGP (SEQ ID NO:446), cleaved by PreScission protease (a fusion protein comprising human rhinovirus 3C protease and glutathione-S-transferase; Walker et al.
- a thrombin cleavage site e.g., CGLVPAGSGP (SEQ ID NO:447); SLLKSRMVPNFN (SEQ ID NO:448) or SLLIARRMPNFN (SEQ ID NO:449), cleaved by cathepsin B; SKLVQASASGVN (SEQ ID NO:450) or SSYLKASDAPDN (SEQ ID NO:451), cleaved by an Epstein-Barr virus protease; RPKPQQFFGLMN (SEQ ID NO:452) cleaved by MMP-3 (stromelysin); SLRPLALWRSFN (SEQ ID NO:453) cleaved by MMP-7 (matrilysin); SPQGIAGQRNFN (SEQ ID NO:454) cleaved by MMP-9; DVDERDVRGFASFL SEQ ID NO:455) cleaved by CGLVPAGSGP (SEQ ID NO:447);
- a chimeric molecule of the present disclosure comprises a nucleic acid covalently linked to a TMMP, where the nucleic acid comprises a nucleotide sequence encoding a CAR.
- the nucleic acid is DNA
- the nucleotide sequences encoding the CAR can be operably linked to a transcriptional control element such as a promoter.
- the transcriptional control element e.g., a promoter
- Suitable promoters include constitutive promoters and regulatable (e.g., inducible) promoters.
- a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of an operably linked nucleotide sequence.
- CMV immediate early cytomegalovirus
- EF-1 ⁇ Elongation Growth Factor-1 ⁇
- constitutive promoter sequences may also be used, including, but not limited to, the simian virus 40 (SV40) early promoter, MND (myeloproliferative sarcoma virus) promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, Moloney Murine Leukemia Virus (MoMuLV) promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter.
- SV40 simian virus 40
- MND myeloproliferative sarcoma virus
- MMTV mouse mammary tumor virus
- HSV human immunodeficiency virus
- LTR long terminal repeat
- MoMuLV Molone
- inducible promoters include, but are not limited to, a metallothionine promoter, a glucocorticoid-inducible promoter, a progesterone-inducible promoter, and a tetracycline-inducible promoter.
- the promoter is a CD8 cell-specific promoter, a CD4 cell-specific promoter, a neutrophil-specific promoter, or an NK-specific promoter.
- a CD4 gene promoter can be used; see, e.g., Salmon et al. (1993) Proc. Natl. Acad. Sci. USA 90: 7739; and Marodon et al. (2003) Blood 101:3416.
- a CD8 gene promoter can be used.
- NK cell-specific expression can be achieved by use of an Ncr1 (p46) promoter; see, e.g., Eckelhart et al. (2011) Blood 117:1565. METHOD OF MAKING A CHIMERIC MOLECULE [00484]
- the present disclosure provides a method of making a chimeric molecule of the present disclosure.
- the nucleic acid component of a chimeric molecule of the present disclosure can be covalently linked to one or both polypeptide chains of the TMMP component of the chimeric molecule using any of a variety of attachment chemistries.
- Suitable attachment chemistries include: 1) reaction of acrylamides, alkyl halides, alkyl sulfonates, aziridines, haloacetamides, or maleimides with thiols to form thioether bonds; 2) reaction of acyl halides, acyl nitriles, anhydrides, or carboxylic acids with alcohols or phenols to form an ester bond; 3) reaction of an aldehyde with an amine or aniline to form an imine bond; 4) reaction of an aldehyde or ketone with a hydrazine to form a hydrazone bond; 5) reaction of an aldehyde or ketone with a hydroxylamine to form an oxime bond; 6) reaction of an alkyl halide with an amine or aniline to form an alky
- the nucleic acid can comprise, or can be modified to comprise, a first reactive coupling group; and one or both polypeptide chains of the TMMP can comprise, or can be modified to comprise, a second reactive coupling group.
- the first reactive coupling group is capable of reacting with the second reactive coupling group to form a covalent bond.
- a coupling reagent is used to link the first reactive coupling group with the second reactive coupling group.
- a cross-linking reagent can be used to link the two components (the nucleic acid component and the TMMP component), where one of the two components comprises a first reactive coupling group, and the other component (the other of the two components) comprises a second reactive coupling group.
- One of either the first reactive coupling group or the second reactive coupling group can be a primary amine, where the other reactive coupling group can be an amine-reactive linking group such as isothiocyanates, isocyanates, acyl azides, N-hydroxysuccinimide (NHS) esters, sulfonyl chlorides, aldehydes, glyoxals, epoxides, oxiranes, carbonates, aryl halides, imidoesters, carbodiimides, anhydrides, and fluorophenyl esters.
- amine-reactive linking group such as isothiocyanates, isocyanates, acyl azides, N-hydroxysuccinimide (NHS) esters, sulfonyl chlorides, aldehydes, glyoxals, epoxides, oxiranes, carbonates, aryl halides, imidoesters, carbodiimides, anhydrides,
- the first reactive coupling group can comprise an amine
- the second reactive coupling group can comprise a complimentary reactive group, such an NHS ester
- a coupling reagent such as dicyclohexylcarbodiimide (DCC) or 1-ethyl-3-(3-dimethyl-aminopropyl) carbodiimide (EDC) can be used to covalently link the amine group with the NHS ester.
- DCC dicyclohexylcarbodiimide
- EDC 1-ethyl-3-(3-dimethyl-aminopropyl) carbodiimide
- One of either the first reactive coupling group or the second reactive coupling group can be an aldehyde, where the other reactive coupling group can be an aldehyde reactive linking group such as hydrazides, alkoxyamines, and primary amines.
- One of either the first reactive coupling group or the second reactive coupling group can be a thiol, where the other reactive coupling group can be a sulfhydryl reactive group such as maleimides, haloacetyls, and pyridyl disulfides.
- the heterobifunctional cross-linking reagent succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) can be used to link the two components, where one of the two components comprises a carboxyl group as the first reactive coupling group, and the other component comprises a thiol group (e.g., an SH group) as the second reactive coupling group.
- SMCC succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate
- the cross-linking reagent EDC can be used to link the two components, where one of the two components comprises a free carboxyl (COOH) group as the first reactive coupling group, and the other component comprises an amine group as the second reactive coupling group.
- the cross-linking reagent tris(hydroxymethyl)phosphine (TMP) or ⁇ -[tris(hydroxymethyl)phosphino] propionic acid (THPP) can be used to link the two components, where one of the two components comprises a primary amine group as the first reactive coupling group, and the other component comprises a primary amine group as the second reactive coupling group.
- the two components can be linked to one another using a “click” chemistry.
- a “click” chemistry See, e.g., Kolb et al. (2001) Angewandte Chemie, International Edition 40:2004; Tornoe et al. (2002) J. Org. Chem.67:3057-3064; Rostovtsev et al. (2002) Angew. Chem., Int. Ed.41:2596-2599; Agard et al. (2004) J. Am. Chem. Soc.126:15046-15047; and Jewett et al. (2010) J. Am. Chem. Soc.132:3688-3690.
- one of the two components comprises an alkyne as the first reactive coupling group, and the other of the two component comprises an azide as the second reactive coupling group.
- the alkyne and azide can undergo a "click" reaction to form a covalent bond.
- a composition of the present disclosure can comprise, in addition to a chimeric molecule of the present disclosure, one or more of: a salt, e.g., NaCl, MgCl2, KCl, MgSO4, etc.; a buffering agent, e.g., a Tris buffer, N-(2-Hydroxyethyl)piperazine-N'-(2-ethanesulfonic acid) (HEPES), 2-(N- Morpholino)ethanesulfonic acid (MES), 2-(N-Morpholino)ethanesulfonic acid sodium salt (MES), 3-(N- Morpholino)propanesulfonic acid (MOPS), N-tris[Hydroxymethyl]methyl-3-aminopropanesulfonic acid (TAPS), etc.; a solubilizing agent; a detergent, e.g., a non-ionic detergent such as Tween-20, etc.; a prote
- the composition may comprise a pharmaceutically acceptable excipient, a variety of which are known in the art and need not be discussed in detail herein.
- Pharmaceutically acceptable excipients have been amply described in a variety of publications, including, for example, “Remington: The Science and Practice of Pharmacy”, 19 th Ed. (1995), or latest edition, Mack Publishing Co; A. Gennaro (2000) “Remington: The Science and Practice of Pharmacy", 20th edition, Lippincott, Williams, & Wilkins; Pharmaceutical Dosage Forms and Drug Delivery Systems (1999) H.C. Ansel et al., eds 7 th ed., Lippincott, Williams, & Wilkins; and Handbook of Pharmaceutical Excipients (2000) A.H.
- a pharmaceutical composition can comprise a chimeric molecule of the present disclosure, and a pharmaceutically acceptable excipient.
- a subject pharmaceutical composition will be suitable for administration to a subject, e.g., will be sterile.
- a subject pharmaceutical composition will be suitable for administration to a human subject, e.g., where the composition is sterile and is free of detectable pyrogens and/or other toxins.
- the protein compositions may comprise other components, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate, hydrochloride, sulfate salts, solvates (e.g., mixed ionic salts, water, organics), hydrates (e.g., water), and the like.
- compositions may include aqueous solution, powder form, granules, tablets, pills, suppositories, capsules, suspensions, sprays, and the like.
- the composition may be formulated according to the various routes of administration described below.
- a chimeric molecule of the present disclosure is administered as an injectable (e.g. subcutaneously, intraperitoneally, intramuscularly, and/or intravenously) directly into a tissue
- a formulation can be provided as a ready-to-use dosage form, or as non-aqueous form (e.g. a reconstitutable storage-stable powder) or aqueous form, such as liquid composed of pharmaceutically acceptable carriers and excipients.
- the protein-containing formulations may also be provided so as to enhance serum half-life of the chimeric molecule following administration.
- the chimeric molecule may be provided in a liposome formulation, prepared as a colloid, or other conventional techniques for extending serum half-life.
- a variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al.1980 Ann. Rev. Biophys. Bioeng.9:467, U.S. Pat. Nos.4,235,871, 4,501,728 and 4,837,028.
- the preparations may also be provided in controlled release or slow-release forms.
- formulations suitable for parenteral administration include isotonic sterile injection solutions, anti-oxidants, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
- a subject pharmaceutical composition can be present in a container, e.g., a sterile container, such as a syringe.
- the formulations can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials, and can be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid excipient, for example, water, for injections, immediately prior to use.
- sterile liquid excipient for example, water
- Extemporaneous injection solutions and suspensions can be prepared from sterile powders, granules, and tablets.
- the concentration of a chimeric molecule of the present disclosure in a formulation can vary widely (e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight) and will usually be selected primarily based on fluid volumes, viscosities, and patient-based factors in accordance with the particular mode of administration selected and the patient's needs.
- the present disclosure provides a container comprising a composition of the present disclosure, e.g., a liquid composition.
- the container can be, e.g., a syringe, an ampoule, and the like.
- the container is sterile.
- both the container and the composition are sterile.
- compositions including pharmaceutical compositions, comprising a chimeric molecule of the present disclosure.
- a composition can comprise: a) a TMMP of the present disclosure; and b) an excipient, as described above.
- the excipient is a pharmaceutically acceptable excipient.
- a chimeric molecule of the present disclosure is present in a liquid composition.
- the present disclosure provides compositions (e.g., liquid compositions, including pharmaceutical compositions) comprising a chimeric molecule of the present disclosure.
- a composition of the present disclosure comprises: a) a chimeric molecule of the present disclosure; and b) saline (e.g., 0.9% NaCl).
- the composition is sterile.
- the composition is suitable for administration to a human subject, e.g., where the composition is sterile and is free of detectable pyrogens and/or other toxins.
- the present disclosure provides a composition comprising: a) a chimeric molecule of the present disclosure; and b) saline (e.g., 0.9% NaCl), where the composition is sterile and is free of detectable pyrogens and/or other toxins.
- the present disclosure provides a method of selectively modulating the activity of T cell specific for an epitope (e.g., a T cell specific for a viral antigen or a bacterial antigen).
- the method comprises contacting the T cell with a chimeric molecule of the present disclosure.
- the contacting selectively modulates the activity of the epitope-specific T cell.
- the contacting step is carried out in vitro. In some cases, the contacting step is carried out in vivo.
- the TMMP comprises Class I MHC polypeptides (e.g., ⁇ 2-microglobulin and Class I MHC heavy chain).
- a TMMP in a chimeric molecule of the present disclosure includes an immunomodulatory polypeptide that is an activating polypeptide, contacting the T cell with the chimeric activates the epitope-specific T cell and/or increases the number of the epitope-specific T cells.
- the epitope-specific T cell is a T cell that is specific for viral epitope
- the CAR encoded by the nucleic acid component of the chimeric molecule is specific for a cancer-associated epitope present on a cancer cell
- contacting the viral epitope-specific T cell with the chimeric molecule increases cytotoxic activity of the T cell toward the cancer cell.
- the epitope-specific T cell is a T cell that is specific for viral epitope
- the CAR encoded by the nucleic acid component of the chimeric molecule is specific for a cancer-associated epitope present on a cancer cell
- contacting the viral epitope-specific T cell with the chimeric molecule increases the number of the viral epitope-specific T cells that have cytotoxic activity toward cancer cells that express a cancer-associated antigen recognized by the CAR.
- TREATMENT METHODS [00509]
- the present disclosure provides a method of treating a cancer in an individual. The method comprises administering to an individual having a cancer an effective amount of a chimeric molecule of the present disclosure.
- the patient’s blood can be removed and treated in vitro with chimeric molecules of the present disclosure in order to prepare genetically modified target T cells as described herein that are then introduced into the patient.
- the term “in vitro” is intended to connote any process, system, container, apparatus, equipment, etc. that is outside of the patient, i.e., ex vivo, for making, holding and/or delivering the genetically modified target T cells as described herein.
- the chimeric molecules can be administered to the cancer patient to generate the genetically modified target T cells in vivo in the patient.
- the method comprises administering to an individual having a cancer a composition comprising an effective amount of a chimeric molecule of the present disclosure.
- a pre-treatment regimen comprising the administration of one or more pharmaceutical doses of a T-cell modulatory polypeptide (e.g., a TMMP, as described herein) that binds to and activates substantially only the target T cells in order to increase the population of target T cells in the patient prior to administering the chimeric molecules.
- a T-cell modulatory polypeptide e.g., a TMMP, as described herein
- the dose comprising a TMMP is administered to the individual at a period of time of from 1 day to 1 month (e.g., from 1 day to 4 days, from 4 days to 7 days, from 1 week to 2 weeks, from 2 weeks to 3 weeks, or from 3 weeks to 1 month) before the composition comprising the chimeric molecules is administered.
- multiple doses of the TMMP are administered to the individual before the composition comprising the chimeric molecules is administered to the individual.
- Such a pre-treatment regimen thus can increase the number of target T cells that may be contacted and genetically modified by the chimeric molecules.
- the patient is given a post-treatment regimen comprising the administration of one or more pharmaceutical doses of the T-cell modulatory polypeptide (e.g., a TMMP, as described herein) that binds to and activates substantially only the target T cells in order to increase the population of target T cells and genetically modified target T cells in the patient.
- the T-cell modulatory polypeptide e.g., a TMMP, as described herein
- the dose comprising a TMMP is administered to the individual at a period of time of from 1 day to 1 month (e.g., from 1 day to 4 days, from 4 days to 7 days, from 1 week to 2 weeks, from 2 weeks to 3 weeks, or from 3 weeks to 1 month) after administration of the composition comprising the chimeric molecules.
- multiple doses of the TMMP are administered to the individual after the composition comprising the chimeric molecules is administered to the individual.
- Such a post-treatment regimen thus can increase the number of target T cells and genetically modified target T cells.
- the patient will receive both a pre-treatment regimen and a post-treatment regimen described above. Moreover, the patient may receive multiple doses of the chimeric molecules.
- the chimeric molecules alternatively or additionally can be used to generate genetically modified target T cells in vitro.
- the method comprises a contacting step in which target T cells that have been removed from a patient are contacted in vitro by a chimeric molecule of the present disclosure to generate genetically modified target T cells that can then be introduced to the patient.
- the term “in vitro” is intended to connote any process, system, container, apparatus, equipment, etc. that is outside of the patient, i.e., ex vivo, for making, holding and/or delivering to the patient the genetically modified target T cells.
- blood is drawn from the patient, and a composition comprising target T cells are then contacted with the chimeric molecules to generate the genetically modified target T cells.
- the blood optionally can be treated to at least partially separate target T cells from non-target T cells, i.e., T cells comprising a TCR that is not specific for the peptide epitope, thereby generating an enriched target T cell population.
- the separation step yields a composition that comprises T cells, the majority of which are target T cells.
- the composition comprising target T cells is contacted with the chimeric molecules to generate a composition comprising genetically modified target T cells.
- composition comprising the genetically modified target T cells optionally can be further treated by a separation step to further enrich the population of genetically modified target T cells before an effective amount of the genetically modified target T cells are then administered into the patient.
- a pre-treatment regimen as described above comprising the administration of one or more pharmaceutical doses of a T-cell modulatory polypeptide (e.g., a TMMP, as described herein) that binds to and activates substantially only the target T cells in order to increase the population of target T cells.
- a T-cell modulatory polypeptide e.g., a TMMP, as described herein
- the dose comprising a TMMP is administered to the individual at a period of time of from 1 day to 1 month (e.g., from 1 day to 4 days, from 4 days to 7 days, from 1 week to 2 weeks, from 2 weeks to 3 weeks, or from 3 weeks to 1 month) before the composition comprising the chimeric molecules is administered.
- multiple doses of the TMMP are administered to the individual before the composition comprising the chimeric molecules is administered to the individual.
- Such a pre-treatment regimen thus can increase the number of target T cells that may be contacted and genetically modified by the chimeric molecules.
- blood is drawn from the patient, and a composition comprising target T cells are contacted with the chimeric molecules to generate the genetically modified target T cells.
- the blood can be treated to at least partially separate target T cells from non-target T cells., i.e., T cells comprising a TCR that is not specific for the peptide epitope, thereby generating an enriched target T cell population, and thereafter contacting the composition comprising an enriched population of target T cells with the chimeric molecules to generate the genetically modified target T cells.
- target T cells i.e., T cells comprising a TCR that is not specific for the peptide epitope
- the composition comprising genetically modified target T cells may be further treated by contacting the composition with one or more pharmaceutical doses of a T-cell modulatory polypeptide (e.g., a TMMP, as described herein) that binds to and activates the genetically modified target T cells in order to increase the population of genetically modified target T cells.
- a T-cell modulatory polypeptide e.g., a TMMP, as described herein
- the patient undergoes a post-treatment regimen as described above comprising the administration of one or more pharmaceutical doses of a T-cell modulatory polypeptide (e.g., a TMMP, as described herein) that binds to and activates target T cells, including the genetically modified target T cells, in order to increase the population of target T cells and genetically modified target T cells.
- a T-cell modulatory polypeptide e.g., a TMMP, as described herein
- the dose comprising a TMMP is administered to the individual at a period of time of from 1 day to 1 month (e.g., from 1 day to 4 days, from 4 days to 7 days, from 1 week to 2 weeks, from 2 weeks to 3 weeks, or from 3 weeks to 1 month) after the composition comprising the chimeric molecules is administered.
- multiple doses of the TMMP are administered to the individual after the composition comprising the genetically modified target T cells is administered to the individual.
- Such a post-treatment regimen thus can increase the number of target T cells and modified target T cells.
- the patient will receive both a pre-treatment regimen and a post-treatment regimen described above. Moreover, the patient may receive multiple doses of the genetically modified target T cells.
- Additional doses of the genetically modified target T cells can be given during administration of the post-treatment regimen of TMMPs.
- allogeneic T cells can be used instead of (or in addition to) T cells removed from the patient. If a heterogenous population of allogeneic T cells is employed as a starting material, then an enriched population optionally can be prepared as described above.
- the genetically modified target T cells made from allogeneic T cells thus can contain both a TCR specific for a preselected antigen (including such TCRs expressed as a result of gene-editing), as well as one or more nucleic acids comprising nucleotide sequences encoding a CAR, where the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- the genetically modified target T cells prepared from allogeneic T cells then would be employed for treatment in the same manner as described herein for patient-derived, genetically modified target T cells.
- an “effective amount” of a chimeric molecule, or of the genetically modified target T cells in the case of in vitro generation is an amount that, when administered in one or more doses to an individual in need thereof, leads to a reduction in the number of cancer cells in the individual.
- the amount that is an effective amount may depend on whether the patient is receiving additional treatments in combination with the chimeric molecule or genetically modified target T cells, including a post-treatment regimen with TMMPs as discussed above.
- an “effective amount” of a chimeric molecule or genetically modified target T cell of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, leads to a reductions in the number of cancer cells in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the number of cancer cells in the individual before administration of the chimeric molecule or genetically modified target T cells, or in the absence of administration with the chimeric molecule or genetically modified target T cell.
- an “effective amount” of the chimeric molecule or genetically modified target T cells is an amount that, when administered in one or more doses to an individual in need thereof, leads to a reduction in the number of cancer cells in the individual to undetectable levels.
- an “effective amount” of a chimeric molecule or of the genetically modified target T cells of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, leads to a reduction in the tumor mass in the individual.
- an “effective amount” of a chimeric molecule or of the genetically modified target T cells of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof (an individual having a tumor), leads to a reduction in the tumor mass in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the tumor mass in the individual before administration of the chimeric molecule or genetically modified target T cells, or in the absence of administration with the chimeric molecule or genetically modified target T cells.
- an “effective amount” of a chimeric molecule or of the genetically modified target T cells of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof (an individual having a tumor), leads to a reduction in the tumor volume in the individual.
- an “effective amount” of a chimeric molecule or genetically modified target T cells of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof (an individual having a tumor), leads to a reduction in the tumor volume in the individual by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, compared to the tumor volume in the individual before administration of the chimeric molecule or genetically modified target T cell, or in the absence of administration with the chimeric molecule or genetically modified target T cell.
- an “effective amount” of a chimeric molecule or genetically modified target T cells of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, leads to an increase in survival time of the individual.
- an “effective amount” of a chimeric molecule or the genetically modified target T cells of the present disclosure is an amount that, when administered in one or more doses to an individual in need thereof, increases survival time of the individual by at least 1 month, at least 2 months, at least 3 months, from 3 months to 6 months, from 6 months to 1 year, from 1 year to 2 years, from 2 years to 5 years, from 5 years to 10 years, or more than 10 years, compared to the expected survival time of the individual in the absence of administration with the chimeric molecule or genetically modified target T cells.
- Cancers that can be treated with a method of the present disclosure include any cancer that can be targeted with a CAR. Cancers that can be treated with a method of the present disclosure include carcinomas, sarcomas, melanoma, leukemias, and lymphomas. Cancers that can be treated with a method of the present disclosure include solid tumors. Cancers that can be treated with a method of the present disclosure include metastatic cancers.
- Carcinomas that can treated by a method disclosed herein include, but are not limited to, esophageal carcinoma, hepatocellular carcinoma, basal cell carcinoma (a form of skin cancer), squamous cell carcinoma (various tissues), bladder carcinoma, including transitional cell carcinoma (a malignant neoplasm of the bladder), bronchogenic carcinoma, colon carcinoma, colorectal carcinoma, gastric carcinoma, lung carcinoma, including small cell carcinoma and non-small cell carcinoma of the lung, adrenocortical carcinoma, thyroid carcinoma, pancreatic carcinoma, breast carcinoma, ovarian carcinoma, prostate carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, renal cell carcinoma, ductal carcinoma in situ or bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical carcinoma, uterine carcinoma, testicular carcinoma
- Sarcomas that can be treated by a method disclosed herein include, but are not limited to, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, chordoma, osteogenic sarcoma, osteosarcoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's sarcoma, leiomyosarcoma, rhabdomyosarcoma, and other soft tissue sarcomas.
- Other solid tumors that can be treated by a method disclosed herein include, but are not limited to, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, and retinoblastoma.
- Leukemias that can be amenable to therapy by a method disclosed herein include, but are not limited to, a) chronic myeloproliferative syndromes (neoplastic disorders of multipotential hematopoietic stem cells); b) acute myelogenous leukemias (neoplastic transformation of a multipotential hematopoietic stem cell or a hematopoietic cell of restricted lineage potential; c) chronic lymphocytic leukemias (CLL; clonal proliferation of immunologically immature and functionally incompetent small lymphocytes), including B-cell CLL, T-cell CLL prolymphocytic leukemia, and hairy cell leukemia; and d) acute lymphoblastic leukemias (characterized by accumulation of lymphoblasts).
- CLL chronic lymphocytic leukemias
- Lymphomas that can be treated using a subject method include, but are not limited to, B-cell lymphomas (e.g., Burkitt's lymphoma); Hodgkin's lymphoma; non-Hodgkin's lymphoma, and the like.
- B-cell lymphomas e.g., Burkitt's lymphoma
- Hodgkin's lymphoma e.g., Burkitt's lymphoma
- non-Hodgkin's lymphoma e.g., Hodgkin's lymphoma
- Other cancers that can be treated according to the methods disclosed herein include atypical meningioma, islet cell carcinoma, medullary carcinoma of the thyroid, mesenchymoma, hepatocellular carcinoma, hepatoblastoma, clear cell carcinoma of the kidney, and neurofibroma mediastinum.
- a suitable formulation comprises: a) a chimeric molecule of the present disclosure; and b) a pharmaceutically acceptable excipient. Suitable pharmaceutically acceptable excipients are described above. Dosages [00530] A suitable dosage (e.g., of a TMMP, a chimeric molecule, a genetically modified target T cell) can be determined by an attending physician or other qualified medical personnel, based on various clinical factors.
- a chimeric molecule of the present disclosure may be administered in amounts between 1 ng/kg body weight and 20 mg/kg body weight per dose, e.g. between 0.1 mg/kg body weight and 10 mg/kg body weight, e.g.
- the regimen is a continuous infusion, it can also be in the range of 1 ⁇ g to 10 mg per kilogram of body weight per minute.
- a chimeric molecule of the present disclosure can be administered in an amount of from about 1 mg/kg body weight to 50 mg/kg body weight, e.g., from about 1 mg/kg body weight to about 5 mg/kg body weight, from about 5 mg/kg body weight to about 10 mg/kg body weight, from about 10 mg/kg body weight to about 15 mg/kg body weight, from about 15 mg/kg body weight to about 20 mg/kg body weight, from about 20 mg/kg body weight to about 25 mg/kg body weight, from about 25 mg/kg body weight to about 30 mg/kg body weight, from about 30 mg/kg body weight to about 35 mg/kg body weight, from about 35 mg/kg body weight to about 40 mg/kg body weight, or from about 40 mg/kg body weight to about 50 mg/kg body weight.
- a suitable dose of a chimeric molecule of the present disclosure is from 0.01 ⁇ g to 100 g per kg of body weight, from 0.1 ⁇ g to 10 g per kg of body weight, from 1 ⁇ g to 1 g per kg of body weight, from 10 ⁇ g to 100 mg per kg of body weight, from 100 ⁇ g to 10 mg per kg of body weight, or from 100 ⁇ g to 1 mg per kg of body weight.
- Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the administered agent in bodily fluids or tissues.
- a chimeric molecule of the present disclosure is administered in maintenance doses, ranging from 0.01 ⁇ g to 100 g per kg of body weight, from 0.1 ⁇ g to 10 g per kg of body weight, from 1 ⁇ g to 1 g per kg of body weight, from 10 ⁇ g to 100 mg per kg of body weight, from 100 ⁇ g to 10 mg per kg of body weight, or from 100 ⁇ g to 1 mg per kg of body weight.
- dose levels can vary as a function of the specific chimeric molecule, the severity of the symptoms, and the susceptibility of the subject to side effects.
- a TMMP may be administered in amounts between 1 ng/kg body weight and 20 mg/kg body weight per dose, e.g. between 0.1 mg/kg body weight to 10 mg/kg body weight, e.g. between 0.1 mg/kg body weight and 4 mg/kg body weight, between 0.5 mg/kg body weight and 2 mg/kg body weight, or between 0.5 mg/kg body weight and 5 mg/kg body weight; however, doses below or above this exemplary range are envisioned, especially considering the aforementioned factors.
- a TMMP can be administered in an amount of from about 1 mg/kg body weight to 50 mg/kg body weight, e.g., from about 1 mg/kg body weight to about 5 mg/kg body weight, from about 5 mg/kg body weight to about 10 mg/kg body weight, from about 10 mg/kg body weight to about 15 mg/kg body weight, from about 15 mg/kg body weight to about 20 mg/kg body weight, from about 20 mg/kg body weight to about 25 mg/kg body weight, from about 25 mg/kg body weight to about 30 mg/kg body weight, from about 30 mg/kg body weight to about 35 mg/kg body weight, from about 35 mg/kg body weight to about 40 mg/kg body weight, or from about 40 mg/kg body weight to about 50 mg/kg body weight.
- a suitable dose of a TMMP is from 0.01 ⁇ g to 100 g per kg of body weight, from 0.1 ⁇ g to 10 g per kg of body weight, from 1 ⁇ g to 1 g per kg of body weight, from 10 ⁇ g to 100 mg per kg of body weight, from 100 ⁇ g to 10 mg per kg of body weight, or from 100 ⁇ g to 1 mg per kg of body weight.
- Persons of ordinary skill in the art can easily estimate repetition rates for dosing based on measured residence times and concentrations of the administered agent in bodily fluids or tissues.
- a TMMP is administered in maintenance doses, ranging from 0.01 ⁇ g to 100 g per kg of body weight, from 0.1 ⁇ g to 10 g per kg of body weight, from 1 ⁇ g to 1 g per kg of body weight, from 10 ⁇ g to 100 mg per kg of body weight, from 100 ⁇ g to 10 mg per kg of body weight, or from 100 ⁇ g to 1 mg per kg of body weight.
- dose levels can vary as a function of the specific TMMP, the severity of the symptoms, and the susceptibility of the subject to side effects.
- a suitable dose of genetically modified target T cells is equal to or less than a number selected from the group consisting of 10 cells/kg body weight, 10 2 cells/kg body weight, 10 3 cells/kg body weight, 10 4 cells/kg body weight, 10 5 cells/kg body weight, 10 6 cells/kg body weight, 10 7 cells/kg body weight, 10 8 cells/kg body weight, and 10 9 cells/kg body weight.
- a suitable dose of genetically modified target T cells is from about 10 cells/kg body weight to about 10 2 cells/kg body weight, from about 10 2 cells/kg body weight to about 10 3 cells/kg body weight, from about 10 3 cells/kg body weight to about 10 4 cells/kg body weight, from about 10 4 cells/kg body weight to about 10 5 cells/kg body weight, from about 10 5 cells/kg body weight to about 10 6 cells/kg body weight, from about 10 6 cells/kg body weight to about 10 7 cells/kg body weight, from about 10 7 cells/kg body weight to about 10 8 cells/kg body weight, or from about 10 8 cells/kg body weight to about 10 9 cells/kg body weight.
- lower doses of genetically modified target T cells can be employed, e.g., less than about 10 7 cells/kg body weight, less than about 10 6 cells/kg body weight, less than about 10 5 cells/kg body weight, less than about 10 4 cells/kg body weight or less than about 10 3 cells/kg body weight, where a TMMP post-treatment regimen as described above is employed in order to increase the number of genetically modified target T cells in the patient after administration of the genetically modified target T cells to the patient.
- dose levels can vary as a function of the specific genetically modified target T cells, the severity of the symptoms, and the susceptibility of the subject to side effects.
- Preferred dosages for a given genetically modified target T cell are readily determinable by those of skill in the art by a variety of means.
- Routes of administration An active agent (a chimeric molecule or genetically modified target T cells of the present disclosure; and/or a second therapeutic agent) is administered to an individual using any available method and route suitable for drug delivery, including in vivo and ex vivo methods, as well as systemic and localized routes of administration.
- routes of administration include intratumoral, peritumoral, intramuscular, intralymphatic, intratracheal, intracranial, subcutaneous, intradermal, topical application, intravenous, intraarterial, rectal, nasal, oral, and other enteral and parenteral routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the chimeric molecule and/or the desired effect.
- a chimeric molecule or genetically modified target T cell of the present disclosure can be administered in a single dose or in multiple doses.
- a chimeric molecule or genetically modified target T cell of the present disclosure is administered intravenously.
- a chimeric molecule or genetically modified target T cell of the present disclosure is administered intramuscularly. In some cases, a chimeric molecule or genetically modified target T cell of the present disclosure is administered intralymphatically. In some cases, a chimeric molecule or genetically modified target T cell of the present disclosure is administered locally. In some cases, a chimeric molecule or genetically modified target T cell of the present disclosure is administered intratumorally. In some cases, a chimeric molecule or genetically modified target T cell of the present disclosure is administered peritumorally. In some cases, a chimeric molecule or genetically modified target T cell of the present disclosure is administered intracranially.
- a chimeric molecule or genetically modified target T cell of the present disclosure is administered subcutaneously.
- Parenteral routes of administration other than inhalation administration include, but are not necessarily limited to, topical, transdermal, subcutaneous, intramuscular, intraorbital, intracapsular, intraspinal, intrasternal, intratumoral, intralymphatic, peritumoral, and intravenous routes, i.e., any route of administration other than through the alimentary canal.
- Parenteral administration can be carried to effect systemic or local delivery of a chimeric molecule of the present disclosure. Where systemic delivery is desired, administration typically involves invasive or systemically absorbed topical or mucosal administration of pharmaceutical preparations.
- a method of the present disclosure for treating cancer in an individual comprises: a) administering a chimeric molecule or genetically modified target T cell of the present disclosure; and b) administering at least one additional therapeutic agent or therapeutic treatment.
- additional therapeutic agents include, but are not limited to, a small molecule cancer chemotherapeutic agent, a TMMP as described herein (where the TMMP is not conjugated to a nucleic acid component), and an immune checkpoint inhibitor.
- Suitable additional therapeutic treatments include, e.g., radiation, surgery (e.g., surgical resection of a tumor), and the like.
- a treatment method of the present disclosure can comprise co-administration of a chimeric molecule or genetically modified target T cell of the present disclosure and at least one additional therapeutic agent.
- co-administration is meant that both a chimeric molecule or genetically modified target T cell of the present disclosure and at least one additional therapeutic agent are administered to an individual, although not necessarily at the same time, in order to achieve a therapeutic effect that is the result of having administered both the chimeric molecule or genetically modified target T cell and the at least one additional therapeutic agent.
- the administration of the chimeric molecule or genetically modified target T cell and the at least one additional therapeutic agent can be substantially simultaneous, e.g., the chimeric molecule or genetically modified target T cell can be administered to an individual within about 1 minute to about 24 hours (e.g., within about 1 minute, within about 5 minutes, within about 15 minutes, within about 30 minutes, within about 1 hour, within about 4 hours, within about 8 hours, within about 12 hours, or within about 24 hours) of administration of the at least one additional therapeutic agent.
- a chimeric molecule or genetically modified target T cell of the present disclosure is administered to an individual who is undergoing treatment with, or who has undergone treatment with, the at least one additional therapeutic agent.
- a method of the present disclosure for treating cancer in an individual comprises: a) administering a chimeric molecule or genetically modified target T cell of the present disclosure; and b) administering a TMMP as described herein (where the TMMP is not conjugated to a nucleic acid component; i.e., an unconjugated TMMP).
- the unconjugated TMMP comprises the same peptide epitope as the TMMP present in the chimeric molecule.
- the chimeric molecule or genetically modified target T cell and the unconjugated TMMP are administered at the same time.
- the chimeric molecule or genetically modified target T cell and the TMMP are administered to an individual within about 1 minute to about 24 hours (e.g., within about 1 minute, within about 5 minutes, within about 15 minutes, within about 30 minutes, within about 1 hour, within about 4 hours, within about 8 hours, within about 12 hours, or within about 24 hours) of one another.
- the individual is treated with a TMMP (a TMMP not conjugated to a nucleic acid) before the individual is treated with a chimeric molecule or genetically modified target T cell of the present disclosure.
- a method of the present disclosure comprises: a) administering a TMMP; and b) after a period of time, administering a chimeric molecule of the present disclosure.
- a TMMP is administered from 1 week to 4 weeks (e.g., 1 week, 2 weeks, 3 weeks, or 4 weeks) before the chimeric molecule or genetically modified target T cell of the present disclosure is administered.
- a treatment method of the present disclosure can comprise co- administration of a chimeric molecule or genetically modified target T cell of the present disclosure and an immune checkpoint inhibitor such as an antibody specific for an immune checkpoint.
- co- administration is meant that both a chimeric molecule or genetically modified target T cell of the present disclosure and an antibody specific for an immune checkpoint are administered to an individual, although not necessarily at the same time, in order to achieve a therapeutic effect that is the result of having administered both the chimeric molecule or genetically modified target T cell and the immune checkpoint inhibitor.
- the administration of the chimeric molecule and the antibody specific for an immune checkpoint can be substantially simultaneous, e.g., the chimeric molecule or genetically modified target T cell can be administered to an individual within about 1 minute to about 24 hours (e.g., within about 1 minute, within about 5 minutes, within about 15 minutes, within about 30 minutes, within about 1 hour, within about 4 hours, within about 8 hours, within about 12 hours, or within about 24 hours) of administration of the antibody specific for an immune checkpoint.
- a chimeric molecule of the present disclosure is administered to an individual who is undergoing treatment with, or who has undergone treatment with, an antibody specific for an immune checkpoint.
- immune checkpoint inhibitors include inhibitors that target immune checkpoint polypeptide such as CD27, CD28, CD40, CD122, CD96, CD73, CD47, OX40, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, CD137 (also known as 4-1BB), ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, LAG3, TIM3, VISTA, CD96, TIGIT, CD122, PD-1, PD-L1 and PD- L2.
- target immune checkpoint polypeptide such as CD27, CD28, CD40, CD122, CD96, CD73, CD47, OX40, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, CD137 (also known as 4-1BB), ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA
- the immune checkpoint polypeptide is a stimulatory checkpoint molecule selected from CD27, CD28, CD40, ICOS, OX40, GITR, CD122 and CD137.
- the immune checkpoint polypeptide is an inhibitory checkpoint molecule selected from A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, TIM3, CD96, TIGIT and VISTA.
- the immune checkpoint inhibitor is an antibody specific for an immune checkpoint.
- the anti-immune checkpoint antibody is a monoclonal antibody.
- the anti-immune checkpoint antibody is humanized, or de-immunized such that the antibody does not substantially elicit an immune response in a human.
- the anti-immune checkpoint antibody is a humanized monoclonal antibody.
- the anti-immune checkpoint antibody is a de-immunized monoclonal antibody.
- the anti-immune checkpoint antibody is a fully human monoclonal antibody.
- the anti-immune checkpoint antibody inhibits binding of the immune checkpoint polypeptide to a ligand for the immune checkpoint polypeptide.
- Suitable anti-immune checkpoint antibodies include, but are not limited to, nivolumab (Bristol-Myers Squibb), pembrolizumab (Merck), pidilizumab (Curetech), AMP-224 (GlaxoSmithKline/Amplimmune), MPDL3280A (Roche), MDX-1105 (Medarex, Inc./Bristol Myer Squibb), MEDI-4736 (Medimmune/AstraZeneca), arelumab (Merck Serono), ipilimumab (YERVOY, (Bristol-Myers Squibb), tremelimumab (Pfizer), pidilizumab (CureTech, Ltd.), IMP321 (Immutep S.A.), MGA271 (Macrogenic
- the immune checkpoint inhibitor is an anti-PD-1 antibody.
- Suitable anti-PD-1 antibodies include, e.g., nivolumab, pembrolizumab (also known as MK-3475), pidilizumab, SHR-1210, PDR001, and AMP-224.
- the anti-PD-1 monoclonal antibody is nivolumab, pembrolizumab or PDR001.
- Suitable anti-PD1 antibodies are described in U.S. Patent Publication No.2017/0044259. For pidilizumab, see, e.g., Rosenblatt et al. (2011) J. Immunother.34:409-18.
- the immune checkpoint inhibitor is an anti-CTLA-4 antibody.
- the anti-CTLA-4 antibody is ipilimumab or tremelimumab.
- the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- the anti-PD- L1 monoclonal antibody is BMS-935559, MEDI4736, MPDL3280A (also known as RG7446), KN035, or MSB0010718C.
- the anti-PD-L1 monoclonal antibody is MPDL3280A (atezolizumab) or MEDI4736 (durvalumab).
- durvalumab see, e.g., WO 2011/066389.
- atezolizumab see, e.g., U.S. Patent No.8,217,149.
- Subjects suitable for treatment include individuals who have cancer, including individuals who have been diagnosed as having cancer, individuals who have been treated for cancer but who failed to respond to the treatment, and individuals who have been treated for cancer and who initially responded but subsequently became refractory to the treatment.
- the individual being treated according to a method of the present disclosure has not undergone a lymphodepleting regimen prior to administration of a chimeric molecule or genetically modified target T cell of the present disclosure. In some cases, the individual being treated according to a method of the present disclosure has undergone a lymphodepleting regimen prior to administration of a chimeric molecule or genetically modified target T cell of the present disclosure. In some cases, the lymphodepletion regimen is a non-myeloablative lymphodepletion regimen. Lymphodepletion can be accomplished by administering to the individual: i) cyclophosphamide/fludarabine combination; or ii) cyclophosphamide alone.
- a chimeric molecule comprising: [00554] A) a T-cell modulatory multimeric polypeptide (TMMP) comprising at least one heterodimer comprising: [00555] a) a first polypeptide comprising: [00556] i) a peptide epitope, wherein the peptide epitope is a peptide having a length of at least 4 amino acids; and [00557] ii) a first major histocompatibility complex (MHC) polypeptide; [00558] b) a second polypeptide comprising a second MHC polypeptide; [00559] c) at least one immunomodulatory polypeptide, wherein the first and/or the second polypeptide comprises the at least one immunomodulatory polypeptide; and, optionally, [00560] d) an immunoglobulin (Ig) Fc polypeptide or a non-Ig scaffold, wherein the first and/or the second polypeptide comprises the Ig Fc polypeptid
- nucleic acid component covalently attached to the TMMP, wherein the nucleic acid component comprises one or more nucleic acids comprising nucleotide sequences encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an antigen-binding domain specific for a cancer-associated antigen.
- CAR chimeric antigen receptor
- IgG1 Fc polypeptide comprises one or more amino acid substitutions selected from N297A, L234A, L235A, L234F, L235E, and P331S. [00566] Aspect 5.
- a chimeric molecule of any one of aspects 1-4 wherein [00567] a1) the first polypeptide comprises, in order from N-terminus to C-terminus: [00568] i) the peptide epitope; [00569] ii) the first MHC polypeptide; and [00570] iii) the at least one immunomodulatory polypeptide; and [00571] b1) the second polypeptide comprises, in order from N-terminus to C-terminus: [00572] i) the second MHC polypeptide; [00573] ii) the Ig Fc polypeptide; and [00574] iii) the tumor-targeting polypeptide; or [00575] a2) the first polypeptide comprises, in order from N-terminus to C-terminus: [00576] i) the peptide epitope; and [00577] ii) the first MHC polypeptide; and [00578] b2) the second
- Aspect 6 A chimeric molecule of any one of aspects 1-5, wherein the first polypeptide comprises a peptide linker between the epitope and the first MHC polypeptide and/or wherein the second polypeptide comprises a peptide linker between the immunomodulatory polypeptide and the second MHC polypeptide.
- Aspect 7 A chimeric molecule of aspect 6, wherein the peptide linker comprises the amino acid sequence (GGGGS)n (SEQ ID NO:5), where n is an integer from 1 to 10.
- the at least one immunomodulatory polypeptide is selected from the group consisting of a wild type polypeptide, a variant of a wild type polypeptide, or a fragment of a wild type or variant polypeptide selected from the group consisting of a cytokine, a 4-1BBL poly
- Aspect 11 A chimeric molecule of any one of aspects 1-10, wherein the multimeric polypeptide comprises at least two immunomodulatory polypeptides, and wherein at least two of the immunomodulatory polypeptides are the same.
- Aspect 12. A chimeric molecule of aspect 11, wherein the 2 or more immunomodulatory polypeptides are in tandem.
- Aspect 13 A chimeric molecule of any one of aspects 1-12, wherein the first polypeptide and the second polypeptide are covalently linked to one another. [00677] Aspect 14.
- a chimeric molecule of aspect 14 wherein the ⁇ 2M polypeptide and the MHC heavy chain polypeptide are joined by a disulfide bond that joins a Cys residue in the ⁇ 2M polypeptide and a Cys residue in the MHC heavy chain polypeptide.
- Aspect 16 A chimeric molecule of aspect 15, wherein a Cys at amino acid residue 12 of the ⁇ 2M polypeptide is disulfide bonded to a Cys at amino acid residue 236 of the MHC heavy chain polypeptide.
- Aspect 18 A chimeric molecule of aspect 17, wherein the first polypeptide chain comprises a linker between the peptide epitope and the ⁇ 2M polypeptide, and wherein the disulfide bond links a Cys substituted for Gly2 in the linker with a Cys substituted for Tyr84 of the MHC heavy chain polypeptide.
- Aspect 20 The chimeric molecule of aspect 19, wherein: [00684] a) a first disulfide bond is between: i) a Cys present in a linker between the peptide epitope and the first MHC class I polypeptide, wherein the first MHC class I polypeptide is a ⁇ 2M polypeptide; and ii) a Cys residue introduced via a Y84C substitution in the second MHC class I polypeptide, wherein the second MHC class I polypeptide is an MHC Class I heavy chain polypeptide; and [00685] b) a second disulfide bond is between: i) a Cys residue introduced into the ⁇ 2M polypeptide via an R12C substitution; and ii) a Cys residue introduced into the MHC Class I heavy chain poly
- Aspect 21 A chimeric molecule of aspect 18 or 20, wherein the linker comprises the amino acid sequence GCGGS (SEQ ID NO:373).
- Aspect 22 A chimeric molecule of aspect 21, wherein the linker comprises the amino acid sequence GCGGS(GGGGS)n (SEQ ID NO:206), where n is an integer from 1 to 10.
- Aspect 23 Aspect 23.
- 4 amino acids aa
- Aspect 25 A chimeric molecule of any of aspects 1-24, wherein the first MHC polypeptide is a ⁇ 2M polypeptide, and wherein the second MHC polypeptide comprises an amino acid sequence having at least 95% amino acid sequence identity to an HLA-A*2402 polypeptide.
- Aspect 26 A chimeric molecule of any one of aspects 1-24, wherein the first MHC polypeptide is a ⁇ 2M polypeptide, and wherein the second MHC polypeptide is an HLA-A*1101 polypeptide.
- Aspect 27 Aspect 27.
- Aspect 28. A chimeric molecule of any one of aspects 1-24, wherein the first MHC polypeptide is a ⁇ 2M polypeptide, and wherein the second MHC polypeptide comprises an amino acid sequence having at least 95% amino acid sequence identity to an HLA-A*0201 polypeptide.
- Aspect 30 A chimeric molecule of any one of aspects 1-29, wherein the epitope is a peptide of an antigen encoded by a virus or a bacterium.
- Aspect 31. A chimeric molecule of aspect 30, wherein the epitope is a peptide of a viral antigen.
- CMV cytomegalovirus
- Aspect 33 A chimeric molecule of aspect 32, wherein the CMV polypeptide is a CMV pp65 polypeptide.
- Aspect 34 A chimeric molecule of aspect 33, wherein the peptide has the amino acid sequence NLVPMVATV (SEQ ID NO:172) and has a length of 9 amino acids.
- Aspect 35 Aspect 35.
- Aspect 36 A chimeric molecule of aspect 35, wherein: [00711] a) the TMMP binds to the first T cell with an affinity that is at least 50%, at least 2-fold, at least 5-fold, or at least 10-fold higher than the affinity with which it binds the second T cell; and/or [00712] b) the variant immunomodulatory polypeptide binds the co-immunomodulatory polypeptide with an affinity of from about 10 -4 M to about 10 -7 M, from about 10 -4 M to about 10 -6 M, from about 10 -4 M to about 10 -5 M; and/or [00713] c) wherein the ratio of the binding affinity of a control TMMP, wherein the control comprises a wild-type immunomodulatory polypeptide, to a cognate co-immunomodulatory polypeptide to the binding affinity of the TMMP comprising a variant of the wild-type immunomodulatory polypeptide to the cognate co-immunomodulatory
- Aspect 37 A chimeric molecule of any of aspects 1-36, wherein the CAR comprises: a) an extracellular domain comprising the antigen-binding domain; b) a transmembrane region; and c) a cytoplasmic domain comprising an intracellular signaling domain.
- Aspect 38 A chimeric molecule of aspect 37, wherein the cytoplasmic domain comprises one or more co-stimulatory polypeptides.
- Aspect 39. A chimeric molecule of aspect 37 or aspect 38, wherein the intracellular signaling domain comprises: i) a signaling domain from the zeta chain of human CD3.
- Aspect 40 Aspect 40.
- Aspect 41 A chimeric molecule of any of aspects 37-40, wherein the CAR is a single polypeptide chain CAR.
- Aspect 42 A chimeric molecule of any of aspects 37-40, wherein the CAR comprises at least two polypeptide chains.
- Aspect 43 Aspect 43.
- the cancer-associated antigen is selected from AFP, BCMA, CD10, CD117, CD123, CD133, CD128, CD171, CD19, CD20, CD22, CD30, CD33, CD34,
- Aspect 44 A chimeric molecule of any one of aspects 1-42, wherein the TMMP comprises two heterodimers.
- Aspect 45 A chimeric molecule of aspect 44, wherein both heterodimers comprise an Ig Fc polypeptide, and wherein the heterodimers are covalently bound by one or more disulfide bonds between the Ig Fc polypeptides of the first and second heterodimers.
- Aspect 46 A chimeric molecule of any one of aspects 1-45, wherein the one or more nucleic acids is attached to a thiol moiety present at the C-terminus of the first and/or the second polypeptide.
- Aspect 48. A chimeric molecule of aspect 47, wherein the mRNA comprises one or more of a backbone modification, a modified base, and a modified sugar.
- Aspect 49. A chimeric molecule of any one of aspects 1-46, wherein the nucleotide sequence encoding the CAR is operably linked to a promoter.
- Aspect 50. A chimeric molecule of aspect 49, wherein the promoter is constitutive.
- Aspect 51. A chimeric molecule of aspect 49, wherein the promoter is regulatable. [00729] Aspect 52.
- Aspect 53 A method of aspect 52, wherein the first reactive coupling group comprises an amine moiety and wherein the second reactive coupling group comprises a carboxyl moiety.
- Aspect 58. A method according to aspect 56, wherein the step of contacting is carried out in vivo.
- Aspect 59. A method of treating a patient having a cancer, the method comprising administering to the patient a therapeutically effective amount of a pharmaceutical composition comprising a chimeric molecule according to any one of aspects 1-51.
- Aspect 61. A method of treating a patient having a cancer according to aspect 59 or aspect 60, wherein the patient does not undergo a lymphodepleting regimen prior to the step of administering the chimeric molecule.
- Aspect 62. A method of treating a patient having a cancer according to aspect 59 or aspect 60, wherein the patient does undergo a lymphodepleting regimen prior to the step of administering the chimeric molecule.
- Aspect 63 A method according to any of aspects aspect 59-62, wherein said administering steps are each independently selected from the group consisting of intramuscular, intravenous, peritumoral, or intratumoral.
- Aspect 64 An in vivo method of making genetically modified cytotoxic T cells comprising the step of administering to the patient an effective amount of a pharmaceutical composition comprising a chimeric molecule according to any one of aspects 1-51.
- Aspect 65 A method according to aspect 64, further comprising the step of administering to the patient a composition comprising a TMMP in accordance with any of aspects 1-44, wherein the TMMP has the same epitope as the chimeric molecule.
- Aspect 66 An in vitro method of making a composition comprising a quantity of genetically modified cytotoxic T cells comprising the step of: [00744] (i) obtaining a composition comprising a quantity of T cells, [00745] (ii) increasing the quantity of T cells comprising a T-cell receptor (TCR) specific for a preselected antigen by contacting the T cells with a composition comprising a T-cell modulatory polypeptide that largely binds to and activates only the T cells comprising a T-cell receptor (TCR) specific for a preselected antigen, [00746] (iii) admixing with the quantity of T cells a quantity of chimeric molecules according to any of aspects 1-51 to create a composition comprising a quantity of genetically modified cytotoxic T cells, [00747] wherein the preselected antigen has the same peptide epitope as the chimeric molecules.
- TCR T-cell receptor
- Aspect 67 A method according to aspect 66, wherein the T-cell modulatory polypeptide is a T cell multimeric polypeptide (TMMP) in accordance with any of aspects 1-51.
- Aspect 68 A method according to aspect 66 or aspect 67, wherein prior to step (iii), a separation is performed to at least partially separate the T cells that comprise a T-cell receptor (TCR) specific for a preselected antigen (collectively, “target T cells”) from T cells comprising a T-cell receptor (TCR) that is not specific for the preselected antigen.
- TCR T-cell receptor
- target T cells T cells that is not specific for the preselected antigen.
- a method according to any one of aspects 66-68, wherein after step (iii) is performed, a separation is performed to at least partially separate the quantity of genetically modified cytotoxic T cells for genetically modified cytotoxic T cells that comprise a T-cell receptor (TCR) specific for a preselected antigen (collectively, “genetically modified target T cells”) from genetically modified and unmodified T cells comprising a T-cell receptor (TCR) that is not specific for the preselected antigen.
- TCR T-cell receptor
- TCR T-cell receptor
- TCR T-cell receptor
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Toxicology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Hematology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2020370292A AU2020370292A1 (en) | 2019-10-23 | 2020-10-22 | T-cell modulatory chimeric molecules and methods of use thereof |
| CN202080064663.3A CN114599674A (zh) | 2019-10-23 | 2020-10-22 | T细胞调节嵌合分子及其使用方法 |
| EP20878131.0A EP4048689A4 (en) | 2019-10-23 | 2020-10-22 | T-CELL MODULATING CHIMERIC MOLECULES AND METHOD OF USE THEREOF |
| CA3146917A CA3146917A1 (en) | 2019-10-23 | 2020-10-22 | T-cell modulatory chimeric molecules and methods of use thereof |
| JP2022520769A JP2023500574A (ja) | 2019-10-23 | 2020-10-22 | T細胞調節性キメラ分子及びその使用方法 |
| IL290298A IL290298A (en) | 2019-10-23 | 2022-02-02 | T-cell modulatory chimeric molecules and methods of use thereof |
| US17/678,748 US20230055644A1 (en) | 2019-10-23 | 2022-02-23 | T-cell modulatory chimeric molecules and methods of use thereof |
| US19/327,171 US20260070959A1 (en) | 2019-10-23 | 2025-09-12 | T-Cell Modulatory Chimeric Molecules and Methods of Use Thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962925115P | 2019-10-23 | 2019-10-23 | |
| US62/925,115 | 2019-10-23 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/678,748 Continuation US20230055644A1 (en) | 2019-10-23 | 2022-02-23 | T-cell modulatory chimeric molecules and methods of use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021081239A1 true WO2021081239A1 (en) | 2021-04-29 |
Family
ID=75620861
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/056908 Ceased WO2021081239A1 (en) | 2019-10-23 | 2020-10-22 | T-cell modulatory chimeric molecules and methods of use thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US20230055644A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4048689A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2023500574A (cg-RX-API-DMAC7.html) |
| CN (1) | CN114599674A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020370292A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3146917A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL290298A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021081239A1 (cg-RX-API-DMAC7.html) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3897746A4 (en) * | 2018-12-19 | 2022-10-26 | Cue Biopharma, Inc. | MULTIMERIC T LYMPHOCYTE MODULATING POLYPEPTIDES AND METHODS OF USE THEREOF |
| US11530248B2 (en) | 2016-12-22 | 2022-12-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| WO2023205711A1 (en) * | 2022-04-20 | 2023-10-26 | Replay Holdings, Inc. | Methods and compositions for cellular therapy |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12006348B2 (en) | 2017-09-07 | 2024-06-11 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| EP4504802A4 (en) * | 2022-04-07 | 2026-03-25 | Cue Biopharma Inc | IMMUNE CELL BINDING POLYPEPTIDES |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017201210A1 (en) * | 2016-05-18 | 2017-11-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090123467A1 (en) * | 2007-07-31 | 2009-05-14 | The Johns Hopkins University | Polypeptide-Nucleic Acid Conjugate for Immunoprophylaxis or Immunotherapy for Neoplastic or Infectious Disorders |
| US20170335281A1 (en) * | 2014-03-15 | 2017-11-23 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
| WO2019051127A1 (en) * | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015195531A2 (en) * | 2014-06-18 | 2015-12-23 | Albert Einstein College Of Medicine, Inc. | Syntac polypeptides and uses thereof |
| ES2973548T3 (es) * | 2016-12-22 | 2024-06-20 | Cue Biopharma Inc | Polipéptidos multiméricos moduladores de linfocitos T y métodos para su uso |
| US20200010528A1 (en) * | 2017-03-15 | 2020-01-09 | Cue Biopharma, Inc. | Methods for modulating an immune response |
-
2020
- 2020-10-22 CA CA3146917A patent/CA3146917A1/en active Pending
- 2020-10-22 WO PCT/US2020/056908 patent/WO2021081239A1/en not_active Ceased
- 2020-10-22 EP EP20878131.0A patent/EP4048689A4/en not_active Withdrawn
- 2020-10-22 CN CN202080064663.3A patent/CN114599674A/zh not_active Withdrawn
- 2020-10-22 JP JP2022520769A patent/JP2023500574A/ja active Pending
- 2020-10-22 AU AU2020370292A patent/AU2020370292A1/en active Pending
-
2022
- 2022-02-02 IL IL290298A patent/IL290298A/en unknown
- 2022-02-23 US US17/678,748 patent/US20230055644A1/en not_active Abandoned
-
2025
- 2025-09-12 US US19/327,171 patent/US20260070959A1/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090123467A1 (en) * | 2007-07-31 | 2009-05-14 | The Johns Hopkins University | Polypeptide-Nucleic Acid Conjugate for Immunoprophylaxis or Immunotherapy for Neoplastic or Infectious Disorders |
| US20170335281A1 (en) * | 2014-03-15 | 2017-11-23 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
| WO2019051127A1 (en) * | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | MULTIMER MODULATOR POLYPEPTIDE OF LYMPHOCYTE T HAVING CONJUGATION SITES AND METHODS OF USE THEREOF |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4048689A4 * |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12180258B2 (en) | 2016-12-22 | 2024-12-31 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12145973B2 (en) | 2016-12-22 | 2024-11-19 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12421287B2 (en) | 2016-12-22 | 2025-09-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11739133B2 (en) | 2016-12-22 | 2023-08-29 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12152061B2 (en) | 2016-12-22 | 2024-11-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11905320B2 (en) | 2016-12-22 | 2024-02-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11987610B2 (en) | 2016-12-22 | 2024-05-21 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11530248B2 (en) | 2016-12-22 | 2022-12-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11993641B2 (en) | 2017-03-15 | 2024-05-28 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US12006348B2 (en) | 2017-09-07 | 2024-06-11 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptide with conjugation sites and methods of use thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| EP3897746A4 (en) * | 2018-12-19 | 2022-10-26 | Cue Biopharma, Inc. | MULTIMERIC T LYMPHOCYTE MODULATING POLYPEPTIDES AND METHODS OF USE THEREOF |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12257311B2 (en) | 2020-05-12 | 2025-03-25 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485184B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485183B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| EP4504802A4 (en) * | 2022-04-07 | 2026-03-25 | Cue Biopharma Inc | IMMUNE CELL BINDING POLYPEPTIDES |
| WO2023205711A1 (en) * | 2022-04-20 | 2023-10-26 | Replay Holdings, Inc. | Methods and compositions for cellular therapy |
Also Published As
| Publication number | Publication date |
|---|---|
| CN114599674A (zh) | 2022-06-07 |
| EP4048689A4 (en) | 2023-11-01 |
| US20230055644A1 (en) | 2023-02-23 |
| JP2023500574A (ja) | 2023-01-10 |
| IL290298A (en) | 2022-04-01 |
| US20260070959A1 (en) | 2026-03-12 |
| CA3146917A1 (en) | 2021-04-29 |
| EP4048689A1 (en) | 2022-08-31 |
| AU2020370292A1 (en) | 2022-03-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20260070959A1 (en) | T-Cell Modulatory Chimeric Molecules and Methods of Use Thereof | |
| US11993641B2 (en) | Methods for modulating an immune response | |
| CN114126635A (zh) | 多聚体t细胞调节多肽及其使用方法 | |
| US20220017597A1 (en) | Multimeric t-cell modulatory polypeptides and methods of use thereof | |
| US20260053855A1 (en) | Modified Cytotoxic T Cells and Methods of Use Thereof | |
| US20240034770A1 (en) | T-cell modulatory multimeric polypeptides and methods of use thereof | |
| JP2025515473A (ja) | 改変された細胞傷害性t細胞およびその使用方法 | |
| HK40020576B (en) | Combination of multimeric fusion polypeptides and immune checkpoint inhibitor for treating hpv-associated cancer | |
| HK40020576A (en) | Combination of multimeric fusion polypeptides and immune checkpoint inhibitor for treating hpv-associated cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20878131 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3146917 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020370292 Country of ref document: AU Date of ref document: 20201022 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022520769 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020878131 Country of ref document: EP Effective date: 20220523 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2020878131 Country of ref document: EP |