WO2021051130A1 - Combination therapy for the treatment of migraines - Google Patents

Combination therapy for the treatment of migraines Download PDF

Info

Publication number
WO2021051130A1
WO2021051130A1 PCT/US2020/070511 US2020070511W WO2021051130A1 WO 2021051130 A1 WO2021051130 A1 WO 2021051130A1 US 2020070511 W US2020070511 W US 2020070511W WO 2021051130 A1 WO2021051130 A1 WO 2021051130A1
Authority
WO
WIPO (PCT)
Prior art keywords
cgrp
migraine
antibody
patient
igf
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/070511
Other languages
English (en)
French (fr)
Inventor
Richard KRAIG
Lisa Won
Kae PUSIC
Aya PUSIC
Martin Sanders
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Seurat Therapeutics
University of Chicago
Original Assignee
Seurat Therapeutics
University of Chicago
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Seurat Therapeutics, University of Chicago filed Critical Seurat Therapeutics
Priority to EP20862880.0A priority Critical patent/EP4027984A4/en
Priority to AU2020346186A priority patent/AU2020346186A1/en
Priority to JP2022515624A priority patent/JP2022547948A/ja
Priority to CA3153776A priority patent/CA3153776A1/en
Publication of WO2021051130A1 publication Critical patent/WO2021051130A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/30Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4523Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
    • A61K31/4545Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring hetero atom, e.g. pipamperone, anabasine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2073IL-11
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/21Interferons [IFN]
    • A61K38/217IFN-gamma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/28Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0043Nose
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/04Centrally acting analgesics, e.g. opioids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/06Antimigraine agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies

Definitions

  • the present invention relates generally to medicine and neurology.
  • embodiments are directed to the treatment of migraine and related neurological disorders.
  • Migraine headache is a complex, recurrent disorder that is one of the most common complaints in medicine. In the United States, more than 30 million people have one or more migraine headaches per year. Approximately 75% of all persons who experience migraines are women.
  • Migraine was previously considered a vascular phenomenon that resulted from intracranial vasoconstriction followed by rebound vasodilation.
  • the neurovascular theory describes migraine as primarily a neurogenic process with secondary changes in cerebral perfusion.
  • the neurovascular theory holds that a complex series of neural and vascular events initiates migraine.
  • CSD cortical spreading depression
  • Migraine treatment involves acute (abortive) and preventive (prophylactic) therapy. Patients with frequent attacks may require both. Acute treatments are intended to stop or prevent the progression of a headache or reverse a headache that has started. Preventive treatment, which is given even in the absence of a headache, is intended to reduce the frequency and severity of the migraine attack, make acute attacks more responsive to abortive therapy, and perhaps also improve the patient's quality of life.
  • New CGRP antibodies represent an additional therapeutic approach to treating migraines. However, these therapies are not effective in every patient. The differential impact on activation of mechanosensitive primary afferent meningeal nociceptors may begin to explain why CGRP antibodies are not effective in all patients.
  • aspects of the disclosure relate to a method for treating a migraine, post- traumatic headache, or chronic pain syndrome patient, the method comprising administering to the patient an effective amount of an insulin growth factor receptor (IGFR) activator and a calcitonin gene-related peptide (CGRP) inhibitor. Further aspects relate to a composition comprising insulin-like growth factor- 1 (IGF-1) and a CGRP inhibitor.
  • IGFR insulin growth factor receptor
  • CGRP calcitonin gene-related peptide
  • spreading depression is further defined as spreading depression related demyelination.
  • the spreading depression related demyelination comprises spreading depression demyelination occurring or associated with multiple sclerosis, Parkinson's disease, Alzheimer's disease, acute or chronic post-traumatic brain injury, Amyotrophic Lateral Sclerosis, Huntington's disease, depression, schizophrenia, radiation- induced encephalitis, or oxygen-deprivation-induced encephalitis.
  • ischemic stroke toxin-induced encephalopathy, infectious agent-induced encephalopathy, or acute cerebral edema
  • methods for treating ischemic stroke, toxin-induced encephalopathy, infectious agent-induced encephalopathy, or acute cerebral edema comprising administering to the patient an effective amount of an insulin growth factor receptor (IGFR) activator and a calcitonin gene-related peptide (CGRP) inhibitor.
  • IGFR insulin growth factor receptor
  • CGRP calcitonin gene-related peptide
  • spreading depression is further defined as spreading depression related demyelination.
  • treating a patient comprises treating or inhibiting spreading depression in the patient.
  • FIG. 1 Further aspects relate to a method for treating a chronic pain syndrome patient, the method comprising administering to the patient an effective amount of an insulin growth factor receptor (IGFR) activator; wherein the chronic pain syndrome comprises fibromyalgia or chronic fatigue syndrome.
  • IGFR insulin growth factor receptor
  • the CGRP inhibitor comprises a CGRP antibody, a CGRP receptor antibody, an antigen binding fragment from a CGRP antibody or CGRP receptor antibody, a CGRP inhibitory fusion protein, a CGRP bioneutralizing agent, a CGRP receptor antagonists, a small molecule inhibitor, or a polypeptide inhibitor.
  • the antibody fragment comprises an scFv, a diabody, or a single domain antibody.
  • the antibody fragment comprises an antibody fragment described herein.
  • the antibody comprises a monoclonal antibody, a humanized antibody, a bivalent antibody, or a chimeric antibody. In some embodiments, the antibody is further defined according to antibody embodiments described herein.
  • the migraine is further defined as chronic, acute, episodic, vestibular, ocular, complex, menstrual, acephalgic, hormonal, stress, cluster, or vascular.
  • the migraine is defined as chronic.
  • the migraine is defined as acute.
  • the migraine is defined as episodic.
  • the migraine is defined as cluster or as a cluster headache.
  • the migraine is further defined as high frequency migraine.
  • the term “acute migraine” is defined as a single attack and is typically used when discussing “acute” treatment for a migraine. “Acute” treatments are abortives to stop a given attack; “prophylactic medications” are used to reduce tendency for next attack (i.e., in high frequency or chronic migraine patients). Accordingly, in embodiments of the disclosure, the compositions of the disclosure may be further defined as prophylactic medications. In some embodiments the compositions of the disclosure may be further defined as an acute treatment.
  • the term “episodic migraine” refers to a migraine in a patient that experiences, has experienced, or experiences on average 0-14 headache days per month. Chronic migraine is defined as a migraine in a patient that experiences, has experienced, or experiences on average 15 headache days or more per month.
  • high frequency migraine refers to a migraine or headache in a patient that experiences, has experienced, or experiences on average 4-14 headaches a month.
  • the patient is suffering from symptoms of a migraine. In some embodiments, the patient is suffering from acute migraine. In some embodiments, the patient is suffering from episodic migraine. In some embodiments, the patient is suffering from frequent migraine. In some embodiments, the patient is suffering from chronic migraine. [0015] In some embodiments, the chronic pain syndrome comprises neurological pain, musculoskeletal pain, gastrointestinal pain, fibromyalgia, chronic fatigue syndrome, or heightened pain response.
  • the IGFR activator comprises IGF-1 or insulin. In some embodiments, the IGFR activator comprises IGF-1. In some embodiments, the IGFR activator comprises a polypeptide of any one of SEQ ID NOS: 1-5. In some embodiments, the IGFR activator comprises a polypeptide of SEQ ID NO: 1 or a polypeptide with at least 80% identity to SEQ ID NO:l. In some embodiments, the IGFR activator comprises a polypeptide of SEQ ID NO:2 or a polypeptide with at least 80% identity to SEQ ID NO:2.
  • the IGFR activator comprises a polypeptide of SEQ ID NO:3 or a polypeptide with at least 80% identity to SEQ ID NO:3. In some embodiments, the IGFR activator comprises a polypeptide of SEQ ID NO:4 or a polypeptide with at least 80% identity to SEQ ID NO:4. In some embodiments, the IGFR activator comprises a polypeptide of SEQ ID NO:5 or a polypeptide with at least 80% identity to SEQ ID NO: 5. In some embodiments, the IGFR activator comprises mecasermin.
  • the IGFR activator comprises a polypeptide with at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to one of SEQ ID NOS: 1-5.
  • the CGRP inhibitor comprises a CGRP antibody or a CGRP receptor antibody.
  • the CGRP or CGRP receptor antibody comprises an inhibitory antibody.
  • the patient is administered an effective amount of an insulin growth factor receptor (IGFR) activator and a CGRP or CGRP receptor antibody antigen binding fragment comprising one or both of a heavy chain variable region and a light chain variable region from a CGRP or CGRP receptor antibody.
  • IGFR insulin growth factor receptor
  • the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3 from the heavy chain variable region of a CGRP or CGRP receptor antibody and/or wherein the light chain variable region comprises LCDR1, LCDR2, and LCDR3 from the light chain variable region of a CGRP or CGRP receptor antibody.
  • the heavy chain variable region and/or light chain variable region comprises the heavy chain variable region and/or light chain variable region of a CGRP or CGRP receptor antibody.
  • the antibody or antigen binding fragment comprises fremanezumab, erenumab, galcanezumab, eptinezumab, or an antigen binding fragment thereof.
  • the antibody comprises fremanezumab.
  • the antibody comprises an antigen binding fragment from fremanezumab.
  • the CGRP inhibitor comprises a small molecule.
  • the small molecule comprises a gepant.
  • the inhibitor comprises one or more of atogepant, BI 44370, MK-3207, BMS-927711, olcegepant, rimegepant, telcagepant, and ubrogepant.
  • the small molecule comprises ubrogepant, rimegepant, atogepant, or combinations thereof.
  • the IGFR activator and/or the CGRP inhibitor are administered parenterally, orally, and/or topically. In some embodiments, the IGFR activator and the CGRP inhibitor are in the same composition. In some embodiments, the IGFR activator and the CGRP inhibitor are in different compositions. In some embodiments, the method further comprises administering a second IGFR activator, and optionally wherein the second IGFR activator comprises insulin. In some embodiments, the composition comprises a second IGFR activator, and optionally wherein the second IGFR activator comprises insulin. In some embodiments, one or both of the IGFR activator and the CGRP inhibitor is administered to the patient intranasally. In some embodiments, the CGRP inhibitor is administered subcutaneously. In some embodiments, the IGFR activator is administered intranasally and the CGRP inhibitor is administered subcutaneously. In some embodiments, the CGRP inhibitor is administered parenterally.
  • about 0.1 ng to about 2.0 g of IGFR activator is administered to the patient.
  • about 0.1 ng to about 2.0 g of a CGRP inhibitor is administered to the patient.
  • the CGRP inhibitor comprises Eptinezumab and is administered at a dose of 100 mg, 300 mg, or 100-300 mg. In some embodiments, a dose of Eptinezumab is administered every three months. In some embodiments, the CGRP inhibitor comprises Erenumab and is administered at a dose of 70 mg, 140 mg, or 70-140 mg. In some embodiments, a dose of Erenumab is administered every month. In some embodiments, the CGRP inhibitor comprises Fremanezumab and is administered at a dose of 225 mg, 675 mg, or 225-675 mg. In some embodiments, a dose of Fremanezumab is administered every month or every three months.
  • an initial dose of 675 mg of Fremanezumab is administered as an initial dose and followed by 225 mg administration as monthly doses or every 3 months.
  • the CGRP inhibitor comprises Galcanezumab and is administered at a dose of 120 mg, 240 mg, or 120-240 mg.
  • a dose of Galcanezumab is administered every month. It is also contemplated that the dose of the CGRP inhibitor, such as a dose administered herein may be reduced by at least 5, 6, 7, 8, 9, 10, 11,
  • the patient is administered up to about 10 ml of a composition comprising the IGFR activator and/or CGRP inhibitor per dose. In some embodiments, the patient is administered up to about, at least about, or about 0.1, 0.2, 0.3, 0.4,
  • the method further comprises administering the IGFR activator and/or administering the CGRP inhibitor to the patient up to four times a day.
  • the IGFR activator is administered 1-2 times per week for a period of at least 1 week.
  • the period comprises at least, at most, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42,
  • the IGFR activator is administered at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, or 8 times, or any derivable range therein, to the patient daily or at least, at most, or exactly 1,
  • the IGFR activator is administered at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 times, or any derivable range therein, to the patient in one week, or per week.
  • the IGFR activator is administered at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7,
  • the IGFR activator is administered to the patient on a weekly, daily, or monthly basis for at least 1, 2, 3, 4, 5, 6, or 7 days or 1, 2, 3, or 4 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months (or any derivable range therein).
  • the CGPR inhibitor is administered at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, or 8 times, or any derivable range therein, to the patient daily or at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 times, or any derivable range therein, to the patient in one week, or per week.
  • the CGPR inhibitor is administered at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 times, or any derivable range therein, to the patient in one month, or per month.
  • the CGPR inhibitor is administered to the patient on a weekly, daily, or monthly basis for at least 1, 2, 3, 4, 5, 6, or 7 days or 1, 2, 3, or 4 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months (or any derivable range therein).
  • the IGFR activator is administered at least every, at most every, or about every 2, 4, 6, 8, or 12 hours (or any derivable range therein).
  • the CGPR inhibitor is administered at least every, at most every, or about every 2, 4, 6, 8, or 12 hours (or any derivable range therein).
  • the IGFR activator is administered at least, at most, or about 1, 2, 3, 4, 8, 12, 18, or 24 hours, or 1, 2, 3, 4, 5, 6, 7 days (or any derivable range therein) before the CGPR inhibitor. In some embodiments, the CGPR inhibitor is administered at least, at most, or about 1, 2, 3, 4, 8, 12,
  • the patient is administered one or both of the IGFR activator and the CGRP inhibitor daily, weekly, monthly, quarterly, or yearly.
  • the method further comprises administering to the patient IL-11 and/or interferon g.
  • the composition further comprises IL-11 and/or interferon g.
  • the method alters the patient’s central nervous system.
  • the composition alters the patient’s central nervous system.
  • the patient has experienced one or more migraines in a 4 week period or in a month.
  • the patient has experience more than, less than, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 migraines (or any derivable range therein) in a period of at least, at most, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks (or any derivable range therein) or at least, at most, or about 1 or 2 months or at least, at most, or about 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • the patient has experienced at least one migraine lasting for at least 3 hours in the previous 24 hours prior to administration. In some embodiments, the patient has experienced at least or at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 migraine(s) lasting for at least 0.5, 1, 2, 3, 4, 5, or 6 hours (or any derivable range therein) in the previous 0.5, 1, 2, 3, 4, 5, 6, or 7 days (or any derivable range therein) prior to administration. In some embodiments, the patient is one that, on average, experiences 14 or fewer migraines within a month. In some embodiments, the patient is one that experiences or has experienced 14 or fewer migraines within a month.
  • the patient is a human patient that is 18 years or older. In some embodiments, the patient is a pediatric patient of less than 18 years. In some embodiments, the patient is younger than 50. In some embodiments, the patient is older than 50. In some embodiments, the patient is at least, at most, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 45, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60,
  • the patient is a human patient.
  • the patient is dog, cat, mouse, rat, horse, pig, or rabbit.
  • the migraine is further defined as a migraine with aura.
  • the patient is further defined as one that has one or more symptoms comprising visual disruptions, numbness, dizziness, speech disruptions, ataxia, dysarthria, vertigo, tinnitus, hypacusis, diplopia, decreased consciousness, allodynia, and unilateral visual disruptions.
  • the symptom is further being defined as on one aspect of the head or neck.
  • the aura or symptom begins before the headache begins.
  • the aura or symptom begins at least or at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 hours (or any derivable range therein) before the headache begins.
  • the patient has not had or has not been diagnosed with ischemia.
  • the migraine is further defined as a migraine without aura.
  • the patient is also administered an anti-migraine drug.
  • the composition further comprises an anti-migraine drug.
  • the anti -migraine drug comprises a 5-HT1F (ditan) receptor agonist.
  • the anti-migraine drug comprises one or more of alniditan, lasmiditan (COL- 144), and LY-334370.
  • the anti-migraine drug is in the same composition as the IGFR activator.
  • the anti-migraine drug is in the same composition as the CGPR inhibitor.
  • the anti-migraine drug comprises acetaminophen or ibuprofen.
  • the patient is administered the anti-migraine drug within 24 hours of being administered the composition.
  • the method further comprises administering an additional agent.
  • the composition comprises an additional agent.
  • the additional agent either activates or inhibits pituitary adenylate cyclase activating peptide (PACAP), vasoactive intestinal peptide (VIP), PACAP/VIP receptors (PAC1, VPAC1 and VPAC2).
  • PACAP pituitary adenylate cyclase activating peptide
  • VIP vasoactive intestinal peptide
  • PACAP/VIP receptors PAC1, VPAC1 and VPAC2
  • the additional agent comprises one or more of an inhibitor of PACAP, VIP, PACAP receptor, and VIP receptor.
  • the additional agent either activates or inhibits transient receptor potential (TRP) channels.
  • the additional agent comprises one or more of an inhibitor of TRP and TRP receptor.
  • the IGFR activator, CGRP inhibitor, anti migraine drug, and/or additional agent are co-administered and/or are in the same composition.
  • the additional agent comprises a polypeptide, nucleic acid, or small molecule.
  • treating comprises reducing brain hyperexcitability, reducing spreading depression, and/or reducing oxidative stress.
  • treating comprises reducing oxidative stress in the trigeminal system.
  • the spreading depression may further be defined as cortical spreading depression.
  • compositions of the disclosure are formulated for intranasal, parenteral, oral, subcutaneous, intravenous, and/or topical administration. In some embodiments, the compositions of the disclosure are formulated for a route of administration described herein.
  • compositions or methods of the disclosure exclude an additional anti-migraine therapy or an additional therapy.
  • the compositions and methods exclude a EPO.
  • the compositions and methods exclude agents in addition to the therapeutic agents in recited in the claims.
  • compositions and methods of the disclosure may exclude one or more of a cytokine, growth factor, inhibitor, antigen binding fragment from an antibody, or analgesic. This exclusion applies in addition to the elements and therapeutic agents recited in the claims.
  • the claims may recite administration of an antibody in the method of the disclosure but may exclude the administration of an additional antibody that is not recited in the method of the disclosure.
  • x, y, and/or z can refer to “x” alone, “y” alone, “z” alone, “x, y, and z,” “(x and y) or z,” “x or (y and z),” or “x or y or z.” It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment.
  • compositions and methods for their use can “comprise,” “consist essentially of,” or “consist of’ any of the ingredients or steps disclosed throughout the specification.
  • any limitation discussed with respect to one embodiment of the invention may apply to any other embodiment of the invention.
  • any composition of the invention may be used in any method of the invention, and any method of the invention may be used to produce or to utilize any composition of the invention.
  • Aspects of an embodiment set forth in the Examples are also embodiments that may be implemented in the context of embodiments discussed elsewhere in a different Example or elsewhere in the application, such as in the Summary of Invention, Detailed Description of the Embodiments, Claims, and description of Figure Legends.
  • FIGs. 1A-B Nasal IGF-1 significantly reduced level of CGRP in the trigeminal ganglion (TG).
  • FIG. 2 Schematic of IGF-1 results from in vitro and in vivo studies.
  • Initial studies done using hippocampal brain slice cultures show that IGF-1 inhibits spreading depression (SD) by abrogating microglial activation and release of TNFa and reactive oxygen species (ROS). It has been shown that SD in vivo leads to trigeminal system activation which is known to increase levels of CGRP.
  • Nasal delivery of IGF-1 reduces trigeminal ganglion CGRP expression and therefore it is likely that it will also reduce SD induced CGRP there, and by extension migraine.
  • FIG. 3 Nose to brain IGF-1 did not cause hypoglycemia.
  • Dotted lines show normal glucose range. While the glucose level that defines hypoglycemia is variable, a drop of 1 mM is not considered hypoglycemic. Furthermore, no IGF-l-glucose level was hypoglycemic. Results shown as mean ⁇ SD.
  • FIG. 4 Representative spreading depression (SD) responses from KC1 stimulation. Records show typical large extracellular voltage deflections of SD. Nose to brain administration of IGF-1 (or vehicle) was delivered. Twenty-four hours later, SD was induced every 10 minutes for 90 minutes via pressurized episodic micro-injections of nL quantities of 0.5 M KC1 into the rostral neocortex with confirmation of SD established via electrophysiological microelectrode recordings from caudal neocortex. Representative SD slow electrical changes are shown. 10 mV scale bar is negative down. Immediately after SD stimulation, tissues were harvested for determination of the degree of trigeminal system activation in the trigeminal ganglion and caudal trigeminal nucleus.
  • FIG. 6 Nose to brain (N2B) treatment with IGF-1 did not cause hypoglycemia. Serum glucose was measured in non-fasted rats under brief isoflurane anesthesia after N2B delivery of vehicle (black) or IGF-1 (red) compared to immediately before treatments (light gray). As expected, glucose rose at the conclusion of N2B treatments due to continued isoflurane exposure. However, no significant differences were seen between treatment pairs (/- test) or 0 time (light gray) versus other values when compared via ANOVA plus post hoc Holm- Sidak except at the 0.3 hour point (***/> ⁇ 0.001).
  • IGF-1 glucose-related level seen was 114 mg/dL [compared to control (132 mg/dL; time 0)], which is within the normal range for Wistar rats [85-132 mg/dL]
  • Dotted lines show normal glucose range. While the glucose level that defines hypoglycemia is variable, a drop of 1 mM is not considered hypoglycemic. Furthermore, no IGF-1 glucose level was hypoglycemic. Results shown as mean ⁇ SEM. [0052] FIGs. 7A-B. Nose-to-brain (N2B) delivery of IGF-1 significantly reduced CGRP levels in the trigeminal ganglion of naive animals.
  • FIGs. 8A-B Nose-to-brain (N2B) delivery of IGF-1 significantly reduced oxidative stress in the trigeminal ganglion after recurrent spreading depression.
  • Representative images show malondialdehyde immunostaining of the VI area of the trigeminal ganglion after pre-treatment with (A) IGF-1 or (B) vehicle which was followed a day later by 90 minutes of recurrent spreading depression.
  • FIGs. 10A-C Nose-to-brain (N2B) delivery of IGF-1 significantly reduced CGRP levels in the trigeminal ganglion after recurrent spreading depression. Representative images show CGRP immunostaining of the VI area of the trigeminal ganglion after pre-treatment with (A) IGF-1 or (B) vehicle which was followed a day later by 90 minutes of
  • Representative images show c-fos immunostaining at -4.5 mm caudal to the obex within (red area of interest) laminae I and II of the caudal trigeminal nucleus after pre-treatment with (A) IGF-1 or (B) succinate buffer which was followed a day later by 90 minutes of recurrent spreading depression.
  • FIGs. 11A-B Summary nasal IGF-1 data and its relation to the impact of anti- CGRPs for migraine modeled in rats.
  • A Work using rat hippocampal brain slice cultures, showed that IGF-1 significantly inhibited spreading depression, a model of migraine, by selectively reducing microglial tumor necrosis factor alpha (TNF-a) production and reactive oxygen specifies (ROS), factors that otherwise promote spreading depression (Grinberg et al., 2017).
  • TNF-a microglial tumor necrosis factor alpha
  • ROS reactive oxygen specifies
  • FIGs. 12A-D Paradigm for study of the impact of intranasal delivery of human recombinant IGF-1 on trigeminal system activation after spreading depression (SD).
  • IGF- 1 150 pg/50pL [or vehicle (sham)] was administered to rats over 20 minutes in a recumbent position while under inhalational isoflurane anesthesia.
  • B 24 hours later, SD was induced every 9-10 minutes for 90 minutes via pressurized episodic micro-injections of nL amounts of 0.5 M KC1 into rostral neocortex with confirmation of SD established via electrophysiological microelectrode recordings from caudal neocortex. Representative SDs are shown.
  • tissues were harvested for immunostaining assessment of trigeminal system activation in the trigeminal ganglion using OS lipid peroxidation marker, malondialdehyde, and CGRP (C) and c-fos in the caudal trigeminal nucleus (D).
  • FIG. 13 Systemic administration of IGF-1 did not trigger hypoglycemia.
  • FIG. 14 Schematic adapted from Melo-Carrillo et al. (JNS, 2019) illustrates that nasal IGF-1 may impact migraine at multiple levels.
  • FIG. 15A-B Intranasal delivery of IGF-1 significantly reduces CGRP levels in the trigeminal ganglion of naive animals.
  • FIG. 17A-I Trigeminal system activation after recurrent SD and pretreatment with high dose (150 pg) intranasal IGF-1. (Top panel) Intranasal delivery of IGF-1 significantly reduced OS in the trigeminal ganglion after recurrent SD. Representative images show malondialdehyde immunostaining of the VI area of the trigeminal ganglion after pre-treatment with (A) IGF-1 or (B) vehicle which was followed a day later by 90 minutes of recurrent CSD.
  • FIG. 18A-D Representative trigeminocervical c-fos immunostaining after treatment and subsequent recurrent CSD.
  • Representative trigeminal cervical c-fos immunostaining black dots) in the superficial lamellae (encircled areas) at -4.5 mm for the obex (top) and 6.0 mm from the obex bottom).
  • Images show the result of recurrent activation of CSD for 90 minutes (i.e., with CSD stimulus delivered every nine minutes for 90 minutes) after (A) sham treatment with nasal succinate and subsequent intravenous saline) compared to (B) nasal IGF-1 followed by intravenous saline and (C) nasal IGF-1 followed by intravenous anti-CGRP antibody.
  • Statistical results are shown in (D).
  • Nasal IGF-1 followed by intravenous treatment with an anti-CGRP antibody also triggered a significant (***p ⁇ 0.001) reduction in c-fos activation from recurrent CSD compared to ND in ratios.
  • FIG. 20 BIO-EVF5 system from BIOSEB.
  • the video-based BIOSEB (Vitrolles cedex France) electronic Von Frey system is shown. This system allows accurate determination of mechanical pain sensitivity threshold using the hand-held stimulator handle with a video camera and sensor tip that is used to test paw withdrawal threshold. Each measurement is registered via software and laptop computer to create a permanent record. Results are also recorded manually to a lab book.
  • FIG. 21 Individual animal enclosures for Von Frey hind paw withdrawal testing.
  • Image shows six individual rat enclosures where animals are housed for 30 minutes before initiation of hind paw withdrawal testing via the electronic Von Frey unit using a hand-held stimulator that is used to approach the left and right hind paws via the underlying wire mesh. Measurements are made from the left paw and then the right paw per animal and repeated for all animals five times.
  • FIG. 22 Screen shot of electronic Von Frey (BIOSEB) system software.
  • FIG. 24 Impact of nasal treatment with IGF-1 versus succinate (vehicle) from FM-
  • FIG. 25 Impact of nasal treatment with IGF-1 versus succinate (vehicle) from FM-
  • Insulin-like growth factor 1 is also known as somatomedin C or mechano growth factor, and has also been referred to as a “sulfation factor” or “nonsuppressible insulin like activity” (NSILA).
  • the insulin-like growth factor family includes two ligands, IGF-1 and IGF -2, two cell membrane receptors, IGF-1R and IGF-2R, and six IGF-1 -binding proteins IGFBP1-6.
  • the IGF-1 protein is encoded by the IGF1 gene.
  • Insulin-like growth factor 1 has been shown to interact with the IGF-1 receptor (IGF1R), and the insulin receptor.
  • IGF1R IGF-1 receptor
  • IGF1R insulin receptor
  • IGF-1 includes a polypeptide comprising the following sequence:
  • Insulin is a hormone central to regulating carbohydrate and fat metabolism in the body. Insulin is synthesized in the pancreas within the b-cells of the islets of Langerhans. Insulin has also been shown to be produced within the brain. The proinsulin precursor of insulin is encoded by the INS gene. Insulin has been shown to interact with the insulin receptor.
  • MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTR REAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN (SEQ ID NO:3) and GenBank accession number AAA59179: MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTR REAEVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN (SEQ ID NO:4).
  • Insulin peptides or polypeptides can comprise all or part of an amino acid sequence similar to that provided in SEQ ID NO: 3 or 4.
  • antibody refers to an intact immunoglobulin of any isotype, or a fragment thereof that can compete with the intact antibody for specific binding to the target antigen, and includes chimeric, humanized, fully human, and bispecific antibodies.
  • antibody or immunoglobulin are used interchangeably and refer to any of several classes of structurally related proteins that function as part of the immune response of an animal, including IgG, IgD, IgE, IgA, IgM, and related proteins, as well as polypeptides comprising antibody CDR domains that retain antigen-binding activity.
  • antigen refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antibody.
  • An antigen may possess one or more epitopes that are capable of interacting with different antibodies.
  • epitope includes any region or portion of molecule capable eliciting an immune response by binding to an immunoglobulin or to a T-cell receptor.
  • Epitope determinants may include chemically active surface groups such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three-dimensional structural characteristics and/or specific charge characteristics.
  • antibodies specific for a particular target antigen will preferentially recognize an epitope on the target antigen within a complex mixture.
  • epitope regions of a given polypeptide can be identified using many different epitope mapping techniques are well known in the art, including: x-ray crystallography, nuclear magnetic resonance spectroscopy, site-directed mutagenesis mapping, protein display arrays, see, e.g., Epitope Mapping Protocols, (Johan Rockb erg and Johan Nilvebrant, Ed., 2018) Humana Press, New York, N.Y. Such techniques are known in the art and described in, e.g., U.S. Pat. No. 4,708,871; Geysen et al. Proc. Natl. Acad. Sci. USA 81:3998-4002 (1984); Geysen et al. Proc.
  • antigenic regions of proteins can also be predicted and identified using standard antigenicity and hydropathy plots.
  • immunogenic sequence means a molecule that includes an amino acid sequence of at least one epitope such that the molecule is capable of stimulating the production of antibodies in an appropriate host.
  • immunogenic composition means a composition that comprises at least one immunogenic molecule (e.g., an antigen or carbohydrate).
  • an intact antibody is generally composed of two full-length heavy chains and two full-length light chains, but in some instances may include fewer chains, such as antibodies naturally occurring in camelids that may comprise only heavy chains.
  • Antibodies as disclosed herein may be derived solely from a single source or may be “chimeric,” that is, different portions of the antibody may be derived from two different antibodies.
  • the variable or CDR regions may be derived from a rat or murine source, while the constant region is derived from a different animal source, such as a human.
  • the antibodies or binding fragments may be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies.
  • the term “antibody” includes derivatives, variants, fragments, and muteins thereof, examples of which are described below (Sela-Culang et al., Front Immunol. 2013; 4: 302; 2013).
  • the term “light chain” includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
  • a full-length light chain has a molecular weight of around 25,000 Daltons and includes a variable region domain (abbreviated herein as VL), and a constant region domain (abbreviated herein as CL).
  • VL variable region domain
  • CL constant region domain
  • VL fragment means a fragment of the light chain of a monoclonal antibody that includes all or part of the light chain variable region, including CDRs.
  • a VL fragment can further include light chain constant region sequences.
  • the variable region domain of the light chain is at the amino-terminus of the polypeptide.
  • the term “heavy chain” includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
  • a full-length heavy chain has a molecular weight of around 50,000 Daltons and includes a variable region domain (abbreviated herein as VH), and three constant region domains (abbreviated herein as CHI, CH2, and CH3).
  • VH variable region domain
  • CHI constant region domain
  • CH2 constant region domains
  • VH fragment means a fragment of the heavy chain of a monoclonal antibody that includes all or part of the heavy chain variable region, including CDRs.
  • a VH fragment can further include heavy chain constant region sequences. The number of heavy chain constant region domains will depend on the isotype.
  • the VH domain is at the amino-terminus of the polypeptide, and the CH domains are at the carboxy -terminus, with the CH3 being closest to the — COOH end.
  • the isotype of an antibody can be IgM, IgD, IgG, IgA, or IgE and is defined by the heavy chains present of which there are five classifications: mu (m), delta (d), gamma (?), alpha (a), or epsilon (e) chains, respectively.
  • IgG has several subtypes, including, but not limited to, IgGl, IgG2, IgG3, and IgG4.
  • IgM subtypes include IgMl and IgM2.
  • IgA subtypes include IgAl and IgA2.
  • Antibodies can be whole immunoglobulins of any isotype or classification, chimeric antibodies, or hybrid antibodies with specificity to two or more antigens. They may also be fragments (e.g., F(ab')2, Fab', Fab, Fv, and the like), including hybrid fragments.
  • An immunoglobulin also includes natural, synthetic, or genetically engineered proteins that act like an antibody by binding to specific antigens to form a complex.
  • the term antibody includes genetically engineered or otherwise modified forms of immunoglobulins.
  • the term “monomer” means an antibody containing only one Ig unit. Monomers are the basic functional units of antibodies.
  • the term “dimer” means an antibody containing two Ig units attached to one another via constant domains of the antibody heavy chains (the Fc, or fragment crystallizable, region). The complex may be stabilized by a joining (J) chain protein.
  • the term “multimer” means an antibody containing more than two Ig units attached to one another via constant domains of the antibody heavy chains (the Fc region). The complex may be stabilized by a joining (J) chain protein.
  • the term “bivalent antibody” means an antibody that comprises two antigen binding sites. The two binding sites may have the same antigen specificities or they may be bi- specific, meaning the two antigen-binding sites have different antigen specificities.
  • Bispecific antibodies are a class of antibodies that have two paratopes with different binding sites for two or more distinct epitopes.
  • bispecific antibodies can be biparatopic, wherein a bispecific antibody may specifically recognize a different epitope from the same antigen.
  • bispecific antibodies can be constructed from a pair of different single domain antibodies termed “nanobodies”. Single domain antibodies are sourced and modified from cartilaginous fish and camelids. Nanobodies can be joined together by a linker using techniques typical to a person skilled in the art; such methods for selection and joining of nanobodies are described in PCT Publication No. WO20 15044386A1, No. W02010037838A2, and Bever et al., Anal Chem. 86:7875-7882 (2014), each of which are specifically incorporated herein by reference in their entirety.
  • Bispecific antibodies can be constructed as: a whole IgG, Fab'2, Fab'PEG, a diabody, or alternatively as scFv. Diabodies and scFvs can be constructed without an Fc region, using only variable domains, potentially reducing the effects of anti -idiotypic reaction. Bispecific antibodies may be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai and Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al., J. Immunol. 148:1547-1553 (1992), each of which are specifically incorporated by reference in their entirety.
  • the antigen-binding domain may be multispecific or heterospecific by multimerizing with VH and VL region pairs that bind a different antigen.
  • the antibody may bind to, or interact with, (a) a cell surface antigen, (b) an Fc receptor on the surface of an effector cell, or (c) at least one other component.
  • aspects may include, but are not limited to, bispecific, trispecific, tetraspecific, and other multispecific antibodies or antigen-binding fragments thereof that are directed to epitopes and to other targets, such as Fc receptors on effector cells.
  • multispecific antibodies can be used and directly linked via a short flexible polypeptide chain, using routine methods known in the art.
  • diabodies that are bivalent, bispecific antibodies in which the VH and VL domains are expressed on a single polypeptide chain, and utilize a linker that is too short to allow for pairing between domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain creating two antigen binding sites.
  • the linker functionality is applicable for embodiments of triabodies, tetrabodies, and higher order antibody multimers. (see, e.g., Hollinger et al., Proc Natl. Acad. Sci.
  • Bispecific diabodies as opposed to bispecific whole antibodies, may also be advantageous because they can be readily constructed and expressed in E. cob.
  • Diabodies (and other polypeptides such as antibody fragments) of appropriate binding specificities can be readily selected using phage display (WO94/13804) from libraries. If one arm of the diabody is kept constant, for instance, with a specificity directed against a protein, then a library can be made where the other arm is varied and an antibody of appropriate specificity selected.
  • Bispecific whole antibodies may be made by alternative engineering methods as described in Ridgeway et al., (Protein Eng., 9:616-621, 1996) and Krah et al., (N Biotechnol. 39:167-173, 2017), each of which is hereby incorporated by reference in their entirety.
  • Heteroconjugate antibodies are composed of two covalently linked monoclonal antibodies with different specificities. See, e.g., U.S. Patent No. 6,010,902, incorporated herein by reference in its entirety.
  • the part of the Fv fragment of an antibody molecule that binds with high specificity to the epitope of the antigen is referred to herein as the “paratope.”
  • the paratope consists of the amino acid residues that make contact with the epitope of an antigen to facilitate antigen recognition.
  • Each of the two Fv fragments of an antibody is composed of the two variable domains, VH and VL, in dimerized configuration.
  • the primary structure of each of the variable domains includes three hypervariable loops separated by, and flanked by, Framework Regions (FR).
  • the hypervariable loops are the regions of highest primary sequences variability among the antibody molecules from any mammal.
  • hypervariable loop is sometimes used interchangeably with the term “Complementarity Determining Region (CDR).”
  • CDR Complementarity Determining Region
  • the length of the hypervariable loops (or CDRs) varies between antibody molecules.
  • the framework regions of all antibody molecules from a given mammal have high primary sequence similarity/consensus.
  • the consensus of framework regions can be used by one skilled in the art to identify both the framework regions and the hypervariable loops (or CDRs) which are interspersed among the framework regions.
  • the hypervariable loops are given identifying names which distinguish their position within the polypeptide, and on which domain they occur.
  • CDRs in the VL domain are identified as LI, L2, and L3, with LI occurring at the most distal end and L3 occurring closest to the CL domain.
  • the CDRs may also be given the names CDR-1, CDR-2, and CDR-3.
  • the L3 (CDR-3) is generally the region of highest variability among all antibody molecules produced by a given organism.
  • the CDRs are regions of the polypeptide chain arranged linearly in the primary structure, and separated from each other by Framework Regions.
  • the amino terminal (N-terminal) end of the VL chain is named FR1.
  • the region identified as FR2 occurs between LI and L2 hypervariable loops.
  • FR3 occurs between L2 and L3 hypervariable loops, and the FR4 region is closest to the CL domain. This structure and nomenclature is repeated for the VH chain, which includes three CDRs identified as HI, H2 and H3.
  • variable domains or Fv fragments (VH and VL)
  • Fv fragments are part of the framework regions (approximately 85%).
  • the three dimensional, or tertiary, structure of an antibody molecule is such that the framework regions are more internal to the molecule and provide the majority of the structure, with the CDRs on the external surface of the molecule.
  • affinity matured antibodies are enhanced with one or more modifications in one or more CDRs thereof that result in an improvement in the affinity of the antibody for a target antigen as compared to a parent antibody that does not possess those alteration(s).
  • Certain affinity matured antibodies will have nanomolar or picomolar affinities for the target antigen.
  • Affinity matured antibodies are produced by procedures known in the art, e.g., Marks et al., Bio/Technology 10:779 (1992) describes affinity maturation by VH and VL domain shuffling, random mutagenesis of CDR and/or framework residues employed in phage display is described by Rajpal et al., PNAS. 24: 8466-8471 (2005) and Thie et al., Methods Mol Biol. 525:309-22 (2009) in conjugation with computation methods as demonstrated in Tiller et al., Front. Immunol. 8:986 (2017).
  • Chimeric immunoglobulins are the products of fused genes derived from different species; “humanized” chimeras generally have the framework region (FR) from human immunoglobulins and one or more CDRs are from a non-human source.
  • FR framework region
  • portions of the heavy and/or light chain are identical or homologous to corresponding sequences from another particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
  • For methods relating to chimeric antibodies see, e.g., U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl.
  • minimizing the antibody polypeptide sequence from the non-human species optimizes chimeric antibody function and reduces immunogenicity. Specific amino acid residues from non-antigen recognizing regions of the non-human antibody are modified to be homologous to corresponding residues in a human antibody or isotype.
  • CDR-grafted antibody in which an antibody comprises one or more CDRs from a particular species or belonging to a specific antibody class or subclass, while the remainder of the antibody chain(s) is identical or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass.
  • V region composed of CDR1, CDR2, and partial CDR3 for both the light and heavy chain variance region from a non-human immunoglobulin are grafted with a human antibody framework region, replacing the naturally occurring antigen receptors of the human antibody with the non-human CDRs.
  • corresponding non-human residues replace framework region residues of the human immunoglobulin.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody to further refine performance.
  • the humanized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • Intrabodies are intracellularly localized immunoglobulins that bind to intracellular antigens as opposed to secreted antibodies, which bind antigens in the extracellular space.
  • Polyclonal antibody preparations typically include different antibodies against different determinants (epitopes).
  • a host such as a rabbit or goat, is immunized with the antigen or antigen fragment, generally with an adjuvant and, if necessary, coupled to a carrier.
  • Antibodies to the antigen are subsequently collected from the sera of the host.
  • the polyclonal antibody can be affinity purified against the antigen rendering it monospecific.
  • Monoclonal antibodies or “mAb” refer to an antibody obtained from a population of homogeneous antibodies from an exclusive parental cell, e.g., the population is identical except for naturally occurring mutations that may be present in minor amounts. Each monoclonal antibody is directed against a single antigenic determinant.
  • antibody fragments such as antibody fragments that bind to antigen.
  • the term functional antibody fragment includes antigen-binding fragments of an antibody that retain the ability to specifically bind to an antigen. These fragments are constituted of various arrangements of the variable region heavy chain (VH) and/or light chain (VL); and in some embodiments, include constant region heavy chain 1 (CHI) and light chain (CL). In some embodiments, they lack the Fc region constituted of heavy chain 2 (CH2) and 3 (CH3) domains.
  • Embodiments of antigen binding fragments and the modifications thereof may include: (i) the Fab fragment type constituted with the VL, VH, CL, and CHI domains; (ii) the Fd fragment type constituted with the VH and CHI domains; (iii) the Fv fragment type constituted with the VH and VL domains; (iv) the single domain fragment type, dAb, (Ward, 1989; McCafferty et al., 1990; Holt et al., 2003) constituted with a single VH or VL domain; (v) isolated complementarity determining region (CDR) regions.
  • CDR complementarity determining region
  • Antigen-binding fragments also include fragments of an antibody that retain exactly, at least, or at most 1, 2, or 3 complementarity determining regions (CDRs) from a light chain variable region. Fusions of CDR-containing sequences to an Fc region (or a CH2 or CH3 region thereof) are included within the scope of this definition including, for example, scFv fused, directly or indirectly, to an Fc region are included herein.
  • CDRs complementarity determining regions
  • Fab fragment means a monovalent antigen-binding fragment of an antibody containing the VL, VH, CL and CHI domains.
  • Fab' fragment means a monovalent antigen-binding fragment of a monoclonal antibody that is larger than a Fab fragment.
  • a Fab' fragment includes the VL, VH, CL and CHI domains and all or part of the hinge region.
  • F(ab')2 fragment means a bivalent antigen-binding fragment of a monoclonal antibody comprising two Fab' fragments linked by a disulfide bridge at the hinge region.
  • An F(ab')2 fragment includes, for example, all or part of the two VH and VL domains, and can further include all or part of the two CL and CHI domains.
  • the term Fd fragment means a fragment of the heavy chain of a monoclonal antibody, which includes all or part of the VH, including the CDRs.
  • An Fd fragment can further include CHI region sequences.
  • Fv fragment means a monovalent antigen-binding fragment of a monoclonal antibody, including all or part of the VL and VH, and absent of the CL and CHI domains.
  • the VL and VH include, for example, the CDRs.
  • Single-chain antibodies are Fv molecules in which the VL and VH regions have been connected by a flexible linker to form a single polypeptide chain, which forms an antigen-binding fragment. Single chain antibodies are discussed in detail in International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203, the disclosures of which are herein incorporated by reference.
  • (scFv)2 means bivalent or bispecific sFv polypeptide chains that include oligomerization domains at their C-termini, separated from the sFv by a hinge region (Pack et al. 1992).
  • the oligomerization domain comprises self-associating a- helices, e.g., leucine zippers, which can be further stabilized by additional disulfide bonds.
  • (scFv)2 fragments are also known as “miniantibodies” or “minibodies.”
  • single domain antibody is an antigen-binding fragment containing only a VH or the VL domain.
  • two or more VH regions are covalently joined with a peptide linker to create a bivalent domain antibody.
  • the two VH regions of a bivalent domain antibody may target the same or different antigens.
  • An Fc region contains two heavy chain fragments comprising the CH2 and CH3 domains of an antibody.
  • the two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the CH3 domains.
  • the term “Fc polypeptide” as used herein includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization are included.
  • Antigen-binding peptide scaffolds such as complementarity-determining regions (CDRs) are used to generate protein-binding molecules in accordance with the embodiments.
  • CDRs complementarity-determining regions
  • a person skilled in the art can determine the type of protein scaffold on which to graft at least one of the CDRs. It is known that scaffolds, optimally, must meet a number of criteria such as: good phylogenetic conservation; known three-dimensional structure; small size; few or no post-transcriptional modifications; and/or be easy to produce, express, and purify. Skerra, J Mol Recognit, 13:167-87 (2000).
  • the protein scaffolds can be sourced from, but not limited to: fibronectin type III FN3 domain (known as “monobodies”), fibronectin type III domain 10, lipocalin, anticalin, Z- domain of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the “ankyrin repeat”, the “armadillo repeat”, the “leucine-rich repeat” and the “tetratricopeptide repeat”.
  • Such proteins are described in US Patent Publication Nos. 2010/0285564, 2006/0058510, 2006/0088908, 2005/0106660, and PCT Publication No. W02006/056464, each of which are specifically incorporated herein by reference in their entirety. Scaffolds derived from toxins from scorpions, insects, plants, mollusks, etc., and the protein inhibiters of neuronal NO synthase (PIN) may also be used.
  • PIN neuronal NO synthase
  • selective binding agent refers to a molecule that binds to an antigen.
  • Non-limiting examples include antibodies, antigen-binding fragments, scFv, Fab, Fab', F(ab')2, single chain antibodies, peptides, peptide fragments and proteins.
  • binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
  • immunologically reactive means that the selective binding agent or antibody of interest will bind with antigens present in a biological sample.
  • immuno complex refers the combination formed when an antibody or selective binding agent binds to an epitope on an antigen.
  • affinity refers the strength with which an antibody or selective binding agent binds an epitope. In antibody binding reactions, this is expressed as the affinity constant (Ka or ka sometimes referred to as the association constant) for any given antibody or selective binding agent. Affinity is measured as a comparison of the binding strength of the antibody to its antigen relative to the binding strength of the antibody to an unrelated amino acid sequence. Affinity can be expressed as, for example, 20- fold greater binding ability of the antibody to its antigen then to an unrelated amino acid sequence.
  • vidity refers to the resistance of a complex of two or more agents to dissociation after dilution.
  • immunosorbent and “preferentially binds” are used interchangeably herein with respect to antibodies and/or selective binding agent.
  • examples of some experimental methods that can be used to determine the KD value are: enzyme-linked immunosorbent assays (ELISA), isothermal titration calorimetry (ITC), fluorescence anisotropy, surface plasmon resonance (SPR), and affinity capillary electrophoresis (ACE).
  • ELISA enzyme-linked immunosorbent assays
  • ITC isothermal titration calorimetry
  • SPR surface plasmon resonance
  • ACE affinity capillary electrophoresis
  • Antibodies deemed useful in certain embodiments may have an affinity constant (Ka) of about, at least about, or at most about 106, 107, 108,109, or 1010 M or any range derivable therein.
  • antibodies may have a dissociation constant of about, at least about or at most about 10-6, 10-7, 10-8, 10-9, 10-10 M, or any range derivable therein. These values are reported for antibodies discussed herein and the same assay may be used to evaluate the binding properties of such antibodies.
  • An antibody of the invention is said to “specifically bind” its target antigen when the dissociation constant (KD) is 710-8 M. The antibody specifically binds antigen with “high affinity” when the KD is 75 x 10-9 M, and with “very high affinity” when the KD is 75 x 10-10 M.
  • the epitope of an antigen is the specific region of the antigen for which an antibody has binding affinity.
  • the epitope is the specific residues (or specified amino acids or protein segment) that the antibody binds with high affinity.
  • An antibody does not necessarily contact every residue within the protein. Nor does every single amino acid substitution or deletion within a protein necessarily affect binding affinity.
  • epitope and antigenic determinant are used interchangeably to refer to the site on an antigen to which B and/or T cells respond or recognize.
  • Polypeptide epitopes can be formed from both contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a polypeptide.
  • An epitope typically includes at least 3, and typically 5-10 amino acids in a unique spatial conformation.
  • Epitope specificity of an antibody can be determined in a variety of ways. One approach, for example, involves testing a collection of overlapping peptides of about 15 amino acids spanning the full sequence of the protein and differing in increments of a small number of amino acids (e.g., 3 to 30 amino acids). The peptides are immobilized in separate wells of a microtiter dish. Immobilization can be accomplished, for example, by biotinylating one terminus of the peptides.
  • This process may affect the antibody affinity for the epitope, therefore different samples of the same peptide can be biotinylated at the N and C terminus and immobilized in separate wells for the purposes of comparison. This is useful for identifying end-specific antibodies.
  • additional peptides can be included terminating at a particular amino acid of interest. This approach is useful for identifying end-specific antibodies to internal fragments. An antibody or antigen-binding fragment is screened for binding to each of the various peptides.
  • the epitope is defined as a segment of amino acids that is common to all peptides to which the antibody shows high affinity binding.
  • the antibodies of the present invention may be modified, such that they are substantially identical to the antibody polypeptide sequences, or fragments thereof, and still bind the epitopes of the present invention.
  • Polypeptide sequences are “substantially identical” when optimally aligned using such programs as Clustal Omega, IGBLAST, GAP or BESTFIT using default gap weights, they share at least 80% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, or at least 99% sequence identity or any range therein.
  • amino acid sequences of antibodies or antigen-binding regions thereof are contemplated as being encompassed by the present invention, providing that the variations in the amino acid sequence maintain at least 75%, more preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% and most preferably at least 99% sequence identity.
  • conservative amino acid replacements are contemplated.
  • Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids are generally divided into families based on the chemical nature of the side chain; e.g., acidic (aspartate, glutamate), basic (lysine, arginine, histidine), nonpolar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine).
  • acidic aspartate, glutamate
  • basic lysine, arginine, histidine
  • nonpolar alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • uncharged polar glycine, asparagine, glutamine, cysteine, serine, thre
  • Standard ELISA, Surface Plasmon Resonance (SPR), or other antibody binding assays can be performed by one skilled in the art to make a quantitative comparison of antigen binging affinity between the unmodified antibody and any polypeptide derivatives with conservative substitutions generated through any of several methods available to one skilled in the art.
  • fragments or analogs of antibodies or immunoglobulin molecules can be readily prepared by those skilled in the art. Preferred amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. Preferably, computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Standard methods to identify protein sequences that fold into a known three-dimensional structure are available to those skilled in the art; Dill and McCallum., Science 338:1042-1046 (2012).
  • Framework modifications can be made to antibodies to decrease immunogenicity, for example, by “backmutating” one or more framework residues to a corresponding germline sequence.
  • the antigen-binding domain may be multi-specific or multivalent by multimerizing the antigen-binding domain with VH and VL region pairs that bind either the same antigen (multi -valent) or a different antigen (multi-specific).
  • glycosylation variants of antibodies wherein the number and/or type of glycosylation site(s) has been altered compared to the amino acid sequences of the parent polypeptide.
  • Glycosylation of the polypeptides can be altered, for example, by modifying one or more sites of glycosylation within the polypeptide sequence to increase the affinity of the polypeptide for antigen (U.S. Pat. Nos. 5,714,350 and 6,350,861).
  • antibody protein variants comprise a greater or a lesser number of N- linked glycosylation sites than the native antibody.
  • N-linked glycosylation site is characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the amino acid residue designated as X may be any amino acid residue except proline.
  • the substitution of amino acid residues to create this sequence provides a potential new site for the addition of an N-linked carbohydrate chain.
  • substitutions that eliminate or alter this sequence will prevent addition of an N-linked carbohydrate chain present in the native polypeptide.
  • the glycosylation can be reduced by the deletion of an Asn or by substituting the Asn with a different amino acid.
  • one or more new N-linked glycosylation sites are created.
  • Antibodies typically have an N-linked glycosylation site in the Fc region.
  • Additional antibody variants include cysteine variants, wherein one or more cysteine residues in the parent or native amino acid sequence are deleted from or substituted with another amino acid (e.g., serine). Cysteine variants are useful, inter alia, when antibodies must be refolded into a biologically active conformation. Cysteine variants may have fewer cysteine residues than the native antibody and typically have an even number to minimize interactions resulting from unpaired cysteines.
  • the polypeptides can be pegylated to increase biological half-life by reacting the polypeptide with polyethylene glycol (PEG) or a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the polypeptide.
  • PEG polyethylene glycol
  • Polypeptide pegylation may be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
  • Methods for pegylating proteins are known in the art and can be applied to the polypeptides of the invention to obtain PEGylated derivatives of antibodies. See, e.g., EP 0 154 316 and EP 0 401 384.
  • the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant.
  • TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly(n-vinyl pyrrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols, and polyvinyl alcohols.
  • polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins.
  • the derivatized antibody or fragment thereof may comprise any molecule or substance that imparts a desired property to the antibody or fragment.
  • the derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimetric, antigenic, or enzymatic molecule, or a detectable bead), a molecule that binds to another molecule (e.g., biotin or streptavidin), a therapeutic or diagnostic moiety (e.g., a radioactive, cytotoxic, or pharmaceutically active moiety), or a molecule that increases the suitability of the antibody for a particular use (e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses).
  • a detectable (or labeling) moiety e.g., a radioactive, colorimetric, antigenic, or enzymatic molecule, or a detectable bead
  • an antibody or an immunological portion of an antibody can be chemically conjugated to, or expressed as, a fusion protein with other proteins.
  • polypeptides may be chemically modified by conjugating or fusing the polypeptide to serum protein, such as human serum albumin, to increase half-life of the resulting molecule. See, e.g., EP 0322094 and EP 0 486 525.
  • the polypeptides may be conjugated to a diagnostic agent and used diagnostically, for example, to monitor the development or progression of a disease and determine the efficacy of a given treatment regimen.
  • the polypeptides may also be conjugated to a therapeutic agent to provide a therapy in combination with the therapeutic effect of the polypeptide.
  • Additional suitable conjugated molecules include ribonuclease (RNase), DNase I, an antisense nucleic acid, an inhibitory RNA molecule such as a siRNA molecule, an immunostimulatory nucleic acid, aptamers, ribozymes, triplex forming molecules, and external guide sequences.
  • RNase ribonuclease
  • DNase I DNase I
  • an antisense nucleic acid an inhibitory RNA molecule
  • an inhibitory RNA molecule such as a siRNA molecule
  • an immunostimulatory nucleic acid aptamers
  • ribozymes triplex forming molecules
  • the functional nucleic acid molecules may act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules may possess a de novo activity independent of any other molecules.
  • antibodies and antibody-like molecules that are linked to at least one agent to form an antibody conjugate or payload.
  • it is conventional to link or covalently bind or complex at least one desired molecule or moiety.
  • a molecule or moiety may be, but is not limited to, at least one effector or reporter molecule.
  • Effector molecules comprise molecules having a desired activity, e.g., cytotoxic activity.
  • Non-limiting examples of effector molecules include toxins, therapeutic enzymes, antibiotics, radiolabeled nucleotides and the like.
  • a reporter molecule is defined as any moiety that may be detected using an assay.
  • Non-limiting examples of reporter molecules that have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffmity molecules, colored particles, or ligands.
  • antibody conjugates are those conjugates in which the antibody is linked to a detectable label.
  • Detectable labels are compounds and/or elements that can be detected due to their specific functional properties, and/or chemical characteristics, the use of which allows the antibody to be detected, and/or further quantified if desired.
  • detectable labels include, but not limited to, radioactive isotopes, fluorescers, semiconductor nanocrystals, chemiluminescers, chromophores, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors, dyes, metal ions, metal sols, ligands (e.g., biotin, streptavidin or haptens) and the like.
  • Labels are, but not limited to, horseradish peroxidase (HRP), fluorescein, FITC, rhodamine, dansyl, umbelliferone, dimethyl acridinium ester (DMAE), Texas red, luminol, NADPH and a- or B-galactosidase.
  • Antibody conjugates include those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme to generate a colored product upon contact with a chromogenic substrate.
  • suitable enzymes include, but are not limited to, urease, alkaline phosphatase, (horseradish) hydrogen peroxidase, or glucose oxidase.
  • Preferred secondary binding ligands are biotin and/or avidin and streptavidin compounds.
  • the uses of such labels is well known to those of skill in the art and are described, for example, in Ei.S. Patents 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149 and 4,366,241; each incorporated herein by reference.
  • Molecules containing azido groups may also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter & Haley, 1983).
  • contemplated are immunoconjugates comprising an antibody or antigen-binding fragment thereof conjugated to a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active tox
  • the immunoconjugate can be provided in the form of a fusion protein.
  • an antibody may be conjugated to various therapeutic substances in order to target the cell surface antigen.
  • conjugated agents include, but are not limited to, metal chelate complexes, drugs, toxins and other effector molecules, such as cytokines, lymphokines, chemokines, immunomodulators, radiosensitizers, asparaginase, carboranes, and radioactive halogens.
  • an antibody is conjugated to one or more drug moieties (D) through a linker (L).
  • the ADC may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a nucleophilic group of an antibody with a bivalent linker reagent, to form Ab-L, via a covalent bond, followed by reaction with a drug moiety D; and (2) reaction of a nucleophilic group of a drug moiety with a bivalent linker reagent, to form D-L, via a covalent bond, followed by reaction with the nucleophilic group of an antibody.
  • Antibody drug conjugates may also be produced by modification of the antibody to introduce electrophilic moieties, which can react with nucleophilic substituents on the linker reagent or drug.
  • a fusion protein comprising the antibody and cytotoxic agent may be made, e.g., by recombinant techniques or peptide synthesis.
  • the length of DNA may comprise respective regions encoding the two portions of the conjugate either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the conjugate.
  • the antibody may be conjugated to a “receptor” (such as streptavidin) for utilization in tumor or cancer cell pre-targeting wherein the antibody -receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a “ligand” (e.g., avidin) which is conjugated to a cytotoxic agent (e.g., a radionucleotide).
  • a receptor such as streptavidin
  • a ligand e.g., avidin
  • cytotoxic agent e.g., a radionucleotide
  • Examples of an antibody-drug conjugates known to a person skilled in the art are pro-drugs useful for the local delivery of cytotoxic or cytostatic agents, i.e. drugs to kill or inhibit tumor cells in the treatment of cancer (Syrigos and Epenetos, Anticancer Res. 19:605- 614 (1999); Niculescu-Duvaz and Springer, Adv. Drg. Del. Rev. 26:151-172 (1997); U.S. Pat. No. 4,975,278).
  • ADC include covalent or aggregative conjugates of antibodies, or antigen-binding fragments thereof, with other proteins or polypeptides, such as by expression of recombinant fusion proteins comprising heterologous polypeptides fused to the N-terminus or C-terminus of an antibody polypeptide.
  • the conjugated peptide may be a heterologous signal (or leader) polypeptide, e.g., the yeast alpha-factor leader, or a peptide such as an epitope tag (e.g., V5-His).
  • Antibody-containing fusion proteins may comprise peptides added to facilitate purification or identification of the antibody (e.g., poly- His).
  • An antibody polypeptide also can be linked to the FLAG® (Sigma-Aldrich, St. Louis, Mo.) peptide as described in Hopp et al., Bio/Technology 6:1204 (1988), and U.S. Pat. No. 5,011,912.
  • Oligomers that contain one or more antibody polypeptides may be employed as antagonists. Oligomers may be in the form of covalently linked or non-covalently linked dimers, trimers, or higher oligomers. Oligomers comprising two or more antibody polypeptides are contemplated for use. Other oligomers include heterodimers, homotrimers, heterotrimers, homotetramers, heterotetramers, etc.
  • oligomers comprise multiple antibody polypeptides joined via covalent or non-covalent interactions between peptide moieties fused to the antibody polypeptides.
  • Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
  • Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of antibody polypeptides attached thereto, as described in more detail below.
  • a metal chelate complex employing, for example, an organic chelating agent such as a diethylenetriaminepentaacetic acid anhydride (DTP A); ethylenetriaminetetraacetic acid; N- chloro-p-toluenesulfonamide; and/or tetrachloro-3 -6 -diphenylglycouril-3 attached to the antibody (U.S. Patent Nos. 4,472,509 and 4,938,948, each incorporated herein by reference).
  • DTP A diethylenetriaminepentaacetic acid anhydride
  • ethylenetriaminetetraacetic acid ethylenetriaminetetraacetic acid
  • N- chloro-p-toluenesulfonamide and/or tetrachloro-3 -6 -diphenylglycouril-3 attached to the antibody
  • Monoclonal antibodies may also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate.
  • Conjugates may also be made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HC1), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis(p-azidobenzoyl)hexanediamine), bis- diazonium derivatives (such as bos(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-
  • derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin, using reaction conditions that do not alter the antibody combining site, are contemplated.
  • Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity, and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference).
  • Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region has also been disclosed in the literature (O’Shannessy et al., 1987).
  • a “protein” or “polypeptide” refers to a molecule comprising at least five amino acid residues.
  • wild-type refers to the endogenous version of a molecule that occurs naturally in an organism.
  • wild-type versions of a protein or polypeptide are employed, however, in many embodiments of the disclosure, a modified protein or polypeptide is employed to generate an immune response.
  • a “modified protein” or “modified polypeptide” or a “variant” refers to a protein or polypeptide whose chemical structure, particularly its amino acid sequence, is altered with respect to the wild-type protein or polypeptide.
  • a modified/variant protein or polypeptide has at least one modified activity or function (recognizing that proteins or polypeptides may have multiple activities or functions). It is specifically contemplated that a modified/variant protein or polypeptide may be altered with respect to one activity or function yet retain a wild-type activity or function in other respects, such as immunogenicity.
  • a protein is specifically mentioned herein, it is in general a reference to a native (wild-type) or recombinant (modified) protein or, optionally, a protein in which any signal sequence has been removed.
  • the protein may be isolated directly from the organism of which it is native, produced by recombinant DNA/exogenous expression methods, or produced by solid-phase peptide synthesis (SPPS) or other in vitro methods.
  • SPPS solid-phase peptide synthesis
  • recombinant may be used in conjunction with a polypeptide or the name of a specific polypeptide, and this generally refers to a polypeptide produced from a nucleic acid molecule that has been manipulated in vitro or that is a replication product of such a molecule.
  • the size of a protein or polypeptide may comprise, but is not limited to, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
  • polypeptides may be mutated by truncation, rendering them shorter than their corresponding wild-type form, also, they might be altered by fusing or conjugating a heterologous protein or polypeptide sequence with a particular function (e.g., for targeting or localization, for enhanced immunogenicity, for purification purposes, etc.).
  • domain refers to any distinct functional or structural unit of a protein or polypeptide, and generally refers to a sequence of amino acids with a structure or function recognizable by one skilled in the art.
  • the protein or polypeptide may comprise ammo acids 1 to 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29.
  • 902 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920,
  • the protein, polypeptide, or nucleic acid may comprise 1, 2,
  • the polypeptide, protein, or nucleic acid may comprise at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103 , 104, 105, 106, 107 ,
  • nucleic acid molecule or polypeptide starting at position 1 there is a nucleic acid molecule or polypeptide starting at position
  • nucleotide as well as the protein, polypeptide, and peptide sequences for various genes have been previously disclosed, and may be found in the recognized computerized databases. Two commonly used databases are the National Center for Biotechnology Information’s Genbank and GenPept databases (on the World Wide Web at ncbi.nlm.nih.gov/) and The Universal Protein Resource (UniProt; on the World Wide Web at uniprot.org). The coding regions for these genes may be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art.
  • compositions of the disclosure there is between about 0.001 mg and about 10 mg of total polypeptide, peptide, and/or protein per ml.
  • concentration of protein in a composition can be about, at least about or at most about 0.001, 0.010, 0.050, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0 mg/ml or more (or any range derivable therein).
  • amino acid subunits of a protein may be substituted for other amino acids in a protein or polypeptide sequence with or without appreciable loss of interactive binding capacity with structures such as, for example, antigen-binding regions of antibodies or binding sites on substrate molecules. Since it is the interactive capacity and nature of a protein that defines that protein’s functional activity, certain amino acid substitutions can be made in a protein sequence and in its corresponding DNA coding sequence, and nevertheless produce a protein with similar or desirable properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes which encode proteins without appreciable loss of their biological utility or activity.
  • the term “functionally equivalent codon” is used herein to refer to codons that encode the same amino acid, such as the six different codons for arginine. Also considered are “neutral substitutions” or “neutral mutations” which refers to a change in the codon or codons that encode biologically equivalent amino acids.
  • Amino acid sequence variants of the disclosure can be substitutional, insertional, or deletion variants.
  • a variation in a polypeptide of the disclosure may affect 1, 2, 3, 4, 5, 6, 7,
  • a variant can comprise an amino acid sequence that is at least 50%, 60%, 70%, 80%, or 90%, including all values and ranges there between, identical to any sequence provided or referenced herein.
  • a variant can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more substitute amino acids.
  • amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially identical as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned.
  • the addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non-coding sequences flanking either of the 5' or 3' portions of the coding region.
  • Deletion variants typically lack one or more residues of the native or wild type protein. Individual residues can be deleted or a number of contiguous amino acids can be deleted. A stop codon may be introduced (by substitution or insertion) into an encoding nucleic acid sequence to generate a truncated protein.
  • Insertional mutants typically involve the addition of amino acid residues at a non terminal point in the polypeptide. This may include the insertion of one or more amino acid residues. Terminal additions may also be generated and can include fusion proteins which are multimers or concatemers of one or more peptides or polypeptides described or referenced herein.
  • Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein or polypeptide, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar chemical properties. “Conservative amino acid substitutions” may involve exchange of a member of one amino acid class with another member of the same class.
  • Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
  • amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics or other reversed or inverted forms of amino acid moieties.
  • substitutions may be “non-conservative”, such that a function or activity of the polypeptide is affected. Non-conservative changes typically involve substituting an amino acid residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa. Non-conservative substitutions may involve the exchange of a member of one of the amino acid classes for a member from another class.
  • polypeptides as set forth herein using well-known techniques.
  • One skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity.
  • the skilled artisan will also be able to identify amino acid residues and portions of the molecules that are conserved among similar proteins or polypeptides.
  • areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without significantly altering the biological activity or without adversely affecting the protein or polypeptide structure.
  • hydropathy index of amino acids may be considered.
  • the hydropathy profile of a protein is calculated by assigning each amino acid a numerical value (“hydropathy index”) and then repetitively averaging these values along the peptide chain.
  • Each amino acid has been assigned a value based on its hydrophobicity and charge characteristics.
  • the importance of the hydropathy amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte et al., J.
  • hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0+1); glutamate (+3.0+1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5+1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (- 1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); and tryptophan (-3.4).
  • the substitution of amino acids whose hydrophilicity values are within ⁇ 2 are included, in other embodiments, those which are within ⁇ 1 are included, and in still other embodiments, those within ⁇ 0.5 are included.
  • One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar proteins or polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three-dimensional structure. One skilled in the art may choose not to make changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue.
  • amino acid substitutions are made that: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter ligand or antigen binding affinities, and/or (5) confer or modify other physicochemical or functional properties on such polypeptides.
  • single or multiple amino acid substitutions may be made in the naturally occurring sequence.
  • substitutions can be made in that portion of the antibody that lies outside the domain(s) forming intermolecular contacts.
  • conservative amino acid substitutions can be used that do not substantially change the structural characteristics of the protein or polypeptide (e.g., one or more replacement amino acids that do not disrupt the secondary structure that characterizes the native antibody).
  • nucleic acid sequences can exist in a variety of instances such as: isolated segments and recombinant vectors of incorporated sequences or recombinant polynucleotides encoding one or both chains of an antibody, or a fragment, derivative, mutein, or variant thereof, polynucleotides sufficient for use as hybridization probes, PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense nucleic acids for inhibiting expression of a polynucleotide, and complementary sequences of the foregoing described herein.
  • Nucleic acids that encode the epitope to which certain of the antibodies provided herein are also provided.
  • Nucleic acids encoding fusion proteins that include these peptides are also provided.
  • the nucleic acids can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides and artificial variants thereof (e.g., peptide nucleic acids).
  • polynucleotide refers to a nucleic acid molecule that either is recombinant or has been isolated from total genomic nucleic acid. Included within the term “polynucleotide” are oligonucleotides (nucleic acids 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences.
  • Polynucleotides may be single- stranded (coding or antisense) or double- stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non coding sequences may, but need not, be present within a polynucleotide.
  • the term “gene,” “polynucleotide,” or “nucleic acid” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants.
  • a nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar protein.
  • polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, including all values and ranges there between, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters).
  • the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90%, preferably 95% and above, identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.
  • nucleic acid segments regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably.
  • the nucleic acids can be any length.
  • nucleic acid fragments of almost any length may be employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
  • a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post-translational modification, or for therapeutic benefits such as targeting or efficacy.
  • a tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein “heterologous” refers to a polypeptide that is not the same as the modified polypeptide.
  • nucleic acids that hybridize to other nucleic acids under particular hybridization conditions are well known in the art. See, e.g., Current Protocols in Molecular Biology, John Wiley and Sons, N.Y. (1989), 6.3.1-6.3.6. As defined herein, a moderately stringent hybridization condition uses a prewashing solution containing 5x sodium chloride/sodium citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6 SSC, and a hybridization temperature of 55° C.
  • SSC sodium chloride/sodium citrate
  • pH 8.0 0.5%
  • hybridization buffer of about 50% formamide
  • 6 SSC a hybridization temperature of 55° C.
  • a stringent hybridization condition hybridizes in 6 SSC at 45° C., followed by one or more washes in 0. lx SSC, 0.2% SDS at 68° C.
  • nucleic acids comprising nucleotide sequence that are at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to each other typically remain hybridized to each other.
  • Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antibody or antibody derivative) that it encodes. Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site- directed mutagenesis protocol. In another embodiment, one or more randomly selected residues are changed using, for example, a random mutagenesis protocol. However it is made, a mutant polypeptide can be expressed and screened for a desired property.
  • a polypeptide e.g., an antibody or antibody derivative
  • Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues.
  • one or more mutations can be introduced into a nucleic acid that selectively changes the biological activity of a polypeptide that it encodes. See, eg., Romain Studer et al., Biochem. J. 449:581-594 (2013).
  • the mutation can quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity. Examples of qualitative changes include altering the antigen specificity of an antibody.
  • nucleic acid molecules are suitable for use as primers or hybridization probes for the detection of nucleic acid sequences.
  • a nucleic acid molecule can comprise only a portion of a nucleic acid sequence encoding a full-length polypeptide, for example, a fragment that can be used as a probe or primer or a fragment encoding an active portion of a given polypeptide.
  • the nucleic acid molecules may be used as probes or PCR primers for specific antibody sequences.
  • a nucleic acid molecule probe may be used in diagnostic methods or a nucleic acid molecule PCR primer may be used to amplify regions of DNA that could be used, inter alia, to isolate nucleic acid sequences for use in producing variable domains of antibodies. See, eg., Gaily Kivi et al., BMC Biotechnol. 16:2 (2016).
  • the nucleic acid molecules are oligonucleotides.
  • the oligonucleotides are from highly variable regions of the heavy and light chains of the antibody of interest.
  • the oligonucleotides encode all or part of one or more of the CDRs.
  • Probes based on the desired sequence of a nucleic acid can be used to detect the nucleic acid or similar nucleic acids, for example, transcripts encoding a polypeptide of interest.
  • the probe can comprise a label group, e.g., a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used to identify a cell that expresses the polypeptide.
  • antibodies may be polyclonal or monoclonal antibody preparations, monospecific antisera, human antibodies, hybrid or chimeric antibodies, such as humanized antibodies, altered antibodies, F(ab')2 fragments, Fab fragments, Fv fragments, single-domain antibodies, dimeric or trimeric antibody fragment constructs, minibodies, or functional fragments thereof which bind to the antigen in question.
  • polypeptides, peptides, and proteins and immunogenic fragments thereof for use in various embodiments can also be synthesized in solution or on a solid support in accordance with conventional techniques. See, for example, Stewart and Young, (1984); Tarn et al, (1983); Merrifield, (1986); and Barany and Merrifield (1979), each incorporated herein by reference.
  • a polyclonal antibody is prepared by immunizing an animal with an antigen or a portion thereof and collecting antisera from that immunized animal.
  • the antigen may be altered compared to an antigen sequence found in nature.
  • a variant or altered antigenic peptide or polypeptide is employed to generate antibodies.
  • Inocula are typically prepared by dispersing the antigenic composition in a physiologically tolerable diluent to form an aqueous composition.
  • Antisera is subsequently collected by methods known in the arts, and the serum may be used as-is for various applications or else the desired antibody fraction may be purified by well-known methods, such as affinity chromatography (Harlow and Lane, Antibodies: A Laboratory Manual 1988).
  • Myeloma cell lines suited for use in hybridoma- producing fusion procedures preferably are non-antibody-producing and have high fusion efficiency and enzyme deficiencies that render then incapable of growing in certain selective media that support the growth of only the desired fused cells (hybridomas).
  • the fusion partner includes a property that allows selection of the resulting hybridomas using specific media.
  • fusion partners can be hypoxanthine/aminopterin/thymidine (HAT)-sensitive.
  • Methods for generating hybrids of antibody -producing spleen or lymph node cells and myeloma cells usually comprise mixing somatic cells with myeloma cells in the presence of an agent or agents (chemical or electrical) that promote the fusion of cell membranes.
  • selection of hybridomas can be performed by culturing the cells by single clone dilution in microtiter plates, followed by testing the individual clonal supernatants (after about two to three weeks) for the desired reactivity. Fusion procedures for making hybridomas, immunization protocols, and techniques for isolation of immunized splenocytes for fusion are known in the art.
  • SLAM lymphocyte antibody method
  • Monoclonal antibodies may be further purified using filtration, centrifugation, and various chromatographic methods such as HPLC or affinity chromatography. Monoclonal antibodies may be further screened or optimized for properties relating to specificity, avidity, half-life, immunogenicity, binding association, binding disassociation, or overall functional properties relative to being a treatment for infection. Thus, monoclonal antibodies may have alterations in the amino acid sequence of CDRs, including insertions, deletions, or substitutions with a conserved or non-conserved amino acid.
  • the immunogenicity of a particular immunogen composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants.
  • adjuvants that may be used in accordance with embodiments include, but are not limited to, IL-1, IL-2, IL-4, IL-7, IL-12, -interferon, GMCSP, BCG, aluminum hydroxide, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL).
  • Exemplary adjuvants may include complete Freund’s adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund’s adjuvants, and/or aluminum hydroxide adjuvant.
  • BRM biologic response modifiers
  • Cimetidine CCM; 1200 mg/d
  • CYP Cyclophosphamide
  • cytokines such as B-interferon, IL-2, or IL-12
  • genes encoding proteins involved in immune helper functions such as B-7.
  • a phage-display system can be used to expand antibody molecule populations in vitro.
  • human antibodies may be produced in a non-human transgenic animal, e.g., a transgenic mouse capable of producing multiple isotypes of human antibodies to protein (e.g., IgG, IgA, and/or IgE) by undergoing V-D-J recombination and isotype switching.
  • a non-human transgenic animal e.g., a transgenic mouse capable of producing multiple isotypes of human antibodies to protein (e.g., IgG, IgA, and/or IgE) by undergoing V-D-J recombination and isotype switching.
  • this aspect applies to antibodies, antibody fragments, and pharmaceutical compositions thereof, but also non-human transgenic animals, B-cells, host cells, and hybridomas that produce monoclonal antibodies.
  • Applications of humanized antibodies include, but are not limited to, detect a cell expressing an anticipated protein, either in vivo or in vitro, pharmaceutical preparations containing the antibodies of the present invention, and methods of treating disorders by administer
  • Fully human antibodies can be produced by immunizing transgenic animals (usually mice) that are capable of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production.
  • Antigens for this purpose typically have six or more contiguous amino acids, and optionally are conjugated to a carrier, such as a hapten.
  • a carrier such as a hapten.
  • transgenic animals are produced by incapacitating the endogenous mouse immunoglobulin loci encoding the mouse heavy and light immunoglobulin chains therein, and inserting into the mouse genome large fragments of human genome DNA containing loci that encode human heavy and light chain proteins. Partially modified animals, which have less than the full complement of human immunoglobulin loci, are then crossbred to obtain an animal having all of the desired immune system modifications. When administered an immunogen, these transgenic animals produce antibodies that are immunospecific for the immunogen but have human rather than murine amino acid sequences, including the variable regions. For further details of such methods, see, for example, International Patent Application Publication Nos.
  • mice described above contain a human immunoglobulin gene minilocus that encodes unrearranged human heavy (m and ?) and ? light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous m and ? chain loci (Lonberg et al., Nature 368:856-859 (1994)). Accordingly, the mice exhibit reduced expression of mouse IgM or ? chains and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG ? monoclonal antibodies (Lonberg et al., supra; Lonberg and Huszar, Intern. Ref. Immunol.
  • HuMAb mice The preparation of HuMAb mice is described in detail in Taylor et al., Nucl. Acids Res. 20:6287-6295 (1992); Chen et al., Int. Immunol. 5:647-656 (1993); Tuaillon et al., J. Immunol. 152:2912-2920 (1994); Lonberg et al., supra; Lonberg, Handbook of Exp. Pharmacol. 113:49-101 (1994); Taylor et al., Int. Immunol. 6:579-591 (1994); Lonberg and Huszar, Intern. Ref.
  • WO 93/1227; WO 92/22646; and WO 92/03918 the disclosures of all of which are hereby incorporated by reference in their entirety for all purposes.
  • Technologies utilized for producing human antibodies in these transgenic mice are disclosed also in WO 98/24893, and Mendez et al., Nat. Genetics 15:146-156 (1997), which are herein incorporated by reference.
  • the HCo7 and HCol2 transgenic mice strains can be used to generate human antibodies.
  • antigen-specific humanized monoclonal antibodies with the desired specificity can be produced and selected from the transgenic mice such as those described above. Such antibodies may be cloned and expressed using a suitable vector and host cell, or the antibodies can be harvested from cultured hybridoma cells. Fully human antibodies can also be derived from phage-display libraries (as disclosed in Hoogenboom et al., J. Mol. Biol. 227:381 (1991); and Marks et al., J. Mol. Biol. 222:581 (1991)). One such technique is described in International Patent Application Publication No. WO 99/10494 (herein incorporated by reference), which describes the isolation of high affinity and functional agonistic antibodies for MPL- and msk-receptors using such an approach.
  • Antibody fragments that retain the ability to recognize the antigen of interest will also find use herein.
  • a number of antibody fragments are known in the art that comprise antigen-binding sites capable of exhibiting immunological binding properties of an intact antibody molecule and can be subsequently modified by methods known in the arts.
  • Functional fragments including only the variable regions of the heavy and light chains, can also be produced using standard techniques such as recombinant production or preferential proteolytic cleavage of immunoglobulin molecules. These fragments are known as Fv. See, e.g., Inbar et al., Proc. Nat. Acad. Sci. USA 69:2659-2662 (1972); Hochman et al., Biochem. 15:2706-2710 (1976); and Ehrlich et al., Biochem. 19:4091-4096 (1980).
  • Single-chain variable fragments may be prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
  • scFvs can form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al., Prot. Eng. 10:423 (1997); Kort et al., Biomol. Eng. 18:95-108 (2001)).
  • VL- and VH-comprising polypeptides By combining different VL- and VH-comprising polypeptides, one can form multimeric scFvs that bind to different epitopes (Kriangkum et al., Biomol. Eng. 18:31-40 (2001)). Antigen-binding fragments are typically produced by recombinant DNA methods known to those skilled in the art.
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined using recombinant methods by a synthetic linker that enables them to be made as a single chain polypeptide (known as single chain Fv (sFv or scFv); see e.g., Bird et al., Science 242:423-426 (1988); and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883 (1988).
  • Design criteria include determining the appropriate length to span the distance between the C-terminus of one chain and the N-terminus of the other, wherein the linker is generally formed from small hydrophilic amino acid residues that do not tend to coil or form secondary structures.
  • Suitable linkers generally comprise polypeptide chains of alternating sets of glycine and serine residues, and may include glutamic acid and lysine residues inserted to enhance solubility.
  • Antigen-binding fragments are screened for utility in the same manner as intact antibodies. Such fragments include those obtained by amino-terminal and/or carboxy-terminal deletions, where the remaining amino acid sequence is substantially identical to the corresponding positions in the naturally occurring sequence deduced, for example, from a full- length cDNA sequence.
  • Antibodies may also be generated using peptide analogs of the epitopic determinants disclosed herein, which may consist of non-peptide compounds having properties analogous to those of the template peptide. These types of non-peptide compound are termed “peptide mimetics” or “peptidomimetics”. Fauchere, J. Adv. Drug Res. 15:29 (1986); Veber and Freidinger TINS p. 392 (1985); and Evans et al., J. Med. Chem. 30:1229 (1987). Liu et al.
  • ABSiPs antibody like binding peptidomimetics
  • These analogs can be peptides, non-peptides or combinations of peptide and non-peptide regions. Fauchere, Adv. Drug Res. 15:29 (1986); Veber and Freidiner, TINS p. 392 (1985); and Evans et al., J. Med. Chem. 30:1229 (1987), which are incorporated herein by reference in their entirety for any purpose.
  • Peptide mimetics that are structurally similar to therapeutically useful peptides may be used to produce a similar therapeutic or prophylactic effect.
  • peptidomimetics of the invention are proteins that are structurally similar to an antibody displaying a desired biological activity, such as the ability to bind a protein, but have one or more peptide linkages optionally replaced by a linkage selected from: — CH2NH — , — CH2S — , — CH2 — CH2 — , — CH-CH— (cis and trans), — COCH2 — , — CH(OH)CH2 — , and — CH2SO — by methods well known in the art.
  • Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type may be used in certain embodiments of the invention to generate more stable proteins.
  • constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation may be generated by methods known in the art (Rizo and Gierasch, Ann. Rev. Biochem. 61:387 (1992), incorporated herein by reference), for example, by adding internal cysteine residues capable of forming intramolecular disulfide bridges which cyclize the peptide.
  • a phage display library can be used to improve the immunological binding affinity of the Fab molecules using known techniques. See, e.g., Figini et al., J. Mol. Biol. 239:68 (1994).
  • the coding sequences for the heavy and light chain portions of the Fab molecules selected from the phage display library can be isolated or synthesized and cloned into any suitable vector or replicon for expression. Any suitable expression system can be used.
  • nucleic acid molecule encoding antibody polypeptides e.g., heavy or light chain, variable domain only, or full-length. These may be generated by methods known in the art, e.g., isolated from B cells of mice that have been immunized and isolated, phage display, expressed in any suitable recombinant expression system and allowed to assemble to form antibody molecules.
  • the nucleic acid molecules may be used to express large quantities of recombinant antibodies or to produce chimeric antibodies, single chain antibodies, immunoadhesins, diabodies, mutated antibodies, and other antibody derivatives. If the nucleic acid molecules are derived from a non-human, non-transgenic animal, the nucleic acid molecules may be used for antibody humanization.
  • contemplated are expression vectors comprising a nucleic acid molecule encoding a polypeptide of the desired sequence or a portion thereof (e.g., a fragment containing one or more CDRs or one or more variable region domains).
  • Expression vectors comprising the nucleic acid molecules may encode the heavy chain, light chain, or the antigen binding portion thereof.
  • expression vectors comprising nucleic acid molecules may encode fusion proteins, modified antibodies, antibody fragments, and probes thereof.
  • vectors and expression vectors may contain nucleic acid sequences that serve other functions as well.
  • DNAs encoding partial or full-length light and heavy chains are inserted into expression vectors such that the gene area is operatively linked to transcriptional and translational control sequences.
  • expression vectors used in any of the host cells contain sequences for plasmid or virus maintenance and for cloning and expression of exogenous nucleotide sequences.
  • flanking sequences typically include one or more of the following operatively linked nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
  • a promoter one or more enhancer sequences
  • an origin of replication a transcriptional termination sequence
  • a complete intron sequence containing a donor and acceptor splice site a sequence encoding a leader sequence for polypeptide secretion
  • ribosome binding site a sequence encoding a leader sequence for polypeptide secretion
  • polyadenylation sequence a polylinker region for inserting the nucleic acid encoding the polypeptid
  • Prokaryote- and/or eukaryote-based systems can be employed for use with an embodiment to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides.
  • Commercially and widely available systems include in but are not limited to bacterial, mammalian, yeast, and insect cell systems.
  • Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
  • Those skilled in the art are able to express a vector to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide using an appropriate expression system.
  • nucleic acid delivery to effect expression of compositions are anticipated to include virtually any method by which a nucleic acid (e.g., DNA, including viral and nonviral vectors) can be introduced into a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art.
  • a nucleic acid e.g., DNA, including viral and nonviral vectors
  • Such methods include, but are not limited to, direct delivery of DNA such as by injection (U.S. Patents 5,994,624,5,981,274, 5,945,100, 5,780,448, 5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated herein by reference), including microinjection (Harland and Weintraub, 1985; U.S.
  • Patent 5,789,215 incorporated herein by reference
  • electroporation U.S. Patent No. 5,384,253, incorporated herein by reference
  • calcium phosphate precipitation Graham and Van Der Eb, 1973; Chen and Okayama, 1987; Rippe et ah, 1990
  • DEAE dextran followed by polyethylene glycol
  • direct sonic loading Fechheimer et ah, 1987
  • liposome mediated transfection Nicolau and Sene, 1982; Fraley et al., 1979; Nicolau et al., 1987; Wong et al., 1980; Kaneda et al., 1989; Kato et al., 1991
  • microprojectile bombardment PCT Application Nos.
  • Other methods include viral transduction, such as gene transfer by lentiviral or retroviral transduction.
  • contemplated are the use of host cells into which a recombinant expression vector has been introduced.
  • Antibodies can be expressed in a variety of cell types.
  • An expression construct encoding an antibody can be transfected into cells according to a variety of methods known in the art.
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
  • the antibody expression construct can be placed under control of a promoter that is linked to T-cell activation, such as one that is controlled by NFAT- 1 or NF-??, both of which are transcription factors that can be activated upon T-cell activation.
  • Control of antibody expression allows T cells, such as tumor- targeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells.
  • T cells such as tumor- targeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells.
  • T cells such as tumor- targeting T cells
  • cytokine signaling both in the T cells themselves and in surrounding endogenous immune cells.
  • One of skill in the art would understand the conditions under which to incubate host cells to maintain them and to permit replication of a vector.
  • techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by
  • a selectable marker e.g., for resistance to antibiotics
  • Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods known in the arts.
  • nucleic acid molecule encoding either or both of the entire heavy and light chains of an antibody or the variable regions thereof may be obtained from any source that produces antibodies. Methods of isolating mRNA encoding an antibody are well known in the art. See e.g., Sambrook et ak, supra. The sequences of human heavy and light chain constant region genes are also known in the art. See, e.g., Kabat et ak, 1991, supra. Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed in a cell into which they have been introduced and the antibody isolated. VII. Administration of Therapeutic Compositions
  • the therapy provided herein may comprise administration of a combination of therapeutic agents, such as a first cancer therapy and a second cancer therapy.
  • the therapies may be administered in any suitable manner known in the art.
  • the first and second cancer treatment may be administered sequentially (at different times) or concurrently (at the same time).
  • the first and second cancer treatments are administered in a separate composition.
  • the first and second cancer treatments are in the same composition.
  • Embodiments of the disclosure relate to compositions and methods comprising therapeutic compositions.
  • the different therapies may be administered in one composition or in more than one composition, such as 2 compositions, 3 compositions, or 4 compositions.
  • Various combinations of the agents may be employed.
  • the therapeutic agents of the disclosure may be administered by the same route of administration or by different routes of administration.
  • the cancer therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the appropriate dosage may be determined based on the type of disease to be treated, severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.
  • the treatments may include various “unit doses.”
  • Unit dose is defined as containing a predetermined-quantity of the therapeutic composition.
  • the quantity to be administered, and the particular route and formulation, is within the skill of determination of those in the clinical arts.
  • a unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time.
  • a unit dose comprises a single administrable dose.
  • doses include doses of about 0.1, 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, and 200, 300, 400,
  • Such doses can be administered at multiple times during a day, and/or on multiple days, weeks, or months.
  • the effective dose of the pharmaceutical composition is one which can provide a blood level of about 1 pM to 150 pM.
  • the effective dose provides a blood level of about 4 pM to 100 pM.; or about 1 pM to 100 pM; or about 1 pM to 50 pM; or about 1 pM to 40 pM; or about 1 pM to 30 pM; or about 1 pM to 20 pM; or about 1 pM to 10 pM; or about 10 pM to 150 pM; or about 10 pM to 100 pM; or about 10 pM to 50 pM; or about 25 pM to 150 pM; or about 25 pM to 100 pM; or about 25 pM to 50 pM; or about 50 pM to 150 pM; or about 50 pM to 100 pM (or any range derivable therein).
  • the dose can provide the following blood level of the agent
  • the therapeutic agent that is administered to a subject is metabolized in the body to a metabolized therapeutic agent, in which case the blood levels may refer to the amount of that agent.
  • the blood levels discussed herein may refer to the unmetabolized therapeutic agent.
  • Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the patient, the route of administration, the intended goal of treatment (alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance or other therapies a subject may be undergoing.
  • dosage units of pg/kg or mg/kg of body weight can be converted and expressed in comparable concentration units of pg/ml or mM (blood levels), such as 4 pM to 100 pM. It is also understood that uptake is species and organ/tissue dependent. The applicable conversion factors and physiological assumptions to be made concerning uptake and concentration measurement are well-known and would permit those of skill in the art to convert one concentration measurement to another and make reasonable comparisons and conclusions regarding the doses, efficacies and results described herein.
  • kits containing compositions of the invention or compositions to implement methods of the invention.
  • kits can be used to evaluate one or more biomarkers.
  • a kit contains, contains at least or contains at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
  • kits for evaluating biomarker activity in a cell there are kits for evaluating biomarker activity in a cell.
  • Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means.
  • Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as lx, 2x, 5x, lOx, or 20x or more.
  • Kits for using probes, synthetic nucleic acids, nonsynthetic nucleic acids, and/or inhibitors of the disclosure for prognostic or diagnostic applications are included as part of the disclosure.
  • any such molecules corresponding to any biomarker identified herein which includes nucleic acid primers/primer sets and probes that are identical to or complementary to all or part of a biomarker, which may include noncoding sequences of the biomarker, as well as coding sequences of the biomarker.
  • kits may include a sample that is a negative or positive control for methylation of one or more biomarkers.
  • a control includes a nucleic acid that contains at least one CpG or is capable of identifying a CpG methylation site.
  • any method or composition described herein can be implemented with respect to any other method or composition described herein and that different embodiments may be combined.
  • the claims originally filed are contemplated to cover claims that are multiply dependent on any filed claim or combination of filed claims.
  • Any embodiment of the disclosure involving specific biomarker by name is contemplated also to cover embodiments involving biomarkers whose sequences are at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to the mature sequence of the specified nucleic acid.
  • kits for analysis of a pathological sample by assessing biomarker profile for a sample comprising, in suitable container means, two or more biomarker probes, wherein the biomarker probes detect one or more of the biomarkers identified herein.
  • the kit can further comprise reagents for labeling nucleic acids in the sample.
  • the kit may also include labeling reagents, including at least one of amine-modified nucleotide, poly(A) polymerase, and poly(A) polymerase buffer. Labeling reagents can include an amine- reactive dye.
  • CGRP calcitonin gene-related peptide
  • CGRP-mAb (felanezumab (TEV-48125)] selectively modulates meningeal sensory fibers (Melo-Carrillo et al., 2017a).
  • CSD cortical spreading depression
  • TEV-48125 inhibited activation and sensitization of high threshold trigeminal system neurons after CSD.
  • TEV-48125 inhibited naive high threshold neurons and reduced their activation following stimulation of the intracranial dura, but not the facial skin or cornea.
  • TEV-481245 had no effect on wide dynamic range neurons of the caudal trigeminal nucleus.
  • TEV-48125 did not directly inhibit CSD, it did reduce CSD-based activation of Ad fibers but not activation of C-fiber afferents in the trigeminal ganglion (Melo- Carrillo et al., 2017b).
  • the authors suggest that this differential impact on activation of mechanosensitive primary afferent meningeal nociceptors may explain why the CGRP-mAb is not effective in all patients.
  • C-fibers are the source of CGRP in the trigeminal ganglion, and release CGRP upon activation (e.g., from CSD and by extension migraine).
  • Ad fibers are activated in response to CGRP, an effect that is inhibited by TEV-48125.
  • IGF-1 insulin-like growth factor-1
  • the inventors are developing IGF-1 as a novel, naturally-occurring migraine treatment.
  • IGF-1 reduces the hyperexcitability and oxidative stress needed to trigger CSD, and the inventors reason the hyperexcitability and oxidative stress known to occur in the trigeminal system with models of migraine.
  • the inventors work is based on research into understanding how increased physical and intellectual activity (i.e., environmental enrichment) reduces susceptibility to CSD. In humans, increased physical activity reduces susceptibility to migraine.
  • IGF-1 increases with environmental enrichment and enters brain with increased neural activity from sensory stimulation.
  • IGF- 1 is significantly protective against CSD. This effect involves abrogation of microglial-derived oxidative stress, which otherwise triggers the hyperexcitability burst needed to initiate CSD. Also, IGF-1 significantly protects against CSD after nose-to-brain (N2B) administration in vivo to adult rats (Grinberg et ak, 2017).
  • N2B IGF-1 to reduce trigeminal system activation from recurrent CSD (Won and Kraig 2019a, b, 2020).
  • the points enumerated below emphasize the utility of combining IGF-1 with a representative CGRP-mAb as a combined therapy.
  • 1) N2B administration of IGF-1 to adult rats did not induce nociceptive activation of the trigeminal nucleus as would be expected if such delivery causes headache, a side effect seen in up to 5% of patients treated with systemic IGF-1 for short stature.
  • Migraine is an immense healthcare burden that costs $30 billion a year in the United States alone.
  • New CGRP-mAbs represent a therapeutic means to mitigate the impact of migraine in many patients.
  • the differential impact on activation of mechanosensitive primary afferent meningeal nociceptors may begin to explain why CGRP-mAbs are not effective in all patients.
  • Another important of consideration is that while these agents reduce nociceptive activation by blocking pain related CGRP in the trigeminal system, they do so without impacting the underlying causes of migraine - brain hyperexcitability and oxidative stress.
  • improvement of therapies that extend from the basic physiology of CGRP-mAbs are warranted.
  • the inventors suggest that combining CGRP-mAbs with other anti-migraine agents may provide added relief compared to individual agents alone.
  • This project will determine the utility of combined treatment with a representative CGRP-mAb and nasal delivery of IGF-1 as a therapeutic against trigeminal system activation associated with migraine.
  • Migraine will be modeled via intraperitoneal injection of nitroglycerin (NTG) in rats (Moye and Pradhan, 2017). Two days before NTG treatment, animals will be administered subcutaneous CGRP-mAb (30 mg/kg) or isotype antibody control. Then the day before NTG injection, rats will be anesthetized with inhalational isoflurane [ ⁇ 5% via nasal mask in oxygen with temperature (37 ⁇ 0.5°C) and arterial oxygen (95-100 mm Hg) monitoring] and given human recombinant IGF-1 (150 pg) in 50 pL succinate buffer or vehicle (50 pL of succinate buffer) intranasally over 20 minutes (Grinberg et ak, 2017).
  • NTG nitroglycerin
  • rats will be returned to single animal standard housing. 24 hours later, rats will briefly restrained and given an intraperitoneal injection of NTG.
  • a stock of 5 mg/mL pharmaceutical grade NTG in 30% alcohol, 30% propylene glycol, and water will be freshly diluted each day with 0.9% saline to obtain a final concentration of 1 mg/mL NTG in 6% alcohol, 6% propylene glycol in 0.9% saline. Dilution of the NTG stock is needed to achieve a lower alcohol and propylene glycol concentration which does not affect pain related indices (mechanical sensitivity) when used as a vehicle for mouse chronic migraine studies [Moye And Pradhan, 2017).
  • Animal groups will consist of: 1) naive controls; 2) treatment with IP NTG; 3) treatment with IP NTG vehicle; 4) treatment with IP NTG and SQ CGRP-mAbs; 5) treatment with IP NTG and SQ isotype antibody control; 6) treatment with IP NTG and nasally delivered IGF-1; 7) treatment with IP NTG and nasally delivered succinate buffer; 8) treatment with IP NTG and SQ CGRP-mAb plus nasally delivered IGF-1; 9) treatment with IP NTG and SQ CGRP-mAb plus nasally delivered succinate buffer; and 10) treatment with IP NTG and SQ isotype antibody control plus nasally delivered IGF-1.
  • Endpoints The endpoints for this project are to harvest brain and trigeminal ganglia tissues for immunohistochemical analyses following perfusion with fixative 4 hours post-NTG injection. Trigeminal ganglion measurements will be: immunohistochemical assays of CGRP and oxidative stress. Caudal trigeminal nucleus measurements will be assays of superficial laminae c-fos immunostaining. Blood will be collected from cardiac puncture for CGRP levels immediately before perfusion-fixation.
  • Example 2 Insulin-Like Growth Factor-1 Inhibits Spreading Depression-Induced Trigeminal Calcitonin Gene Related Peptide, Oxidative Stress & Neuronal Activation in Rat [0230]
  • Migraineurs show brain hyperexcitability and increased oxidative stress. Since hyperexcitability enhances oxidative stress and oxidative stress promotes hyperexcitability, ending this vicious feed-back loop may lead to novel therapeutics for migraine.
  • Spreading depression the most likely cause of migraine aura and perhaps pain, triggers oxidative stress not only in the cortical area involved in spreading depression, but also in the trigeminal system, a locus important to pain pathway activation in migraine.
  • oxidative stress causes increased trigeminal calcitonin gene-related peptide release and oxidative stress can reduce spreading depression threshold.
  • insulin-like growth factor- 1 significantly protects against spreading depression in vitro by reducing oxidative stress. Additionally, insulin-like growth factor- 1 significantly protects against spreading depression after nasal administration in vivo to adult rats.
  • CNS hyperexcitability occurs in migraine patients (1) along with increased levels of oxidative stress (OS) (2, 3). Since hyperexcitability enhances OS and OS promotes hyperexcitability, unraveling this vicious cycle especially as it relates to the trigeminal system (TS) may lead to novel therapeutics for migraine (4, 5).
  • Shatillo and colleagues (6) show that neocortical spreading depression (SD), the most likely cause of migraine aura and perhaps pain (7, 8), triggers OS not only in the cortical area involved in SD, but also the TS, a locus important to pain pathway activation in migraine (9). They also note that OS can increase calcitonin gene- related peptide (CGRP) release in dorsal root ganglion neurons (6).
  • SD neocortical spreading depression
  • TS trigeminal system
  • Anti-CGRP biologies designed to block migraine pain are now available and are making important improvements to migraine treatment. However, they do not prevent the root cause of migraine (10, 11) and may be no more effective than existing therapeutics (12). Thus, there is an unmet need for therapeutics to treat frequent migraine sufferers more effectively.
  • N2B Nose-to-brain (N2B) treatment
  • N2B delivery of 150 pg human recombinant IGF-1 (#191-G1; R&D Systems, Minneapolis, MN) in 50 pL sodium succinate buffer followed the previously described approach (21,51) that was based on the techniques of Liu and coworkers (24) in the recording laboratory under isoflurane anesthesia with spontaneous ventilation.
  • Sections for MDA immunohistochemistry of the trigeminal ganglion were blocked in 10% normal donkey serum containing 0.3% Triton X-100 (diluent buffer) for 1 hour at room temperature and then incubated overnight in primary antibody (Table 1) in diluent buffer at 4°C. Sections were rinsed with PBS and incubated in secondary antibody (Table 1) for 1 hour at room temperature.
  • brainstem/cervical spinal cord was cut into 40 pm thick coronal sections using a cryostat. Six consecutive sections were collected every 1.5 mm from the obex (0 mm) caudally through cervical spinal cord (i.e., -1.5 mm, -3.0 mm, -4.5 mm, 6.0 mm) as previously described (8, 26).
  • c-fos immunohistochemistry was performed on free floating sections by incubating in 10% normal donkey serum containing 0.3% Triton X-100 for 1 hour at room temperature and then overnight in rabbit anti-c-fos (Table 1) in diluent buffer at 4°C. Sections were rinsed with PBS and incubated in 2o antibody (Table 1) for 1 hour at room temperature. The sections were rinsed with PBS and mounted on gelatin coated slides.
  • Imaging was performed using a Photometries self-calibrating digital camera QuantEM-512SC camera (500 x 500 pixels; Photometries, Arlington, AZ) run on MetaMorph software (v. 7.0.4; Molecular Devices, Sunnyvale, CA) under blinded conditions (as previously described (13, 20-22).
  • Image exposure, camera gain and thresholding were uniformly set (i.e., equivalently for experimental and sham groups for each imaging metric (i.e., MDA, CGRP and c-fos).
  • Resultant images were digitally stored as TIFF files for subsequent analyses that continued under blinded conditions where image integrated fluorescence intensity was registered using MetaMorph software for MDA and CGRP.
  • Blood was collected via cardiac puncture using a 21 gauge syringe needle and transferred into a BD Vacutainer K3 EDTA blood collection tube (366450, Becton, Dickinson & Co., Franklin Lakes, NJ). Samples were spun 1,500 g x 10 min at 4°C. The plasma was transferred to sterile 2.0 mL, screw cap, polypropylene tubes and stored at -80°C until analysis. Plasma samples were sent to Cayman Chemical Company (Ann Arbor, Michigan) for analysis of CGRP content using ELISA methods. According to the vendor, the detection limit is ⁇ 10 pg/mL.
  • the inventors used a verified method of quantifying immunostaining ratios (experimental / sham) as a further means to reduce potential run-to-run variations in immunostaining for MDA and CGRP (25) while normalization of cell counts for c-fos positive cells were otherwise used. These maneuvers were highly successful in reducing measurement variability.
  • c-fos positive cell quantification was also performed under blinded conditions using a verified methodology (8, 26) and others. Since maximal caudal trigeminal nucleus changes in the superficial lamellae are evident at -4.5 mm caudal to the obex, the inventors report quantitative measurements at this level in the text.
  • IGF-1 (Increlex®) is FDA approved only for parenteral treatment of short stature due to primary IGF-1 deficiency in children (29). In this patient population, a subset of children receiving high doses of systemic IGF-1 exhibit hypoglycemia and headache (29). Accordingly, the inventors probed for any impact of N2B IGF-1 on blood glucose levels. In spite of the fact that evidence of radiolabeled IGF-1 can be found in blood after N2B delivery (30), the inventors did not see evidence of hypoglycemia after N2B delivery of IGF-1 (FIG. 6).
  • N2B IGF-1 inhibits trigeminal ganglion activation after recurrent SD
  • the inventors determined how IGF-1 N2B treatment impacted trigeminal ganglion activation after recurrent SD.
  • SD was triggered every ten minutes for a total of nine CSDs. Consistent with the results of Shatillo and coworkers (6), recurrent SD triggered OS in the trigeminal ganglion.
  • OS measured via MDA immunostaining in the trigeminal ganglion following recurrent SD was significantly (p ⁇ 0.001, power 1.00) reduced by 82% from pretreatment with IGF-1 (FIG. 8).
  • N2B IGF-1 inhibits caudal trigeminal nucleus activation after recurrent SD
  • the inventors (8, 26) and others (5) have shown that recurrent CSD activates neurons in the superficial lamellae of the caudal trigeminal nucleus.
  • the inventors used this trigeminal nucleus activation from CSD to test the impact of pretreatment with N2B delivery of IGF-1 (FIG. 10).
  • Trigeminal nucleus c-fos positive cell counts were less variable from animal to animal such that relative cell counts alone were sufficient to pass normality and equal variance testing. Accordingly, relative cell counts are presented.
  • N2B delivery of IGF-1 is a highly effective means to inhibit TS activation associated with migraine modeled in rats using CSD.
  • N2B IGF-1 treatment did not evoke hypoglycemia and gave no sign of increased headache, side effects that are seen in some patients given systemic delivery of IGF-1.
  • IGF-1 caused a significant reduction in naive levels of trigeminal ganglion cell CGRP.
  • the potential impact of this CGRP reduction before nociceptive activation is enhanced by results that show N2B IGF-1 also significantly reduced TS activation after recurrent CSD.
  • N2B delivery of therapeutics is increasingly recognized to be a safe and effective means to treat neurological disorders (36).
  • N2B administered IGF-1 quickly enters the brain within minutes through olfactory, and importantly, trigeminal routes.
  • Evidence shows thatN2B delivery of IGF-1 is protective against brain cell death, reducing the size of infarction from ischemia (24).
  • N2B IGF-1 delivery also has a significantly positive influence on brain function since it can reduce neuronal hyperexcitability.
  • the inventors extended this quieting impact of IGF-1 on neuronal electrical activity by showing N2B IGF-1 similarly abrogates the increased neuronal activation of the TS from recurrent SD.
  • IGF-1 passes into the brain along the olfactory and trigeminal nerves to the cerebrospinal fluid (30, 37). Soluble agents then appear to move rapidly through the cerebrospinal fluid space by bulk flow and into the brain parenchyma via flow from perivascular spaces (30, 37). This proposed route of entry is supported by biodistribution studies (30, 37).
  • focus to the trigeminal nerve and TS as the conduit to the brain from N2B delivery of therapeutics may be especially well-suited to developing migraine therapeutics since the trigeminal ganglion is the “first stop” along N2B-related passage way to the brain.
  • SD evoked by hyperexcitability from recurrent electrical stimulation requires microglia and their activation to promote release of the pro-inflammatory cytokine tumor necrosis factor alpha and reactive oxygen species, which together help to initiate SD (13, 19, 20). Conversely, treatment with IGF-1 abrogates this microglial OS and inflammatory activation and in so doing inhibits initiation of SD (19, 20).
  • OS including that from mitochondrial dysfunction, may also be a key stimulus for increased CGRP production.
  • others have shown that trigeminal ganglion CGRP levels and related c-fos activation in the caudal trigeminal nucleus after induction of migraine and therapeutic treatments are similar to the protective 44% and 48% effects, respectively, reported here (7, 39-43).
  • N2B IGF-1 effectively prevents SD ⁇ 27-fold over sham treatment (21) in comparison to pretreatment with topiramate, for example, which provides no more than a two-fold level of protection (44) against SD from KC1.
  • KC1 injection volumes here were increased to supra-threshold amounts (i.e., ⁇ 10-fold higher than that needed to induce SD) to ensure that SD occurred and TS activation could be reliably measured.
  • actual protection against CSD and TS activation may be higher than that reported here due to inhibition of SD.
  • N2B IGF-1 treatment A third potential advantage to N2B IGF-1 treatment follows from work from the Burstein laboratory. Melo-Carillo show that anti-CGRP agents selectively block Ad trigeminal electrical activity and related high threshold trigeminal nucleus neurons (45). In contrast, C- fibers, which contain CGRP and activate wide dynamic range neurons in the trigeminal nucleus, are not inhibited. The authors suggest this partial impact on the TS may account for the partial efficacy seen in treatment of migraine patients with anti-CGRP agents (45). Perhaps, N2B IGF-1 treatment will have more widespread effects because of its more global impact on migraine-rel ated pathophy si ol ogy .
  • a fourth and perhaps the most important potential advantage to N2B IGF-1 treatment for migraine involves the ability of IGF-1 to reduce OS.
  • Reactive oxygen species promote TS nociceptive activation via TRPA1 channel activation (6).
  • Increased TRPA1 signaling promotes SD, suggesting that TRPA1 channel blockade may be a potential target for improved migraine treatment due to an ability to reduce OS (41).
  • Most existing prophylactic migraine agents show some degree of anti-oxidant effect (46, 47) providing further support for targeting OS in migraine treatment.
  • TRPA1 channels appear to be a promising target for therapeutics development, considerable hurdles remain (47).
  • N2B IGF-1 showed blockade of OS, like that hoped for with TRPA1 channel blockade, including an 82% reduction in trigeminal ganglion MDA levels after recurrent SD.
  • IGF-1 insulin growth factor-1
  • EE-based science i.e., physiological stress followed by an adaptation period, cycled repeatedly (48) if it can be translated to the human condition.
  • IGF-1 seems particularly well-suited for N2B delivery for migraine because of the likely dominant entry pathway via the trigeminal nerve.
  • N2B IGF-1 delivery not only reduces brain susceptibility to migraine (modeled using SD), hyperexcitability and TS activation, but also results in decreased OS and TS CGRP levels.
  • N2B IGF-1 will mitigate the depletion of antioxidants seen in migraine that leads to worsening of this disorder (2, 3, 49, 50).
  • Oxidative stress is associated with migraine and migraine-related metabolic risk in females. Eur J Neurol. 2011; 18: 1233-1239.
  • Pusic KM Pusic AD, Kemme J, et al. Spreading depression requires microglia and is decreased by their M2a polarization from environmental enrichment. Glia. 2014; 62: 1176- 1194.
  • IGF-1 Insulin-like growth factor 1
  • Brown SM Peters R and Lawrence AB. Up-regulation of IGF-1 in the frontal cortex of piglets exposed to an environmentally enriched arena. Physiol Behav. 2017; 173: 285-292.
  • Grinberg YY van Drongelen W and Kraig RP. Insulin-like growth factor-1 lowers spreading depression susceptibility and reduces oxidative stress. J Neurochem. 2012; 122: 221- 229. 21. Grinberg YY, Zitzow LA and Kraig RP. Intranasally administered IGF-1 inhibits spreading depression in vivo. Brain Res. 2017; 1677: 47-57.
  • Thome RG Pronk GJ, Padmanabhan V, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004; 127: 481-496.
  • Insulin-like growth factor-1 inhibits spreading depression- induced trigeminal calcitonin gene related peptide, oxidative stress & neuronal activation in rat. Brain Res. 1732:146673. doi: 10.1016/j.brainres.2020.146673. Epub 2020 Jan 21. PMID: 31978377. PMCID: 6733989.
  • Example 3 Nose-to-brain insulin-like growth factor-1 abrogates trigeminal system activation from spreading depression
  • Migraine is a health care burden in need of improved therapeutics. This void has begun to be filled by focus on calcitonin gene related peptide (CGRP), an inflammatory molecule released from the trigeminal system (TS) with migraine.
  • CGRP calcitonin gene related peptide
  • New anti-CGRP drugs are antibodies designed to inhibit or absorb circulating CGRP to block nociceptive activation of the TS. As such, they do not influence the cause [i.e., underlying brain hyperexcitability (HE) and TS over activity] of migraine, but instead influence the consequence (i.e., CGRP release) which might account for their partial impact on migraine.
  • HE brain hyperexcitability
  • TS trigeminal system
  • the inventors showed that IGF-1 reduces brain HE associated with migraine modeled using spreading depression (SD) in brain slice cultures. Furthermore, nose-to-brain (N2B) delivery of IGF-1 protects against SD in whole animals. Here the inventors extend that work to determine the impact of N2B IGF-1 pretreatment a day before recurrent SD on TS activation. N2B IGF-1 significantly reduced (p ⁇ 0.001) SD-induced trigeminal ganglion oxidative stress [(OS), measured via malondialdehyde immunostaining] and immunostaining for CGRP by 82% and 44%, respectively.
  • OS SD-induced trigeminal ganglion oxidative stress
  • IGF-1 reduced CGRP in the trigeminal ganglion of naive animals (without SD activation) by 75% compared to vehicle.
  • N2B IGF-1 treatment does not appear to induce headache, a concern from systemic use of IGF-1.
  • N2B IGF-1 showed no evidence of hypoglycemia.
  • N2B IGF-1 is an effective means to abrogate TS activation associated with migraine (modeled using SD). This delivery method may be well-suited for translation to the human condition. Furthermore, while specific mechanisms for the protective impact of N2B IGF-1 treatment for migraine remain to be determined, the inventors’ data strongly support blocking OS as a key mechanism. Perhaps N2B IGF-1 will mitigate the depletion of antioxidants seen in migraine patients that leads to worsening of this disorder.
  • Migraineurs show brain hyperexcitability and increased oxidative stress (OS). Since hyperexcitability enhances OS and OS promotes hyperexcitability, ending this feed-back loop may lead to novel therapeutics for migraine.
  • Spreading depression SD
  • OS the most likely cause of migraine aura and perhaps pain, triggers OS not only in the cortical area involved in SD, but also in the trigeminal system, a locus important to pain pathway activation in migraine.
  • OS increases the release of trigeminal calcitonin gene-related peptide (CGRP), an inflammatory neuropeptide associated with nociception, and OS can reduce SD threshold.
  • CGRP trigeminal calcitonin gene-related peptide
  • IGF-1 insulin-like growth factor-1
  • FIG. 12 Paradigm (FIG. 12) for study of the impact of intranasal delivery of human recombinant IGF-1 on trigeminal system activation after spreading depression (SD).
  • IGF- 1 150 mg/mL
  • vehicle sham
  • SD 24 hours later, SD was induced every 9-10 minutes for 90 minutes via pressurized episodic micro-injections of nL amounts of 0.5 M KC1 into rostral neocortex with confirmation of SD established via electrophysiological microelectrode recordings from caudal neocortex. Representative SDs are shown.
  • tissues were harvested for immunostaining assessment of trigeminal system activation in the trigeminal ganglion using OS lipid peroxidation marker, malondialdehyde, and CGRP (C) and c-fos in the caudal trigeminal nucleus (D).
  • FIG. 14 shows a schematic adapted from Melo-Carrillo et al. (JNS, 2019) illustrates that nasal IGF-1 may impact migraine at multiple levels.
  • Example 4 Development of nasal insulin-like growth factor- 1 as a novel treatment for migraine [0285]
  • CNS hyperexcitability occurs in migraine patients along with increased levels of oxidative stress (OS). Since HE enhances OS and OS promotes HE, uncoupling this CNS cycle, especially as it relates to the trigeminal system (TS), may lead to novel therapeutics for migraine.
  • Spreading depression SD
  • the most likely cause of migraine aura and perhaps pain triggers OS not only in the cortical area involved in SD, but also the TS, a locus important to pain pathway activation in migraine.
  • OS increases calcitonin gene-related peptide (CGRP) release in the TS system.
  • TRPA1 channel blockade is increasingly emphasized as a potential target for migraine because of the ability to reduce OS, though problems have hampered this development.
  • N2B insulin-like growth factor-1 IGF-1
  • EE physical and intellectual activity
  • IGF-1 rises with environmental enrichment (EE) and enters brain with sensory stimulation.
  • EE environmental enrichment
  • the inventors previously showed that IGF-1 is significantly protective against SD using in vitro and in vivo models of migraine. This effect involves abrogation of microglial activation and OS, which triggers the HE burst needed to initiate SD.
  • N2B IGF- 1 significantly protects against SD in rats.
  • N2B pretreatment with IGF-1 also significantly (p ⁇ 0.001) reduced TS activation (as evidenced by trigeminal ganglion OS and CGRP levels; n>5/group) plus trigeminal caudal nucleus activation after recurrent SD (p ⁇ 0.003).
  • N2B IGF-1 reduces naive levels of CGRP by 75% in the trigeminal ganglion while at the same time having no hypoglycemic effect.
  • systemic delivery of IGF-1 for short stature shows > 5% incidence of headache and a more frequent incidence of hypoglycemia, these latter results support the utility of direct N2B delivery of IGF-1.
  • N2B IGF-1 delivery is an effective means to inhibit not only the HE involved in triggering migraine (modeled here as SD), but also TS activation that includes CGRP before it is released to cause pain.
  • N2B IGF-1 may act on the causes and not only the consequences (i.e., CGRP release) of migraine. Since highest levels of IGF-1 occur at the trigeminal ganglion after N2B IGF-1 in rodents, this delivery method may be well-suited for translation to the human condition.
  • IGF-1 is a naturally occurring EE-mimetic that might fulfill the promise of reducing brain and TS OS related to the hyperexcitability of migraine and in so doing present a novel therapeutic for this malady.
  • Example 5 Probing For Synergy against Migraine Modeled in Rats Using Combined Anti- CGRP-mAb and IGF-1
  • IGF-1 insulin-like growth factor-1
  • CNS hyperexcitability occurs in migraine patients along with increased levels of oxidative stress. Since hyperexcitability enhances oxidative stress and oxidative stress promotes hyperexcitability, unraveling this CNS vicious cycle especially as it relates to the trigeminal system may lead to novel therapeutics for migraine.
  • Cortical spreading depression (CSD) the most likely cause of migraine aura and perhaps pain, triggers oxidative stress not only in the cortical areas involved in CSD, but also in the trigeminal pathway, important to pain pathway activation in migraine. Oxidative stress can cause increased CGRP in the trigeminal ganglion and oxidative stress can reduce CSD threshold.
  • IGF-1 reduces the hyperexcitability and oxidative stress needed to trigger CSD, and the inventors reasoned that the hyperexcitability and oxidative stress known to occur in the trigeminal system with models of migraine.
  • This work is based on research into understanding how increased physical and intellectual activity [i.e., environmental enrichment(EE)] reduces susceptibility to CSD.
  • EEE environmental enrichment
  • IGF-1 increases with environmental enrichment and enters brain with increased neural activity from sensory stimulation.
  • the inventors show that IGF-1 is significantly protective against CSD.
  • IGF-1 significantly protects against CSD after nasal administration (which includes direct nose-to-brain delivery) in vivo to adult rats (Grinberg et ak, 2017).
  • the inventors have shown that nasal administration of IGF-1 significantly reduced naive levels of CGRP in the trigeminal ganglion by -75% (FIG. 15). The inventors have now also shown that nasal administration of IGF-1 also significantly reduced trigeminal system activation from recurrent CSD.
  • the inventors sought to define the degree to which combined treatment with intravenous administration of mouse anti -rat CGRP (ab81887 [4901]; Zeller et ak, 2008) and nasal IGF-1 mitigates trigeminal system activation compared to either agent alone.
  • This work will be done using recurrent CSD (Grinberg et ak, 2017, Won and Kraig, 2019a,b, 2020).
  • the primary objectives are to determine trigeminal ganglion levels of activation [i.e., CGRP and oxidative stress (malondialdehyde) levels] and to determine parallel measurements of trigeminocervical complex activation (i.e., c-fos).
  • the inventors have completed a full-length study examining the ability of nasal delivery of IGF-1 to reduce trigeminal system activation from recurrent CSD (Won and Kraig 2019a, b; Won and Kraig, 2020).
  • This work shows that nasal delivery of IGF-1 (150 pg in 50 pi) significantly reduces trigeminal ganglion CGRP and oxidative stress (i.e., levels of malondialdehyde) levels.
  • trigeminocervical complex c-fos positive cells were significantly reduced compared to sham (i.e., nasal delivery of 50 m ⁇ of succinate buffer) after recurrent CSD (elicited every 10 minutes for 90 minutes).
  • FIGS. 11 and 14 summarizes the inventors’ results which support the suggestion that nasal IGF-1 not only inhibits the initiation of migraine modeled in animals using CSD, but also the consequences of trigeminal system activation.
  • Migraine will be modeled using recurrent CSD (Grinberg et ak, 2019; Won and Kraig 2019a, b; Won and Kraig, 2020). Briefly, the day before recurrent CSD, animals are anesthetized with inhalational isoflurane in oxygen (2-5%) and treated with intranasal IGF-1 (150 pg in 50 pi succinate buffer).
  • a second craniotomy is placed six mm caudal to bregma and 4.5 mm lateral to the midline (for recording CSD.
  • the surgery area is wiped with Betadine and incision closed with three wound clips. Animals are allowed to awaken and then returned to overnight standard Animal Facility Housing.
  • isoflurane is raised to 5% and animals anesthetized with intraperitoneal ketamine and Xylazine followed quickly by euthanasia via intra-cardiac perfusion with 0.1 mL heparin (1,000 units/ml), then 250 ml of normal saline and finally 250 ml 4% paraformaldehyde in 0.2 M phosphate buffer.
  • Brains plus upper cervical cord and trigeminal ganglia are harvested for measurement of c-fos immunostaining in the trigeminocervical complex and CGRP and oxidative stress (malondialdehyde) levels in the trigeminal ganglion ipsilateral to CSD. Animal groups and endpoints are defined below.
  • Animal groups will consist of: 1) treatment with nasal IGF-1 + intravenous anti-CGRP-mAb; 2) treatment with nasal IGF-1; 3) treatment with intravenous anti-CGRP-mAb; 4) treatment with nasal IGF-1 + intravenous isotype control; 5) treatment with intravenous isotype control; and 6) treatment with nasal succinate buffer.
  • the endpoints for this project are to harvest brain and trigeminal ganglia tissues for immunohistochemical analyses following perfusion with fixative.
  • Trigeminal ganglion measurements are: immunohistochemical assays of CGRP and oxidative stress.
  • Trigeminocervical complex measurements are assays of laminae I and II c-fos immunostaining.
  • All data analyses are performed blinded to treatments, according to ARRIVE criteria, and statistically treated via ANOVA and post-hoc testing or t-testing as appropriate.
  • Dr. Anthony Reder Professor of Neurology at the University of Chicago, is an external monitor to ensure appropriate coding and blinding of all work, which is done by Dr. Lisa Won with Dr. Kraig performing blinded animal experiments and Dr. Kraig performing blinded analyses with Dr. Won performing staining procedures and blinded analyses of c-fos cell counting. All investigators will be authors on related publications.
  • the inventors used a verified method of quantifying immunostaining log-ratios (experimental / sham) as a further means to reduce potential run-to-run variations in immunostaining for malondialdehyde, CGRP and c-fos positive cells (Won and Kraig, 2020). Images of malondialdehyde and CGRP were analyzed in blinded pairs so that they could be converted once decoded to ratios of experimental/sham image integrated optical intensity, a sensitive metric that not only accounts for the area but also the pixel intensity of related image fluorescence.
  • a ratio e.g., IGF-l/sham
  • Results are shown in FIG. 18 and illustrate that, as expected (Won and Kraig, 2020), nasal IGF-1 treatment alone (in this case with treatment of intravenous saline) significantly reduced c-fos immunostaining from recurrent CSD elicited every nine minutes for 90 minutes.
  • nasal treatment with IGF-1 followed a day later with intravenous treatment with an anti-CGRP antibody (ab81887) further and significantly reduced c-fos activation from recurrent CSD.
  • CGRP treatment on trigeminal ganglion malondialdehyde (MDA) expression (FIG. 19).
  • MDA trigeminal ganglion malondialdehyde
  • Insulin-like growth factor-1 inhibits spreading depression- induced trigeminal calcitonin gene related peptide, oxidative stress & neuronal activation in rat. Brain Res. 1732:146673. doi: 10.1016/j.brainres.2020.146673. Epub 2020 Jan 21.
  • IGF-1 intranasal delivery of IGF-1 extends to chronic pain, in particular, widespread musculoskeletal pain as is seen in fibromyalgia. Results show that nasal delivery of IGF-1 causes a significant and continued reduction in pain-related behavior (hind-paw withdrawal to tactile stimulation) in a rat model of fibromyalgia.
  • Intrathecal IGF-1 can reduce pain (Bitar et al., 1996). However, no one has suggested delivering IGF-1 via the nasal route to treat chronic pain including fibromyalgia/chronic fatigue syndrome.
  • Dynamic thermal gradient testing coupled has been used to assess chronic systemic pain (DeSantana et al., 2013; Deuis et al., 2017; Barrot, 2012; Bardin et al., 2009).
  • FIG. 20 Electronic von Frey (FIG. 20) provides a tool to measure changes in paw withdrawal response to mechanical stimuli as a behavioral read out of pain sensitivity (nociception). Hind paw withdrawal thresholds can be assessed first at baseline and then monitored over time following injury with or without therapeutic intervention. Prior to initiating treatment, it is important that all experimental groups exhibit similar average baseline withdrawal thresholds. The change in nociceptive response is measured as the difference between each individual’s experimental and baseline withdrawal threshold measurements (Martinov et al., 2013).
  • the electronic von Frey method has been used to assess changes in hind paw tactile sensitivity in several rodent nociceptive models including venom-induced inflammation (Martinov et al., 2013), peripheral neuropathy resulting from oxiplatin treatment (Ferrier et al., 2013) and reserpine-induced fibromyalgia (Fusco et al., 2019).
  • Mechanical hyperalgesia is defined here as a reduction in the threshold (increased sensitivity) to mechanical stimulation of the hind paw (paw withdrawal threshold).
  • An electronic von Frey device (FIG. 20) will be used to stimulate the plantar surface of the left and right hind paws (see behavioral training in Project Details below). Behavioral testing is conducted in the same room where animal are housed according to a standard schedule (Table 2) ⁇
  • acid saline injected rats exhibiting mechanical hyperalgesia receive intranasal administration of 50 pi volume of either IGF-1 (150 pg/dose) or succinate buffer (vehicle) as previously described (Won and Kraig, 2020).
  • Behavioral Training Goal To determine whether intranasal administration of IGF- 1 attenuates mechanical hyperalgesia in a non-inflammatory model of long-lasting, widespread muscle pain (fibromyalgia). The method of testing is to assess the mechanical sensitivity threshold (paw withdrawal threshold) will serve as a surrogate measure of pain and will be assessed using an electronic von Frey device (FIG. 20).
  • Testing consists of placing rats in an acrylic cage module [23 cm x 24 cm X 14.6 cm (W x L x H)] which rests upon an elevated wire mesh grid floor (FIG. 21).
  • the cage is open on the bottom and divided into 2 compartments (one rat/compartment) with opaque walls to diminish interactions between rats.
  • An electronic von Frey device is used to assess mechanical sensitivity to hind paw stimulation.
  • the device consists of a portable force transducer fitted with an embedded camera and a rigid, plastic filament probe in the stimulator handle. The camera allows the recording and display of video underneath the paws.
  • the filament tip is applied from beneath the wire grid to the plantar surface (center of footpad) of the hind paw in continuous, increasing force until a paw withdrawal response is elicited (i.e., licking or shaking of the paw).
  • the force at which this response occurs is recorded automatically by the electronic device and is designated as the paw withdrawal threshold (FIG. 22).
  • Rats are acclimatized [habituation (Habl and Hab2)] to the testing environment for two days prior to conducting baseline measures. On each of the two days, rats are placed in the cage enclosure for 30 minutes to acclimatize and then returned to their home cage. The enclosure and wire mesh is cleaned with 70% ethanol prior to habituating another batch of animals.
  • Testing Rats are acclimatized in the test enclosure for 30 min. The tip of the von Frey probe is applied to the center of the footpad and the pressure gradually increased ( ⁇ 15 grams/sec) until a clear withdrawal of the paw is observed. Normal, healthy rats have paw withdrawal thresholds between 50-80 grams. Both hind paws are tested (alternating left and right) with an interval of >5 minutes between registered stimulations on the same hind paw. A minimum of five measurements for each hind paw are obtained for each rat. The enclosure and wire mesh is cleaned with 70% ethanol prior to testing another batch of animals.
  • FIGS. 20-22 and Table 1 show results of acid-induced pain threshold withdrawal responses compared to age-matched sham controls.
  • Housing included use of static micro isolator cages with com cob bedding, Enviro- dri nesting material (Shepard Specialty Papers, Watertown, TN) and nestlets (Ancare Corporation, Bellmore, NY) for enrichment. Rats were maintained in a 12-hour light-dark cycle with controlled humidity and temperature in our Central Animal Facility. Rats had free access to food and water throughout experiments and were observed daily for evidence of normal feeding, grooming and ambulatory activity. All animal procedures were approved by the Institutional Animal Care and Use Committee at the University of Chicago, were conducted in accordance with the Guidelines of the National Institutes of Health Guide for Care and Use of Laboratory Animals (2011) and were patterned after ARRIVE guidelines. [0347] Two investigators were used for all experiments.
  • baseline (BA) measurements of paw withdrawal threshold (PWT) were determined for six animal s/experiment prior to experimental treatment.
  • PWT paw withdrawal threshold
  • FIG. 23 shows results for experiment FM-6 where the paw withdrawal thresholds (PWT) were compared between injection of acid saline (pH 4.0) or vehicle (pH 7.2 saline). Paw withdrawal threshold responses show that acid saline injections caused a persistent and significant (**p ⁇ 0.01) reduction in paw withdrawal threshold measured at PD 1, PD 3, PD 6 and PD 9. This confirms the utility and reproducibility of the hind paw acid saline injection (i.e., model of fibromyalgia) strategy used in experiments described here.
  • PWT paw withdrawal thresholds
  • IGF-1 Insulin-like growth factor 1
  • GH/IGF1 axis disturbances in the fibromyalgia syndrome is there a rationale for GH treatment Pituitary. 2014 Jun;17(3):277- 83. doi: 10.1007/sl 1102-013-0486-0.
  • Insulin-like growth factor- 1 inhibits spreading depression- induced trigeminal calcitonin gene related peptide, oxidative stress & neuronal activation in rat. Brain Res. 1732:146673. doi: 10.1016/j.brainres.2020.146673.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Organic Chemistry (AREA)
  • Diabetes (AREA)
  • Pain & Pain Management (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Otolaryngology (AREA)
  • Dermatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2020/070511 2019-09-09 2020-09-09 Combination therapy for the treatment of migraines Ceased WO2021051130A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP20862880.0A EP4027984A4 (en) 2019-09-09 2020-09-09 Combination therapy for the treatment of migraines
AU2020346186A AU2020346186A1 (en) 2019-09-09 2020-09-09 Combination therapy for the treatment of migraines
JP2022515624A JP2022547948A (ja) 2019-09-09 2020-09-09 片頭痛の処置のための併用療法
CA3153776A CA3153776A1 (en) 2019-09-09 2020-09-09 Combination therapy for the treatment of migraines

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201962897686P 2019-09-09 2019-09-09
US62/897,686 2019-09-09
US201962946122P 2019-12-10 2019-12-10
US62/946,122 2019-12-10

Publications (1)

Publication Number Publication Date
WO2021051130A1 true WO2021051130A1 (en) 2021-03-18

Family

ID=74866081

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/070511 Ceased WO2021051130A1 (en) 2019-09-09 2020-09-09 Combination therapy for the treatment of migraines

Country Status (6)

Country Link
US (1) US12324827B2 (https=)
EP (1) EP4027984A4 (https=)
JP (1) JP2022547948A (https=)
AU (1) AU2020346186A1 (https=)
CA (1) CA3153776A1 (https=)
WO (1) WO2021051130A1 (https=)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023133562A1 (en) * 2022-01-07 2023-07-13 Endosome Therapeutics, Inc. Methods of treating pain
WO2025064583A1 (en) * 2023-09-18 2025-03-27 Ohio State Innovation Foundation Treating gliomas with calcitonin gene-related peptide antagonist
KR102775899B1 (ko) * 2023-12-19 2025-02-28 한림대학교 산학협력단 삽화성 편두통 및 만성 편두통 진단을 위한 정보제공 방법, 장치 및 컴퓨터 프로그램

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080194553A1 (en) * 2003-10-03 2008-08-14 Gillessen Hubert Jean-Marie Francois Use Of Compounds That Are Able To Increase The Serum Igf-1 Level For The Preparation Of A Therapeutical Composition For Treatment Of Various Disease States Associated With A Reduced Igf-1 Serum Level In Humans And Animals
US20140294761A1 (en) * 2011-07-22 2014-10-02 The University Of Chicago Treatments for migraine and related disorders
US20180162931A1 (en) * 2005-11-14 2018-06-14 Teva Pharmaceuticals International Gmbh Methods for treating headache using antagonist antibodies directed against calcitonin gene-related peptide

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0597033B1 (en) 1991-08-01 1997-04-09 Genentech, Inc. Igf-1 to improve the neural condition
US5965520A (en) * 1996-07-25 1999-10-12 Research Corporation Technologies Therapeutic treatment of rheumatoid arthritis and polymyalgia rheumatica
US6025368A (en) * 1997-02-25 2000-02-15 Celtrix Pharmaceuticals, Inc. Method for treating the symptoms of chronic stress-related disorders using IGF
EP1131344B1 (en) 1998-11-19 2005-08-03 ELAN CORPORATION, Plc Retro-inversion peptides that target gastro-intestinal tract transport receptors and use thereof
CN100439397C (zh) 2001-02-09 2008-12-03 基因技术股份有限公司 Igf-1的结晶
WO2002086105A1 (en) 2001-04-20 2002-10-31 Chiron Corporation Delivery of polynucleotide agents to the central nervous sysstem
US7439063B2 (en) 2002-06-11 2008-10-21 Burnham Institute For Medical Research Neuroprotective synergy of erythropoietin and insulin-like growth factors
US20050026823A1 (en) 2003-06-20 2005-02-03 Biomarin Pharmaceutical Inc. Use of the chaperone receptor-associated protein (RAP) for the delivery of therapeutic compounds to the brain and other tissues
CA2689549A1 (en) 2007-06-08 2008-12-18 Massachusetts Institute Of Technology Igf for the treatment of rett syndrome and synaptic disorders
US20110014117A1 (en) 2007-06-28 2011-01-20 Schering Corporation Anti-igf1r
US8197858B2 (en) 2009-02-06 2012-06-12 Mark John Zamoyski Bone microenvironment modulated seizure treatments
US20190135927A1 (en) * 2017-09-29 2019-05-09 Bhl Patent Holdings, Llc Migraine, headache, chronic pain treatment, and prophylaxis options

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080194553A1 (en) * 2003-10-03 2008-08-14 Gillessen Hubert Jean-Marie Francois Use Of Compounds That Are Able To Increase The Serum Igf-1 Level For The Preparation Of A Therapeutical Composition For Treatment Of Various Disease States Associated With A Reduced Igf-1 Serum Level In Humans And Animals
US20180162931A1 (en) * 2005-11-14 2018-06-14 Teva Pharmaceuticals International Gmbh Methods for treating headache using antagonist antibodies directed against calcitonin gene-related peptide
US20140294761A1 (en) * 2011-07-22 2014-10-02 The University Of Chicago Treatments for migraine and related disorders

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4027984A4 *

Also Published As

Publication number Publication date
EP4027984A4 (en) 2023-10-18
CA3153776A1 (en) 2021-03-18
EP4027984A1 (en) 2022-07-20
AU2020346186A1 (en) 2022-04-07
US12324827B2 (en) 2025-06-10
US20210077591A1 (en) 2021-03-18
JP2022547948A (ja) 2022-11-16

Similar Documents

Publication Publication Date Title
US11524995B2 (en) Agents, uses and methods for the treatment of synucleinopathy
KR102645242B1 (ko) 염증 질환의 치료 방법
KR102158569B1 (ko) GFRα3에 대한 인간 항체 및 이것의 사용 방법
KR20150018555A (ko) 뇌졸중 후 신경발생을 촉진시키는 세마포린-4d 결합 분자의 용도
EP3555127B1 (en) Agents, uses and methods
US12324827B2 (en) Combination therapy for the treatment of migraines
RS62454B1 (sr) Anti-asic1 antitela i njihove upotrebe
CN118922208A (zh) 用于消耗患病造血干细胞的组合物和方法
RU2849860C1 (ru) Применение связывающих cxcl13 молекул для лечения повреждения периферических нервов
WO2010112034A2 (en) Compositions and methods for treatment and diagnosis of synucleinopathies
JP2025118705A (ja) 末梢神経再生を促進するためのcxcl13結合分子の使用
HK40127009A (en) Agents, uses and methods for the treatment of synucleinopathy
HK40013648A (en) Agents, uses and methods
HK40013648B (en) Agents, uses and methods
HK1254358B (en) Agents, uses and methods for the treatment of synucleinopathy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20862880

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022515624

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3153776

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020346186

Country of ref document: AU

Date of ref document: 20200909

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020862880

Country of ref document: EP

Effective date: 20220411