WO2021050864A1 - Human cytomegalovirus vaccine - Google Patents
Human cytomegalovirus vaccine Download PDFInfo
- Publication number
- WO2021050864A1 WO2021050864A1 PCT/US2020/050392 US2020050392W WO2021050864A1 WO 2021050864 A1 WO2021050864 A1 WO 2021050864A1 US 2020050392 W US2020050392 W US 2020050392W WO 2021050864 A1 WO2021050864 A1 WO 2021050864A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hcmv
- mrna
- sequence
- dose
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/245—Herpetoviridae, e.g. herpes simplex virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7115—Nucleic acids or oligonucleotides having modified bases, i.e. other than adenine, guanine, cytosine, uracil or thymine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
- A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
- A61K9/1272—Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers comprising non-phosphatidyl surfactants as bilayer-forming substances, e.g. cationic lipids or non-phosphatidyl liposomes coated or grafted with polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/081—DNA viruses
- C07K16/085—Orthoherpesviridae (F), e.g. pseudorabies virus or Epstein-Barr virus
- C07K16/089—Cytomegalovirus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16171—Demonstrated in vivo effect
Definitions
- CMV Cytomegalovirus
- CMV seroprevalence in the United States is 50.4%, but rates of 60% to 100% have been reported in resource-poor areas.
- CMV is the most common congenital viral infection, as it affects 30,000 to 40,000 infants in the United States annually (0.6% to 2% of live births).
- congenital CMV infection in the first trimester is associated with the most adverse pregnancy outcomes, symptomatic congenital CMV can result from infection at any time during pregnancy. Approximately 30% to 35% of mothers with primary CMV infection during pregnancy will transmit the virus to the fetus; 12% of these newborns will have symptomatic disease, and approximately 4% will die in the first year of life.
- CMV-infected infants who are symptomatic at birth will develop late complications such as intellectual disability, sensorineural hearing loss, and developmental delay. Due to the significant effect that congenital CMV infection has on pediatric health, a 2017 Institute of Medicine Report places development of a CMV vaccine for the prevention of congenital CMV infection in its highest priority category. In individuals on chronic immunosuppressive medications after solid organ or hematopoietic stem cell transplantation, CMV infection that leads to graft rejection or end-organ disease is associated with high mortality. In the United States, approximately 30,000 adults receive solid organ transplants and 22,000 receive hematopoietic cell transplants annually.
- a messenger ribonucleic acid (mRNA)-based vaccine platform has been developed based on the principle and observations that target viral antigens can be produced in vivo by delivery and cellular uptake of the corresponding mRNA. The mRNA then undergoes intracellular ribosomal translation to endogenously express the protein antigens encoded by the vaccine mRNA. These mRNA-based vaccines do not enter the cellular nucleus or interact with the human genome, are nonreplicating, and are expressed transiently. mRNA vaccines thereby offer a mechanism to stimulate the endogenous production of structurally intact protein antigens in a manner that mimics wild-type viral infection and is able to induce highly targeted immune responses against infectious pathogens such as CMV.
- mRNA-based prophylactic vaccine designated herein as hCMV mRNA vaccine A
- hCMV mRNA vaccine A mRNA encoding full length CMV glycoprotein B (gB) and mRNA encoding the pentameric gH/gL/UL128/UL130/UL131A glycoprotein complex.
- Some aspects of the present disclosure provide methods for producing an antigen-specific immune response to human cytomegalovirus (hCMV) in a human subject comprising administering to a human subject a 30 ⁇ g to 200 ⁇ g dose of an immunogenic composition
- an immunogenic composition comprising (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a
- an immunogenic composition comprising (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL131A
- an immunogenic composition comprising (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL131A
- compositions for use in producing an antigen-specific immune response to human cytomegalovirus (hCMV) in a human subject wherein the use comprises administering to a human subject a 30 ⁇ g to 200 ⁇ g dose of an immunogenic composition comprising (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 poly
- compositions for use in producing an antigen-specific immune response to human cytomegalovirus (hCMV) in a human subject wherein the use comprises administering to a human subject a 30 ⁇ g to 200 ⁇ g dose of an immunogenic composition comprising (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 poly
- compositions for use in producing an antigen-specific immune response to human cytomegalovirus (hCMV) in a human subject wherein the use comprises administering to a human subject a 30 ⁇ g to 200 ⁇ g dose of an immunogenic composition comprising (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 poly
- the immunogenic composition is administered at a dose of 30 ⁇ g. In some embodiments, the immunogenic composition is administered at a dose of 90 ⁇ g. In some embodiments, the immunogenic composition is administered at a dose of 180 ⁇ g. In some embodiments, the immunogenic composition is administered at a dose of 300 ⁇ g. In some embodiments, at least two doses or at least three doses of the immunogenic composition are administered. In some embodiments, three doses of the immunogenic composition are administered. In some embodiments, doses of the immunogenic composition are administered on: Day 1; around the beginning of month 2; and around the beginning of month 6. In some embodiments, administration of a single dose of the immunogenic composition elicits serum neutralizing antibody titers against hCMV.
- the GMT of neutralizing antibodies against epithelial cell infection increases in the human subject at least 3-fold relative to baseline following a single dose, following two doses, or following three doses of the immunogenic composition. In some embodiments, the GMT of neutralizing antibodies against epithelial cell infection increases in the human subject at least 3-fold relative to baseline following two doses or following three doses of the immunogenic composition. In some embodiments, the GMT of neutralizing antibodies against epithelial cell infection increases in the human subject 9-20 fold relative to baseline following two doses of the vaccine composition. In some embodiments, the GMT of neutralizing antibodies against epithelial cell infection increases in the subject 20-40-fold relative to baseline following three doses of the vaccine composition.
- the GMR of neutralizing antibodies against epithelial cell infection in seropositive subjects administered at least 2 doses of ⁇ 30 ⁇ g of the immunogenic composition is in the range of 14-26. In some embodiments, the GMR of neutralizing antibodies against epithelial cell infection in seropositive subjects administered at least 3 doses of ⁇ 30 ⁇ g of the immunogenic composition is in the range of 14-26. In some embodiments, the GMR of neutralizing antibodies against epithelial cell infection in seropositive subjects administered at least 3 doses of ⁇ 30 ⁇ g of the immunogenic composition is in the range of 14-41. In some embodiments, the GMR is in the range of 30-41.
- the lipid nanoparticle comprises: an ionizable cationic lipid; cholesterol; 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC); and 1,2 dimyristoyl-sn- glycerol, methoxypolyethyleneglycol (DMG-PEG).
- DSPC 1,2-distearoyl-sn-glycero-3-phosphocholine
- DMG-PEG 1,2 dimyristoyl-sn- glycerol, methoxypolyethyleneglycol
- the ionizable cationic lipid comprises Compound I: In some embodiments, the lipid nanoparticle comprises a mixture of lipids comprising 20-60 mol% ionizable cationic lipid, 25-55 mol% cholesterol, 5-25 mol% DSPC, and 0.5-15 mol% DMG-PEG. In some embodiments, the lipid nanoparticle comprises a mixture of lipids comprising 45- 55 mol% ionizable cationic lipid, 35-40 mol% cholesterol, 5-15 mol% DSPC, and 1-2 mol% DMG-PEG.
- the lipid nanoparticle comprises a mixture of lipids comprising 50 mol% ionizable cationic lipid, 38.5 mol% cholesterol, 10 mol% DSPC, and 1.5 mol% DMG-PEG.
- the weight ratio of the mRNA encoding hCMV gH, gL, UL128, UL130, UL131A, and gB proteins in the vaccine composition is 1:1:1:1:1:1.
- the mRNA encoding hCMV gH, gL, UL128, UL130, UL131A, and gB proteins comprise a 1-methylpseudourine chemical modification.
- the mRNA encoding hCMV gH protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 5. In some embodiments, the mRNA encoding hCMV gH protein comprises the nucleotide sequence of sequence of SEQ ID NO: 5. In some embodiments, the mRNA encoding hCMV gL protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 6. In some embodiments, the mRNA encoding hCMV gL protein comprises the nucleotide sequence of sequence of SEQ ID NO: 6.
- the mRNA encoding hCMV UL128 protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 2. In some embodiments, the mRNA encoding hCMV UL128 protein comprises the nucleotide sequence of sequence of SEQ ID NO: 2. In some embodiments, the mRNA encoding hCMV UL130 protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 3. In some embodiments, the mRNA encoding hCMV UL130 protein comprises the nucleotide sequence of sequence of SEQ ID NO: 3.
- the mRNA encoding hCMV UL131A protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 4. In some embodiments, the mRNA encoding hCMV UL131A protein comprises the nucleotide sequence of sequence of SEQ ID NO: 4. In some embodiments, the mRNA encoding hCMV gB protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 1. In some embodiments, the mRNA encoding hCMV gB protein comprises the nucleotide sequence of sequence of SEQ ID NO: 1.
- the mRNA encoding hCMV gH protein comprises the nucleotide sequence of sequence of SEQ ID NO: 5
- the mRNA encoding hCMV gL protein comprises the nucleotide sequence of sequence of SEQ ID NO: 6
- the mRNA encoding hCMV UL128 protein comprises the nucleotide sequence of sequence of SEQ ID NO: 2
- the mRNA encoding hCMV UL130 protein comprises the nucleotide sequence of sequence of SEQ ID NO: 3
- the mRNA encoding hCMV UL131A protein comprises the nucleotide sequence of sequence of SEQ ID NO: 4
- the mRNA encoding hCMV gB protein comprises the nucleotide sequence of sequence of SEQ ID NO: 1.
- the open reading frame encoding the hCMV gH polypeptide comprises a sequence having at least 90% identity to the sequence of SEQ ID NO: 11
- the open reading frame encoding the hCMV gL polypeptide comprises a sequence having at least 90% identity to the sequence of SEQ ID NO: 12
- the open reading frame encoding the hCMV UL128 polypeptide comprises a sequence having at least 90% identity to the sequence of SEQ ID NO: 8
- the open reading frame encoding the hCMV UL130 polypeptide comprises a sequence having at least 90% identity to the sequence of SEQ ID NO: 9
- the open reading frame encoding the hCMV UL131A polypeptide comprises a sequence having at least 90% identity to the of sequence of SEQ ID NO: 10
- the open reading frame encoding the hCMV gB polypeptide comprises a sequence having at least 90% identity to the sequence of SEQ ID NO: 7.
- the immunogenic composition is administered via intramuscular injection.
- the human subject is CMV-seropositive prior to being administered the hCMV mRNA immunogenic composition.
- the human subject is CMV-seronegative prior to being administered the hCMV mRNA immunogenic composition.
- the methods provided further comprise administering to a human subject a dose of 5 ⁇ g to 100 ⁇ g of a second immunogenic composition comprising at least one messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV pp65 polypeptide, wherein the mRNA polynucleotide is formulated in at least one lipid nanoparticle.
- mRNA messenger ribonucleic acid
- the second immunogenic composition is administered at a dose of 10 ⁇ g. In some embodiments, the second immunogenic composition is administered at a dose of 40 ⁇ g. In some embodiments, the second immunogenic composition is administered at a dose of 80 ⁇ g.
- the mRNA encoding hCMV pp65 protein comprises a nucleotide sequence having at least 90% identity to the sequence of SEQ ID NO: 21. In some embodiments, the mRNA encoding hCMV pp65 protein comprises the nucleotide sequence of sequence of SEQ ID NO: 21. In some embodiments, the open reading frame encoding the hCMV pp65 polypeptide comprises a sequence having at least 90% identity to the sequence of SEQ ID NO: 23.
- the second vaccine composition is administered via intramuscular injection.
- the open reading frame encoding the hCMV gH polypeptide comprises SEQ ID NO: 11
- the open reading frame encoding the hCMV gL polypeptide comprises SEQ ID NO: 12
- the open reading frame encoding the hCMV UL128 polypeptide comprises SEQ ID NO: 8
- the open reading frame encoding the hCMV UL130 polypeptide comprises SEQ ID NO: 9
- the open reading frame encoding the hCMV UL131A polypeptide comprises SEQ ID NO: 10
- the open reading frame encoding the hCMV gB polypeptide comprises the sequence of SEQ ID NO: 7.
- the open reading frame encoding the hCMV pp65 polypeptide comprises SEQ ID NO: 23.
- Each of the limitations of the invention can encompass various embodiments of the invention. It is, therefore, anticipated that each of the limitations of the invention involving any one element or combinations of elements can be included in each aspect of the invention.
- This invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The invention is capable of other embodiments and of being practiced or of being carried out in various ways. BRIEF DESCRIPTION OF THE DRAWINGS
- the accompanying drawings are not intended to be drawn to scale. In the drawings, each identical or nearly identical component that is illustrated in various figures is represented by a like numeral.
- FIG.1 depicts an overview of the study design.
- FIG. 2 shows blood sampling time points in dose-escalation phase A.
- A blood sample for antibody-mediated immunogenicity
- S safety blood sample.
- “Visit” denotes clinic visit.
- FIG.3 shows blood sampling time points in dose escalation phase B, dose selection phase B, and sentinel-expansion phase C.
- A blood sample for antibody-mediated immunogenicity
- C blood sample for cell-mediated immunogenicity
- S safety blood sample.
- “Visit” denotes clinic visit.
- FIG.4 illustrates an overview of sequential enrollment and internal safety team safety evaluation in dose-escalation phases A and B. Abbreviations: IST, Internal Safety Team; SMC, Safety Monitoring Committee.
- FIG.5 illustrates an overview of sequential enrollment and safety evaluations in sentinel expansion phase C. Abbreviations: IST, Internal Safety Team; SMC, Safety Monitoring Committee.
- FIG.6 illustrates results of neutralizing antibodies for epithelial cell infection per- protocol set in phase A and phase B seronegative subjects. Solid grey reference line represents the baseline GMT of CMV-seropositive subjects in the study.
- FIG.8 illustrates results of neutralizing antibodies against fibroblast infection per- protocol set in phase A and B seronegative subjects.
- FIG.9 illustrates results of neutralizing antibodies fibroblast by serostatus per-protocol set in phase B by serostatus. Solid grey reference line represents the baseline GMT of CMV- seropositive subjects in the study.
- FIG.10 illustrates neutralizing antibody response against epithelial cell infection, by serostatus.
- FIG.11 illustrates neutralizing antibody response against fibroblast infection, by serostatus. *One CMV-seronegative Phase B placebo recipient had nAb titers consistent with seroconversion with onset between the Month 1 and Month 3 timepoints.
- FIG.12 illustrates neutralizing antibody response against epithelial cell infection in CMV-seronegative subjections, per-protocol set.
- FIG.13 illustrates neutralizing antibody response against fibroblast infection in CMV- seronegative participants, per protocol set.
- Serum neutralizing antibody (nAb) geometric mean titer (GMT) increased after each vaccination in a dose-related manner.
- nAb GMT against fibroblast infection approached the benchmark of natural CMV infection in the 90 ⁇ g and 180 ⁇ g treatment groups, and nAb GMT against epithelial cell infection exceeded the benchmark of natural CMV infection in all treatment groups.
- Neutralizing antibody GMTs were boosted in CMV-seropositive subjects after a single vaccination, which increased further after the second vaccination for nAb GMTs against epithelial cell infection.
- Phase A and Phase B CMV-seronegative participants seroresponses (percentage of subjects with GMTs ⁇ 4x baseline titer) were robust through the 2 nd vaccination, and continued to be robust through 12 months in Phase A, suggesting sustained antibody responses to hCMV mRNA vaccine A through at least 6 months after the 3 rd vaccination. Further, the overall safety profile of the hCMV mRNA vaccines described herein was similar to that of licensed vaccines (e.g., Gardasil and Shingrix).
- Antigens are proteins or polysaccharides capable of inducing an immune response (e.g., causing an immune system to produce antibodies against the antigens).
- antigen encompasses immunogenic proteins and immunogenic fragments that induce (or are capable of inducing) an immune response to hCMV, unless otherwise stated.
- protein encompasses peptides and the term “antigen” encompasses antigenic fragments.
- HCMV includes several surface glycoproteins that are involved in viral attachment and entry into different cell types.
- the pentameric complex composed of gH/gL/UL128/UL130/UL131A (Hahn et al., 2004; Ryckman et al., 2008; Wang and Shenk, 2005b, each of which are incorporated herein by reference), mediates entry into endothelial cells, epithelial cells, and myeloid cells.
- HCMV proteins UL128, UL130, and UL131A assemble with gH and gL proteins to form a heterologous pentameric complex, designated gH/gL/UL128-131A, found on the surface of the HCMV.
- HCMV enters cells by fusing its envelope with either the plasma membrane (fibroblasts) or the endosomal membrane (epithelial and endothelial cells). HCMV initiates cell entry by attaching to the cell surface heparan sulfate proteoglycans using envelope glycoprotein M (gM) or gB. This step is followed by interaction with cell surface receptors that trigger entry or initiate intracellular signaling.
- the entry receptor function is provided by gH/gL glycoprotein complexes.
- Different gH/gL complexes are known to facilitate entry into epithelial cells, endothelial cells, or fibroblasts.
- entry into fibroblasts requires gH/gL heterodimer
- entry into epithelial and endothelial cells requires the pentameric complex gH/gL/UL128/UL130/ UL131 in addition to gH/gL.
- different gH/gL complexes engage distinct entry receptors on epithelial/endothelial cells and fibroblasts. Receptor engagement is followed by membrane fusion, a process mediated by gB and gH/ gL.
- gB is essential for entry and cell spread.
- gB and gH/gL are necessary and sufficient for cell fusion and thus constitute the “core fusion machinery” of HCMV, which is conserved among other herpesviruses.
- the four glycoprotein complexes play a crucial role in viral attachment, binding, fusion and entry into the host cell.
- hCMV glycoproteins gB, gH, gL, gM, and gN are immunogenic and involved in the immunostimulatory response in a variety of cell types.
- UL128, UL130, and UL131A genes are relatively conserved among hCMV isolates and therefore represent an attractive target for vaccination.
- recent studies have shown that antibodies to epitopes within the pentameric gH/gL/UL128-131 complex neutralize entry into endothelial, epithelial, and other cell types, thus blocking the ability of hCMV to infect several cell types.
- the majority of neutralizing antibodies may be directed against envelope glycoproteins (Britt et al., 1990; Fouts et al., 2012; Macagno et al., 2010; Marshall et al., 1992, incorporated herein by reference), whereas robust T cell responses may be directed against the tegument protein pp65 and nonstructural proteins such as IE1 and IE2 (Blanco-Lobo et al., 2016; Borysiewicz et al., 1988; Kern et al., 2002, incorporated herein by reference).
- HCMV envelope glycoprotein complexes represent major antigenic targets of antiviral immune responses.
- RNA e.g., mRNA
- immunogenic compositions e.g., mRNA vaccines
- RNA e.g., mRNA vaccines
- mRNA e.g., mRNA vaccines
- RNA e.g., mRNA
- mRNA vaccines that include at least one polynucleotide encoding at least one hCMV antigenic polypeptide.
- HCMV RNA immunogenic compositions e.g., mRNA vaccines
- mRNA vaccines may be used to induce a balanced immune response, comprising both cellular and humoral immunity, without many of the risks associated with DNA vaccines and live attenuated vaccines.
- PCT/US2015/027400 WO 2015/164674
- PCT/US2016/058310 WO2017/070613
- HUMAN CYTOMEGALOVIRUS VACCINE International Application No.
- the hCMV immunogenic composition (e.g., mRNA vaccine) comprises: (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCM
- the weight ratio of the mRNA encoding hCMV gH, gL, UL128, UL130, UL131A, and gB proteins in the vaccine composition is 1:1:1:1:1:1.
- the hCMV immunogenic composition (e.g., vaccine) components comprise the sequences provided in Table 5.
- the hCMV immunogenic composition (e.g., mRNA vaccine) comprises an mRNA polynucleotide comprising an open reading frame encoding a hCMV mutant pp65 polypeptide (designated herein as pp65mut).
- the hCMV immunogenic composition (e.g., mRNA vaccine) comprises: (a) a messenger ribonucleic acid (mRNA) polynucleotide comprising an open reading frame encoding a hCMV gH polypeptide; (b) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gL polypeptide; (c) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL128 polypeptide; (d) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL130 polypeptide; (e) a mRNA polynucleotide comprising an open reading frame encoding a hCMV UL131A polypeptide; (f) a mRNA polynucleotide comprising an open reading frame encoding a hCMV gB
- the hCMV gH polypeptide comprises the amino acid sequence of SEQ ID NO: 19. In some embodiments, the hCMV gL polypeptide comprises the amino acid sequence of SEQ ID NO: 20. In some embodiments, the hCMV UL128 polypeptide comprises the amino acid sequence of SEQ ID NO: 16. In some embodiments, the hCMV UL130 polypeptide comprises the amino acid sequence of SEQ ID NO: 17. In some embodiments, the hCMV UL131A polypeptide comprises the amino acid sequence of SEQ ID NO: 18. In some embodiments, the hCMV gB polypeptide comprises the amino acid sequence of SEQ ID NO: 15.
- the mRNA encoding the hCMV gH polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 11. In some embodiments, the mRNA encoding the hCMV gL polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 12. In some embodiments, the mRNA encoding the hCMV UL128 polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 8. In some embodiments, the mRNA encoding the hCMV UL130 polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 9.
- the mRNA encoding the hCMV UL131A polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 10.
- the mRNA encoding the hCMV gB polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 7.
- the mRNA encoding the hCMV gH polypeptide comprises the nucleotide sequence of SEQ ID NO: 5.
- the mRNA encoding the hCMV gL polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 6.
- the mRNA encoding the hCMV UL128 polypeptide comprises the nucleotide sequence of SEQ ID NO: 2. In some embodiments, the mRNA encoding the hCMV UL130 polypeptide comprises the nucleotide sequence of SEQ ID NO: 3. In some embodiments, the mRNA encoding the hCMV UL131A polypeptide comprises the nucleotide sequence of SEQ ID NO: 4. In some embodiments, the mRNA encoding the hCMV gB polypeptide comprises the nucleotide sequence of SEQ ID NO: 1. In some embodiments, the hCMV pp65mut polypeptide comprises the amino acid sequence of SEQ ID NO: 24.
- the mRNA encoding the hCMV pp65mut polypeptide comprises an open reading frame (ORF) of the nucleotide sequence of SEQ ID NO: 23. In some embodiments, the mRNA encoding the hCMV pp65mut polypeptide comprises the nucleotide sequence of SEQ ID NO: 21. In some embodiments, the aforementioned mRNAs may further comprise a 5’ cap (e.g., 7mG(5’)ppp(5’)NlmpNp), a polyA tail (e.g., ⁇ 100 nucleotides), or a 5’ cap and a polyA tail.
- a 5’ cap e.g., 7mG(5’)ppp(5’)NlmpNp
- a polyA tail e.g., ⁇ 100 nucleotides
- the hCMV mRNA components of the immunogenic compositions (e.g., mRNA vaccines) of the present disclosure may comprise a signal sequence. It should also be understood that the hCMV mRNA components of the immunogenic compositions (e.g., mRNA vaccines) of the present disclosure may include any 5' untranslated region (UTR) and/or any 3' UTR. Exemplary UTR sequences are provided in Table 5; however, other UTR sequences (e.g., of the prior art) may be used or exchanged for any of the UTR sequences described herein. UTRs may also be omitted from the vaccine constructs provided herein.
- UTR 5' untranslated region
- the hCMV immunogenic compositions comprise at least one (one or more) ribonucleic acid (RNA) having an open reading frame encoding at least one hCMV antigen.
- RNA is a messenger RNA (mRNA) having an open reading frame encoding at least one hCMV antigen.
- the RNA e.g., mRNA
- the RNA further comprises a (at least one) 5 ' UTR, 3 ' UTR, a polyA tail and/or a 5' cap.
- Nucleic acids comprise a polymer of nucleotides (nucleotide monomers), also referred to as polynucleotides. Nucleic acids may be or may include, for example, deoxyribonucleic acids (DNAs), ribonucleic acids (RNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs, including LNA having a b- D-ribo configuration, a-LNA having an a-L-ribo configuration (a diastereomer of LNA), 2'-amino-LNA having a 2'-amino functionalization, and 2'-amino- a-LNA having a 2'-amino functionalization), ethylene nucleic acids (ENA), cyclohexenyl nucleic acids (CeNA) and/or chimeras and/or combinations thereof.
- DNAs de
- Messenger RNA is any ribonucleic acid that encodes a (at least one) protein (a naturally-occurring, non-naturally-occurring, or modified polymer of amino acids) and can be translated to produce the encoded protein in vitro, in vivo, in situ or ex vivo.
- mRNA messenger RNA
- nucleic acid sequences set forth in the instant application may recite “T”s in a representative DNA sequence but where the sequence represents RNA (e.g., mRNA), the “T”s would be substituted for “U”s.
- any of the DNAs disclosed and identified by a particular sequence identification number herein also disclose the corresponding RNA (e.g., mRNA) sequence complementary to the DNA, where each “T” of the DNA sequence is substituted with “U.”
- RNA e.g., mRNA
- An open reading frame is a continuous stretch of DNA or RNA beginning with a start codon (e.g., methionine (ATG or AUG)) and ending with a stop codon (e.g., TAA, TAG or TGA, or UAA, UAG or UGA).
- An ORF typically encodes a protein.
- the sequences disclosed herein may further comprise additional elements, e.g., 5' and 3' UTRs, but that those elements, unlike the ORF, need not necessarily be present in a vaccine of the present disclosure.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition comprises mRNAs encoding an hCMV antigen variant.
- Antigen or other polypeptide variants refers to molecules that differ in their amino acid sequence from a wild- type, native or reference sequence.
- the antigen/polypeptide variants may possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence.
- variants possess at least 50% identity to a wild-type, native or reference sequence. In some embodiments, variants share at least 80%, or at least 90% identity with a wild-type, native or reference sequence.
- Variant antigens/polypeptides encoded by nucleic acids of the disclosure may contain amino acid changes that confer any of a number of desirable properties, e.g., that enhance their immunogenicity, enhance their expression, and/or improve their stability or PK/PD properties in a subject.
- Variant antigens/polypeptides can be made using routine mutagenesis techniques and assayed as appropriate to determine whether they possess the desired property. Assays to determine expression levels and immunogenicity are well known in the art.
- PK/PD properties of a protein variant can be measured using art recognized techniques, e.g., by determining expression of antigens in a vaccinated subject over time and/or by looking at the durability of the induced immune response.
- the stability of protein(s) encoded by a variant nucleic acid may be measured by assaying thermal stability or stability upon urea denaturation or may be measured using in silico prediction. Methods for such experiments and in silico determinations are known in the art.
- an hCMV immunogenic composition (e.g., mRNA vaccine) comprises an mRNA ORF having a nucleotide sequence identified by any one of the sequences provided herein (see e.g., Table 5), or having a nucleotide sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical (including all values in between) to a nucleotide sequence identified by any one of the sequence provided herein.
- identity refers to a relationship between the sequences of two or more polypeptides (e.g.
- Identity also refers to the degree of sequence relatedness between or among sequences as determined by the number of matches between strings of two or more amino acid residues or nucleic acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (e.g., “algorithms”). Identity of related antigens or nucleic acids can be readily calculated by known methods.
- Percent (%) identity as it applies to polypeptide or polynucleotide sequences is defined as the percentage of residues (amino acid residues or nucleic acid residues) in the candidate amino acid or nucleic acid sequence that are identical with the residues in the amino acid sequence or nucleic acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity. Methods and computer programs for the alignment are well known in the art. It is understood that identity depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation.
- variants of a particular polynucleotide or polypeptide have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art.
- tools for alignment include those of the BLAST suite (Stephen F.
- FGSAA Fast Optimal Global Sequence Alignment Algorithm
- Sequence tags can be used for peptide detection, purification or localization.
- Lysines can be used to increase peptide solubility or to allow for biotinylation.
- amino acid residues located at the carboxy and amino terminal regions of the amino acid sequence of a peptide or protein may optionally be deleted providing for truncated sequences.
- Certain amino acids e.g., C-terminal or N-terminal residues may alternatively be deleted depending on the use of the sequence, as for example, expression of the sequence as part of a larger sequence which is soluble, or linked to a solid support.
- sequences for (or encoding) signal sequences, termination sequences, transmembrane domains, linkers, multimerization domains (such as, e.g., foldon regions) and the like may be substituted with alternative sequences that achieve the same or a similar function.
- cavities in the core of proteins can be filled to improve stability, e.g., by introducing larger amino acids.
- buried hydrogen bond networks may be replaced with hydrophobic resides to improve stability.
- glycosylation sites may be removed and replaced with appropriate residues. Such sequences are readily identifiable to one of skill in the art.
- sequences provided herein contain sequence tags or terminal peptide sequences (e.g., at the N-terminal or C-terminal ends) that may be deleted, for example, prior to use in the preparation of an RNA (e.g., mRNA) vaccine.
- RNA e.g., mRNA
- protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of hCMV antigens of interest.
- any protein fragment meaning a polypeptide sequence at least one amino acid residue shorter than a reference antigen sequence but otherwise identical
- the fragment is immunogenic and confers a protective immune response to the hCMV pathogen.
- an antigen includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations, relative to any of the sequences provided or referenced herein.
- Antigens/antigenic polypeptides can range in length from about 4, 6, or 8 amino acids to full length proteins.
- Stabilizing Elements Naturally-occurring eukaryotic mRNA molecules can contain stabilizing elements, including, but not limited to untranslated regions (UTR) at their 5'-end (5' UTR) and/or at their 3'-end (3' UTR), in addition to other structural features, such as a 5'-cap structure or a 3'-poly(A) tail.
- UTR untranslated regions
- Both the 5' UTR and the 3' UTR are typically transcribed from the genomic DNA and are elements of the premature mRNA. Characteristic structural features of mature mRNA, such as the 5'-cap and the 3'-poly(A) tail are usually added to the transcribed (premature) mRNA during mRNA processing.
- the hCMV immunogenic composition (e.g., mRNA vaccine) includes at least one RNA polynucleotide having an open reading frame encoding at least one antigenic polypeptide having at least one modification, at least one 5' terminal cap, and is formulated within a lipid nanoparticle.
- 5'-capping of polynucleotides may be completed concomitantly during the in vitro-transcription reaction using the following chemical RNA cap analogs to generate the 5'-guanosine cap structure according to manufacturer protocols: 3 ⁇ -O- Me-m7G(5')ppp(5') G [the ARCA cap];G(5')ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A; m7G(5')ppp(5')G (New England BioLabs, Ipswich, MA).5'-capping of modified RNA may be completed post-transcriptionally using
- Cap 1 structure may be generated using both Vaccinia Virus Capping Enzyme and a 2'-O methyl-transferase to generate: m7G(5')ppp(5')G-2'-O-methyl.
- Cap 2 structure may be generated from the Cap 1 structure followed by the 2'-O-methylation of the 5'-antepenultimate nucleotide using a 2'-O methyl- transferase.
- Cap 3 structure may be generated from the Cap 2 structure followed by the 2'-O- methylation of the 5'-preantepenultimate nucleotide using a 2'-O methyl-transferase.
- Enzymes may be derived from a recombinant source.
- the 3'-poly(A) tail is typically a stretch of adenine nucleotides added to the 3'-end of the transcribed mRNA. It can, in some instances, comprise up to about 400 adenine nucleotides.
- the length of the 3'-poly(A) tail may be an essential element with respect to the stability of the individual mRNA.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition includes one or more stabilizing elements. Stabilizing elements may include for instance a histone stem-loop. A 32 kDa stem-loop binding protein (SLBP) has been reported.
- SLBP RNA binding domain of SLBP is conserved through metazoa and protozoa; its binding to the histone stem-loop depends on the structure of the loop.
- the minimum binding site includes at least three nucleotides 5’ and two nucleotides 3' relative to the stem-loop.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition includes a coding region, at least one histone stem-loop, and optionally, a poly(A) sequence or polyadenylation signal.
- the poly(A) sequence or polyadenylation signal generally should enhance the expression level of the encoded protein.
- the encoded protein in some embodiments, is not a histone protein, a reporter protein (e.g. Luciferase, GFP, EGFP, b-Galactosidase, EGFP), or a marker or selection protein (e.g.
- the combination of a poly(A) sequence or polyadenylation signal and at least one histone stem-loop acts synergistically to increase the protein expression beyond the level observed with either of the individual elements.
- the synergistic effect of the combination of poly(A) and at least one histone stem-loop does not depend on the order of the elements or the length of the poly(A) sequence.
- the hCMV immunogenic composition e.g., mRNA vaccine
- HDE histone downstream element
- Histone downstream element includes a purine-rich polynucleotide stretch of approximately 15 to 20 nucleotides 3' of naturally occurring stem-loops, representing the binding site for the U7 snRNA, which is involved in processing of histone pre-mRNA into mature histone mRNA.
- the nucleic acid does not include an intron.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the histone stem-loop is generally derived from histone genes, and includes an intramolecular base pairing of two neighbored partially or entirely reverse complementary sequences separated by a spacer, consisting of a short sequence, which forms the loop of the structure.
- the unpaired loop region is typically unable to base pair with either of the stem loop elements. It occurs more often in RNA, as is a key component of many RNA secondary structures, but may be present in single-stranded DNA as well. Stability of the stem-loop structure generally depends on the length, number of mismatches or bulges, and base composition of the paired region. In some embodiments, wobble base pairing (non-Watson-Crick base pairing) may result.
- the at least one histone stem-loop sequence comprises a length of 15 to 45 nucleotides.
- the hCMV immunogenic composition e.g., mRNA vaccine
- an hCMV immunogenic composition (e.g., mRNA vaccine) comprises an mRNA having an ORF that encodes a signal peptide fused to the hCMV antigen.
- Signal peptides comprising the N-terminal 15-60 amino acids of proteins, are typically needed for the translocation across the membrane on the secretory pathway and, thus, universally control the entry of most proteins both in eukaryotes and prokaryotes to the secretory pathway.
- the signal peptide of a nascent precursor protein directs the ribosome to the rough endoplasmic reticulum (ER) membrane and initiates the transport of the growing peptide chain across it for processing.
- ER processing produces mature proteins, wherein the signal peptide is cleaved from precursor proteins, typically by a ER-resident signal peptidase of the host cell, or they remain uncleaved and function as a membrane anchor.
- a signal peptide may also facilitate the targeting of the protein to the cell membrane.
- a signal peptide may have a length of 15-60 amino acids.
- a signal peptide may have a length of 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids.
- a signal peptide has a length of 20-60, 25-60, 30-60, 35- 60, 40-60, 45- 60, 50-60, 55-60, 15-55, 20-55, 25-55, 30-55, 35-55, 40-55, 45-55, 50-55, 15-50, 20-50, 25-50, 30-50, 35-50, 40-50, 45-50, 15-45, 20-45, 25-45, 30-45, 35-45, 40-45, 15-40, 20- 40, 25-40, 30-40, 35-40, 15-35, 20-35, 25-35, 30-35, 15-30, 20-30, 25-30, 15-25, 20-25, or 15-20 amino acids.
- the signal peptide may comprise one of the following sequences: MDSKGSSQKGSRLLLLLVVSNLLLPQGVVG (SEQ ID NO: 25), MDWTWILFLVAAATRVHS (SEQ ID NO: 26); METPAQLLFLLLLWLPDTTG (SEQ ID NO: 22); MLGSNSGQRVVFTILLLLVAPAYS (SEQ ID NO: 27); MKCLLYLAFLFIGVNCA (SEQ ID NO: 28); MWLVSLAIVTACAGA (SEQ ID NO: 29).
- an ORF encoding an antigen of the disclosure is codon optimized. Codon optimization methods are known in the art. For example, an ORF of any one or more of the sequences provided herein may be codon optimized. Codon optimization, in some embodiments, may be used to match codon frequencies in target and host organisms to ensure proper folding; bias GC content to increase mRNA stability or reduce secondary structures; minimize tandem repeat codons or base runs that may impair gene construction or expression; customize transcriptional and translational control regions; insert or remove protein trafficking sequences; remove/add post translation modification sites in encoded protein (e.g., glycosylation sites); add, remove or shuffle protein domains; insert or delete restriction sites; modify ribosome binding sites and mRNA degradation sites; adjust translational rates to allow the various domains of the protein to fold properly; or reduce or eliminate problem secondary structures within the polynucleotide.
- Codon optimization tools, algorithms and services are known in the art – non- limiting examples include services from GeneArt (Life Technologies), DNA2.0 (Menlo Park CA) and/or proprietary methods.
- the open reading frame (ORF) sequence is optimized using optimization algorithms.
- a codon optimized sequence shares less than 95% sequence identity to a naturally-occurring or wild-type sequence ORF (e.g., a naturally-occurring or wild- type mRNA sequence encoding a hCMV antigen).
- a codon optimized sequence shares less than 90% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding a hCMV antigen). In some embodiments, a codon optimized sequence shares less than 85% sequence identity to a naturally- occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding a hCMV antigen). In some embodiments, a codon optimized sequence shares less than 80% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding a hCMV antigen).
- a codon optimized sequence shares less than 75% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding hCMV antigen). In some embodiments, a codon optimized sequence shares between 65% and 85% (e.g., between about 67% and about 85% or between about 67% and about 80%) sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding a hCMV antigen).
- a codon optimized sequence shares between 65% and 75% or about 80% sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding a hCMV antigen).
- a codon-optimized sequence encodes an antigen that is as immunogenic as, or more immunogenic than (e.g., at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 100%, or at least 200% more), than a hCMV antigen encoded by a non-codon-optimized sequence.
- the modified mRNAs When transfected into mammalian host cells, the modified mRNAs have a stability of between 12-18 hours, or greater than 18 hours, e.g., 24, 36, 48, 60, 72, or greater than 72 hours and are capable of being expressed by the mammalian host cells.
- a codon optimized RNA may be one in which the levels of G/C are enhanced.
- the G/C-content of nucleic acid molecules (e.g., mRNA) may influence the stability of the RNA.
- RNA having an increased amount of guanine (G) and/or cytosine (C) residues may be functionally more stable than RNA containing a large amount of adenine (A) and thymine (T) or uracil (U) nucleotides.
- WO02/098443 discloses a pharmaceutical composition containing an mRNA stabilized by sequence modifications in the translated region. Due to the degeneracy of the genetic code, the modifications work by substituting existing codons for those that promote greater RNA stability without changing the resulting amino acid. The approach is limited to coding regions of the RNA.
- RNA e.g., mRNA
- nucleotides and nucleosides of the present disclosure comprise standard nucleoside residues such as those present in transcribed RNA (e.g. A, G, C, or U).
- nucleotides and nucleosides of the present disclosure comprise standard deoxyribonucleosides such as those present in DNA (e.g.
- the hCMV immunogenic compositions (e.g., mRNA vaccines) of the present disclosure comprise, in some embodiments, at least one nucleic acid (e.g., RNA) having an open reading frame encoding at least one hCMV antigen, wherein the nucleic acid comprises nucleotides and/or nucleosides that can be standard (unmodified) or modified as is known in the art.
- nucleotides and nucleosides of the present disclosure comprise modified nucleotides or nucleosides.
- modified nucleotides and nucleosides can be naturally- occurring modified nucleotides and nucleosides or non-naturally occurring modified nucleotides and nucleosides. Such modifications can include those at the sugar, backbone, or nucleobase portion of the nucleotide and/or nucleoside as are recognized in the art.
- a naturally-occurring modified nucleotide or nucleoside of the disclosure is one as is generally known or recognized in the art. Non-limiting examples of such naturally occurring modified nucleotides and nucleosides can be found, inter alia, in the widely recognized MODOMICS database.
- a non-naturally occurring modified nucleotide or nucleoside of the disclosure is one as is generally known or recognized in the art.
- Non-limiting examples of such non-naturally occurring modified nucleotides and nucleosides can be found, inter alia, in published US application Nos. PCT/US2012/058519; PCT/US2013/075177; PCT/US2014/058897; PCT/US2014/058891; PCT/US2014/070413; PCT/US2015/36773; PCT/US2015/36759; PCT/US2015/36771; or PCT/IB2017/051367 all of which are incorporated by reference herein.
- nucleic acids of the disclosure can comprise standard nucleotides and nucleosides, naturally- occurring nucleotides and nucleosides, non-naturally-occurring nucleotides and nucleosides, or any combination thereof.
- Nucleic acids of the disclosure e.g., DNA nucleic acids and RNA nucleic acids, such as mRNA nucleic acids
- in some embodiments comprise various (more than one) different types of standard and/or modified nucleotides and nucleosides.
- a particular region of a nucleic acid contains one, two or more (optionally different) types of standard and/or modified nucleotides and nucleosides.
- a modified RNA nucleic acid e.g., a modified mRNA nucleic acid
- introduced to a cell or organism exhibits reduced degradation in the cell or organism, respectively, relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides.
- a modified RNA nucleic acid (e.g., a modified mRNA nucleic acid), introduced into a cell or organism, may exhibit reduced immunogenicity in the cell or organism, respectively (e.g., a reduced innate response) relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides.
- Nucleic acids e.g., RNA nucleic acids, such as mRNA nucleic acids
- nucleic acid e.g., RNA nucleic acids, such as mRNA nucleic acids.
- a “nucleoside” refers to a compound containing a sugar molecule (e.g., a pentose or ribose) or a derivative thereof in combination with an organic base (e.g., a purine or pyrimidine) or a derivative thereof (also referred to herein as “nucleobase”).
- nucleotide refers to a nucleoside, including a phosphate group.
- Modified nucleotides may by synthesized by any useful method, such as, for example, chemically, enzymatically, or recombinantly, to include one or more modified or non-natural nucleosides.
- Nucleic acids can comprise a region or regions of linked nucleosides. Such regions may have variable backbone linkages. The linkages can be standard phosphodiester linkages, in which case the nucleic acids would comprise regions of nucleotides.
- Modified nucleotide base pairing encompasses not only the standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine base pairs, but also base pairs formed between nucleotides and/or modified nucleotides comprising non-standard or modified bases, wherein the arrangement of hydrogen bond donors and hydrogen bond acceptors permits hydrogen bonding between a non-standard base and a standard base or between two complementary non-standard base structures, such as, for example, in those nucleic acids having at least one chemical modification.
- non-standard base pairing is the base pairing between the modified nucleotide inosine and adenine, cytosine or uracil.
- modified nucleobases in nucleic acids comprise 1-methyl-pseudouridine (m1 ⁇ ), 1-ethyl-pseudouridine (e1 ⁇ ), 5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), and/or pseudouridine ( ⁇ ).
- modified nucleobases in nucleic acids comprise 5-methoxymethyl uridine, 5-methylthio uridine, 1-methoxymethyl pseudouridine, 5-methyl cytidine, and/or 5-methoxy cytidine.
- the polyribonucleotide includes a combination of at least two (e.g., 2, 3, 4 or more) of any of the aforementioned modified nucleobases, including but not limited to chemical modifications.
- a mRNA of the disclosure comprises 1-methyl-pseudouridine (m1 ⁇ ) substitutions at one or more or all uridine positions of the nucleic acid.
- a mRNA of the disclosure comprises 1-methyl-pseudouridine (m1 ⁇ ) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid.
- a mRNA of the disclosure comprises pseudouridine ( ⁇ ) substitutions at one or more or all uridine positions of the nucleic acid.
- a mRNA of the disclosure comprises pseudouridine ( ⁇ ) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid.
- a mRNA of the disclosure comprises uridine at one or more or all uridine positions of the nucleic acid.
- mRNAs are uniformly modified (e.g., fully modified, modified throughout the entire sequence) for a particular modification.
- a nucleic acid can be uniformly modified with 1-methyl-pseudouridine, meaning that all uridine residues in the mRNA sequence are replaced with 1-methyl-pseudouridine.
- a nucleic acid can be uniformly modified for any type of nucleoside residue present in the sequence by replacement with a modified residue such as those set forth above.
- the nucleic acids of the present disclosure may be partially or fully modified along the entire length of the molecule.
- one or more or all or a given type of nucleotide may be uniformly modified in a nucleic acid of the disclosure, or in a predetermined sequence region thereof (e.g., in the mRNA including or excluding the polyA tail).
- nucleotides X in a nucleic acid of the present disclosure are modified nucleotides, wherein X may be any one of nucleotides A, G, U, C, or any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C or A+G+C.
- the nucleic acid may contain from about 1% to about 100% modified nucleotides (either in relation to overall nucleotide content, or in relation to one or more types of nucleotide, i.e., any one or more of A, G, U or C) or any intervening percentage (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to
- the mRNAs may contain at a minimum 1% and at maximum 100% modified nucleotides, or any intervening percentage, such as at least 5% modified nucleotides, at least 10% modified nucleotides, at least 25% modified nucleotides, at least 50% modified nucleotides, at least 80% modified nucleotides, or at least 90% modified nucleotides.
- the nucleic acids may contain a modified pyrimidine such as a modified uracil or cytosine.
- At least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the uracil in the nucleic acid is replaced with a modified uracil (e.g., a 5-substituted uracil).
- the modified uracil can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures).
- cytosine in the nucleic acid is replaced with a modified cytosine (e.g., a 5-substituted cytosine).
- the modified cytosine can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures).
- Untranslated Regions UTRs
- the mRNAs of the present disclosure may comprise one or more regions or parts which act or function as an untranslated region.
- the nucleic may comprise one or more of these untranslated regions (UTRs). Wild-type untranslated regions of a nucleic acid are transcribed but not translated. In mRNA, the 5' UTR starts at the transcription start site and continues to the start codon but does not include the start codon; whereas, the 3' UTR starts immediately following the stop codon and continues until the transcriptional termination signal. There is growing body of evidence about the regulatory roles played by the UTRs in terms of stability of the nucleic acid molecule and translation. The regulatory features of a UTR can be incorporated into the polynucleotides of the present disclosure to, among other things, enhance the stability of the molecule.
- a variety of 5’UTR and 3’UTR sequences are known and available in the art.
- a 5 ' UTR is region of an mRNA that is directly upstream (5 ') from the start codon (the first codon of an mRNA transcript translated by a ribosome).
- a 5 ' UTR does not encode a protein (is non-coding).
- Natural 5'UTRs have features that play roles in translation initiation. They harbor signatures like Kozak sequences which are commonly known to be involved in the process by which the ribosome initiates translation of many genes.
- a 5’ UTR is a heterologous UTR, i.e., is a UTR found in nature associated with a different ORF.
- a 5’ UTR is a synthetic UTR, i.e., does not occur in nature.
- Synthetic UTRs include UTRs that have been mutated to improve their properties, e.g., which increase gene expression as well as those which are completely synthetic.
- Exemplary 5’ UTRs include Xenopus or human derived a-globin or b- globin (US8278063; US9012219), human cytochrome b-245 a polypeptide, and hydroxysteroid (17b) dehydrogenase, and Tobacco etch virus (US8278063, 9012219).
- CMV immediate-early 1 (IE1) gene (US20140206753, WO2013/185069)
- the sequence GGGAUCCUACC SEQ ID NO: 31) (WO2014144196) may also be used.
- 5' UTR of a TOP gene is a 5' UTR of a TOP gene lacking the 5' TOP motif (the oligopyrimidine tract) (e.g., WO/2015101414, WO2015101415, WO/2015/062738, WO2015024667, WO2015024667; 5' UTR element derived from ribosomal protein Large 32 (L32) gene (WO/2015101414, WO2015101415, WO/2015/062738), 5' UTR element derived from the 5'UTR of an hydroxysteroid (17-b) dehydrogenase 4 gene (HSD17B4) (WO2015024667), or a 5' UTR element derived from the 5' UTR of ATP5A1 (WO2015024667) can be used.
- L32 ribosomal protein Large 32
- HSD17B4 hydroxysteroid
- HSD17B4 hydroxysteroid
- WO2015024667 or a 5' UTR element
- an internal ribosome entry site is used instead of a 5' UTR.
- a 5' UTR of the present disclosure comprises a nucleotide sequence of SEQ ID NO: 13.
- a 3 ' UTR is region of an mRNA that is directly downstream (3 ') from the stop codon (the codon of an mRNA transcript that signals a termination of translation).
- a 3 ' UTR does not encode a protein (is non-coding).
- Natural or wild type 3' UTRs are known to have stretches of adenosines and uridines embedded in them. These AU rich signatures are particularly prevalent in genes with high rates of turnover.
- AU rich elements can be separated into three classes (Chen et al, 1995): Class I AREs contain several dispersed copies of an AUUUA motif within U-rich regions. C-Myc and MyoD contain class I AREs. Class II AREs possess two or more overlapping UUAUUUA(U/A)(U/A) (SEQ ID NO: 32) nonamers. Molecules containing this type of AREs include GM-CSF and TNF-a. Class III ARES are less well defined. These U rich regions do not contain an AUUUA motif. c-Jun and Myogenin are two well-studied examples of this class.
- HuR binds to AREs of all the three classes. Engineering the HuR specific binding sites into the 3' UTR of nucleic acid molecules will lead to HuR binding and thus, stabilization of the message in vivo. 3' UTRs may be heterologous or synthetic. With respect to 3’ UTRs, globin UTRs, including Xenopus b-globin UTRs and human b-globin UTRs are known in the art (US8278063, US9012219, US20110086907).
- a modified b-globin construct with enhanced stability in some cell types by cloning two sequential human b-globin 3’UTRs head to tail has been developed and is well known in the art (US2012/0195936, WO2014/071963).
- a2-globin, a1-globin, UTRs and mutants thereof are also known in the art (WO2015101415, WO2015024667).
- Other 3' UTRs described in the mRNA constructs in the non-patent literature include CYBA (Ferizi et al., 2015) and albumin (Thess et al., 2015).
- 3' UTRs include that of bovine or human growth hormone (wild type or modified) (WO2013/185069, US20140206753, WO2014152774), rabbit b globin and hepatitis B virus (HBV), a-globin 3' UTR and Viral VEEV 3’ UTR sequences are also known in the art.
- the sequence UUUGAAUU (WO2014144196) is used.
- 3' UTRs of human and mouse ribosomal protein are used.
- Other examples include rps93’UTR (WO2015101414), FIG4 (WO2015101415), and human albumin 7 (WO2015101415).
- a 3 ' UTR of the present disclosure comprises a nucleotide sequence of SEQ ID NO: 14.
- 5’UTRs that are heterologous or synthetic may be used with any desired 3’ UTR sequence.
- a heterologous 5’UTR may be used with a synthetic 3’UTR with a heterologous 3” UTR.
- Combinations of features may be included in flanking regions and may be contained within other features.
- the ORF may be flanked by a 5' UTR which may contain a strong Kozak translational initiation signal and/or a 3' UTR which may include an oligo(dT) sequence for templated addition of a poly-A tail.
- 5' UTR may comprise a first polynucleotide fragment and a second polynucleotide fragment from the same and/or different genes such as the 5' UTRs described in US Patent Application Publication No.20100293625 and PCT/US2014/069155, herein incorporated by reference in its entirety.
- IVT in vitro transcription
- RNA transcript is generated using a non-amplified, linearized DNA template in an in vitro transcription reaction to generate the RNA transcript.
- the template DNA is isolated DNA.
- the template DNA is cDNA.
- the cDNA is formed by reverse transcription of a RNA polynucleotide, for example, but not limited to hCMV mRNA.
- cells e.g., bacterial cells, e.g., E.
- coli e.g., DH-1 cells are transfected with the plasmid DNA template.
- the transfected cells are cultured to replicate the plasmid DNA which is then isolated and purified.
- the DNA template includes a RNA polymerase promoter, e.g., a T7 promoter located 5 ' to and operably linked to the gene of interest.
- an in vitro transcription template encodes a 5' untranslated (UTR) region, contains an open reading frame, and encodes a 3' UTR and a polyA tail. The particular nucleic acid sequence composition and length of an in vitro transcription template will depend on the mRNA encoded by the template.
- a polyA tail may contain 10 to 300 adenosine monophosphates.
- a polyA tail may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290 or 300 adenosine monophosphates.
- a polyA tail contains 50 to 250 adenosine monophosphates.
- a nucleic acid includes 200 to 3,000 nucleotides.
- a nucleic acid may include 200 to 500, 200 to 1000, 200 to 1500, 200 to 3000, 500 to 1000, 500 to 1500, 500 to 2000, 500 to 3000, 1000 to 1500, 1000 to 2000, 1000 to 3000, 1500 to 3000, or 2000 to 3000 nucleotides).
- the RNA transcript is capped via enzymatic capping.
- the RNA comprises 5' terminal cap, for example, 7mG(5’)ppp(5’)NlmpNp.
- Lipid Nanoparticles LNPs
- the hCMV immunogenic compositions (mRNA vaccines) of the disclosure are formulated in one or more lipid nanoparticles (LNPs).
- Lipid nanoparticles typically comprise ionizable cationic lipid, non-cationic lipid, sterol and PEG lipid components along with the nucleic acid cargo of interest.
- the lipid nanoparticles of the disclosure can be generated using components, compositions, and methods as are generally known in the art, see for example PCT/US2016/052352; PCT/US2016/068300; PCT/US2017/037551; PCT/US2015/027400; PCT/US2016/047406; PCT/US2016000129; PCT/US2016/014280; PCT/US2017/038426; PCT/US2014/027077; PCT/US2014/055394; PCT/US2016/52117; PCT/US2012/069610; PCT/US2017/027492; PCT/US2016/059575 and PCT/US2016/069491 all of which are incorporated by reference herein in their entireties.
- Vaccines of the present disclosure are typically formulated in lipid nanoparticles.
- the lipid nanoparticle comprises at least one ionizable cationic lipid, at least one non-cationic lipid, at least one sterol, and/or at least one polyethylene glycol (PEG)-modified lipid.
- the lipid nanoparticles of the present disclosure are comprised of a mixture of lipids and the amounts are measured according to the mole faction or the mole percent of each lipid component in the lipid nanoparticle. Mole percent is obtained by multiplying the mole fraction by 100%. The mRNA and any water are not represented where the lipid mixture is accounted for numerically.
- the lipid nanoparticle comprises a mixture of lipids comprising 20-60 mol% ionizable cationic lipid.
- the lipid nanoparticle may comprise a mole percent of 20-50 mol%, 20-40 mol%, 20-30 mol%, 30-60 mol%, 30-50 mol%, 30-40 mol%, 40- 60 mol%, 40-50 mol%, or 50-60 mol% ionizable cationic lipid.
- the lipid nanoparticle comprises 20 mol%, 30 mol%, 40 mol%, 50 mol%, or 60 mol% ionizable cationic lipid.
- the lipid nanoparticle comprises a mixture of lipids comprising 5- 25 mol% non-cationic lipid.
- the lipid nanoparticle may comprise a non-cationic lipid comprising 5-20 mol%, 5-15 mol%, 5-10 mol%, 10-25 mol%, 10-20 mol%, 10-25 mol%, 15-25 mol%, 15-20 mol%, or 20-25 mol% non-cationic lipid.
- the lipid nanoparticle comprises a mixture of lipids comprising 5 mol%, 10 mol%, 15 mol%, 20 mol%, or 25 mol% non-cationic lipid.
- the lipid nanoparticle comprises a mixture of lipids comprising 25-55 mol% sterol.
- the lipid nanoparticle may comprise a sterol comprising 25-50 mol%, 25-45 mol%, 25-40 mol%, 25-35 mol%, 25-30 mol%, 30-55 mol%, 30-50 mol%, 30-45 mol%, 30-40 mol%, 30-35 mol%, 35-55 mol%, 35-50 mol%, 35-45 mol%, 35-40 mol%, 40-55 mol%, 40-50 mol%, 40-45 mol%, 45-55 mol%, 45-50 mol%, or 50-55 mol% sterol.
- the lipid nanoparticle comprises a mole percent of 25 mol%, 30 mol%, 35 mol%, 40 mol%, 45 mol%, 50 mol%, or 55 mol% sterol.
- the lipid nanoparticle comprises a mixture of lipids comprising 0.5-15 mol% PEG-modified lipid.
- the lipid nanoparticle may comprise a mole percent of 0.5-10 mol%, 0.5-5 mol%, 1-15 mol%, 1-10 mol%, 1-5 mol%, 2-15 mol%, 2-10 mol%, 2-5 mol%, 5-15 mol%, 5-10 mol%, or 10-15 mol% PEG-modified lipid.
- the lipid nanoparticle comprises a mole percent of 0.5 mol%, 1 mol%, 2 mol%, 3 mol%, 4 mol%, 5 mol%, 6 mol%, 7 mol%, 8 mol%, 9 mol%, 10 mol%, 11 mol%, 12 mol%, 13 mol%, 14 mol%, or 15 mol% PEG-modified lipid.
- the lipid nanoparticle comprises a molar ratio of 20-60% ionizable cationic lipid, 5-25% non-cationic lipid, 25-55% sterol, and 0.5-15% PEG-modified lipid.
- the lipid nanoparticle comprises a mixture of lipids comprising 49 mol% ionizable cationic lipid, 38.5 mol% cholesterol, 10 mol% DSPC, and 2.5 mol% DMG- PEG. In some embodiments, the lipid nanoparticle comprises a mixture of lipids comprising 48 mol% ionizable cationic lipid, 38.5 mol% cholesterol, 11 mol% DSPC, and 2.5 mol% DMG- PEG. In some embodiments, the lipid nanoparticle comprises a mixture of lipids comprising 47 mol% ionizable cationic lipid, 38.5 mol% cholesterol, 11.5 mol% DSPC, and 3 mol% DMG- PEG.
- an ionizable cationic lipid of the disclosure comprises a compound having structure: In some embodiments, an ionizable cationic lipid of the disclosure comprises a compound having structure: In some embodiments, a non-cationic lipid of the disclosure comprises 1,2-distearoyl-sn- glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2-dimyristoyl-sn-gly cero- phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), l,2-dipalmitoyl- sn-glycero-3-phosphocholine (DPPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-
- a PEG modified lipid of the disclosure comprises a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and mixtures thereof.
- the PEG-modified lipid is DMG-PEG, PEG-c- DOMG (also referred to as PEG-DOMG), PEG-DSG and/or PEG-DPG.
- a sterol of the disclosure comprises cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, ursolic acid, alpha- tocopherol, and mixtures thereof.
- a LNP of the disclosure comprises an ionizable cationic lipid of Compound 1, wherein the non-cationic lipid is DSPC, the structural lipid that is cholesterol, and the PEG lipid is DMG-PEG.
- the lipid nanoparticle comprises 45 – 55 mole percent ionizable cationic lipid.
- lipid nanoparticle may comprise 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, or 55 mole percent ionizable cationic lipid.
- the lipid nanoparticle comprises 5 – 15 mole percent DSPC.
- the lipid nanoparticle may comprise 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mole percent DSPC.
- the lipid nanoparticle comprises 35 – 40 mole percent cholesterol.
- the lipid nanoparticle may comprise 35, 36, 37, 38, 39, or 40 mole percent cholesterol.
- the lipid nanoparticle comprises 1 – 2 mole percent DMG-PEG.
- the lipid nanoparticle may comprise 1, 1.5, or 2 mole percent DMG-PEG.
- the lipid nanoparticle comprises 50 mole percent ionizable cationic lipid, 10 mole percent DSPC, 38.5 mole percent cholesterol, and 1.5 mole percent DMG-PEG.
- a LNP of the disclosure comprises an N:P ratio of from about 2:1 to about 30:1.
- a LNP of the disclosure comprises an N:P ratio of about 6:1.
- a LNP of the disclosure comprises an N:P ratio of about 3:1.
- a LNP of the disclosure comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of from about 10:1 to about 100:1. In some embodiments, a LNP of the disclosure comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of about 20:1. In some embodiments, a LNP of the disclosure comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of about 10:1. In some embodiments, a LNP of the disclosure has a mean diameter from about 50 nm to about 150 nm.
- a LNP of the disclosure has a mean diameter from about 70 nm to about 120 nm.
- the hCMV immunogenic compositions may include mRNA or multiple mRNAs encoding two or more antigens of the same or different hCMV species.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the mRNA of a hCMV immunogenic composition may encode 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more antigens.
- the hCMV immunogenic composition comprises at least one RNA encoding an hCMV gH, an hCMV gL, an hCMV UL128, an hCMV UL130, an hCMV UL131A, and an hCMV gB.
- the hCMV immunogenic composition (e.g., mRNA vaccine) comprises at least one RNA encoding a hCMV pp65mut.
- the hCMV immunogenic composition (e.g., mRNA vaccine) comprises at least one RNA encoding an hCMV gH, an hCMV gL, an hCMV UL128, an hCMV UL130, an hCMV UL131A, an hCMV gB, and a hCMV pp65mut.
- two or more different RNAs e.g., mRNAs
- encoding antigens may be formulated in the same lipid nanoparticle.
- RNAs encoding antigens may be formulated in separate lipid nanoparticles (e.g., each RNA formulated in a single lipid nanoparticle).
- the lipid nanoparticles may then be combined and administered as a single vaccine composition (e.g., comprising multiple RNA encoding multiple antigens) or may be administered separately.
- Pharmaceutical Formulations Provided herein are compositions (e.g., pharmaceutical compositions), methods, kits and reagents for prevention or treatment of hCMV in humans and other mammals, for example.
- hCMV mRNA vaccines can be used as therapeutic or prophylactic agents. They may be used in medicine to prevent and/or treat infectious disease.
- the hCMV immunogenic compositions e.g., mRNA vaccines
- mRNA as described herein can be administered to a subject (e.g., a mammalian subject, such as a human subject), and the RNA polynucleotides are translated in vivo to produce an antigenic polypeptide (antigen).
- a subject e.g., a mammalian subject, such as a human subject
- an “effective amount” of a hCMV immunogenic composition is based, at least in part, on the target tissue, target cell type, means of administration, physical characteristics of the RNA (e.g., length, nucleotide composition, and/or extent of modified nucleosides), other components of the vaccine, and other determinants, such as age, body weight, height, sex and general health of the subject.
- an effective amount of a hCMV immunogenic composition e.g., mRNA vaccine
- an effective amount of the hCMV immunogenic composition e.g., mRNA vaccine
- RNA polynucleotides having at least one chemical modifications are more efficient than a composition containing a corresponding unmodified polynucleotide encoding the same antigen or a peptide antigen.
- Increased antigen production may be demonstrated by increased cell transfection (the percentage of cells transfected with the RNA vaccine), increased protein translation and/or expression from the polynucleotide, decreased nucleic acid degradation (as demonstrated, for example, by increased duration of protein translation from a modified polynucleotide), or altered antigen specific immune response of the host cell.
- composition refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
- a “pharmaceutically acceptable carrier,” after administered to or upon a subject, does not cause undesirable physiological effects.
- the carrier in the pharmaceutical composition must be “acceptable” also in the sense that it is compatible with the active ingredient and can be capable of stabilizing it.
- One or more solubilizing agents can be utilized as pharmaceutical carriers for delivery of an active agent.
- a pharmaceutically acceptable carrier include, but are not limited to, biocompatible vehicles, adjuvants, additives, and diluents to achieve a composition usable as a dosage form.
- immunological compositions e.g., RNA vaccines including polynucleotides and their encoded polypeptides
- hCMV immunological composition may be administered prophylactically or therapeutically as part of an active immunization scheme to healthy individuals or early in infection during the incubation phase or during active infection after onset of symptoms.
- the amount of RNA vaccines of the present disclosure provided to a cell, a tissue or a subject may be an amount effective for immune prophylaxis.
- the hCMV immunological composition e.g., mRNA vaccine
- a prophylactic or therapeutic compound may be an adjuvant or a booster.
- booster refers to an extra administration of the prophylactic (vaccine) composition.
- a booster or booster vaccine may be given after an earlier administration of the prophylactic composition.
- the time of administration between the initial administration of the prophylactic composition and the booster may be, but is not limited to, 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 6 minutes, 7 minutes, 8 minutes, 9 minutes, 10 minutes, 15 minutes, 20 minutes 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 1 day, 36 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 10 days, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, 18 months, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, 11 years, 12 years, 13 years, 14
- the time of administration between the initial administration of the prophylactic composition and the booster may be, but is not limited to, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months or 1 year.
- the hCMV immunological compositions e.g., mRNA vaccine
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition may be utilized in various settings depending on the prevalence of the infection or the degree or level of unmet medical need.
- the RNA vaccines may be utilized to treat and/or prevent a variety of infectious disease.
- RNA vaccines have superior properties in that they produce much larger antibody titers, better neutralizing immunity, produce more durable immune responses, and/or produce responses earlier than commercially available vaccines.
- pharmaceutical compositions including the hCMV immunogenic composition (e.g., mRNA vaccine) and/or complexes optionally in combination with one or more pharmaceutically acceptable excipients.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition may comprise other components including, but not limited to, adjuvants.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition (e.g., mRNA vaccine) includes an MF59 adjuvant system (e.g., as described in O’Hagan et al., Expert Rev Vaccines.2007 Oct;6(5):699-710, incorporated herein by reference).
- the hCMV immunogenic composition (e.g., mRNA vaccine) may be formulated or administered in combination with one or more pharmaceutically-acceptable excipients.
- vaccine compositions comprise at least one additional active substances, such as, for example, a therapeutically-active substance, a prophylactically-active substance, or a combination of both.
- Vaccine compositions may be sterile, pyrogen-free or both sterile and pyrogen-free.
- General considerations in the formulation and/or manufacture of pharmaceutical agents, such as vaccine compositions, may be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference in its entirety).
- the hCMV immunogenic compositions e.g., mRNA vaccines
- the phrase “active ingredient” generally refers to the RNA vaccines or the polynucleotides contained therein, for example, RNA polynucleotides (e.g., mRNA polynucleotides) encoding antigens.
- Formulations of the vaccine compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient (e.g., mRNA polynucleotide) into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product into a desired single- or multi-dose unit.
- compositions in accordance with the disclosure will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
- the composition may comprise between 0.1% and 100%, e.g., between 0.5 and 50%, between 1-30%, between 5-80%, at least 80% (w/w) active ingredient.
- the hCMV immunogenic composition (e.g., mRNA vaccine) is formulated using one or more excipients to: (1) increase stability; (2) increase cell transfection; (3) permit the sustained or delayed release (e.g., from a depot formulation); (4) alter the biodistribution (e.g., target to specific tissues or cell types); (5) increase the translation of encoded protein in vivo; and/or (6) alter the release profile of encoded protein (antigen) in vivo.
- excipients can include, without limitation, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with the hCMV immunogenic composition (e.g., mRNA vaccine) (e.g., for transplantation into a subject), hyaluronidase, nanoparticle mimics and combinations thereof.
- hCMV immunogenic composition e.g., mRNA vaccine
- hyaluronidase e.g., for transplantation into a subject
- compositions e.g., pharmaceutical compositions
- methods, kits and reagents for prevention and/or treatment of hCMV infection in humans and other mammals can be used as therapeutic or prophylactic agents.
- RNA vaccines of the disclosure are used to provide prophylactic protection from hCMV.
- the RNA vaccines of the disclosure are used to treat a hCMV infection.
- the hCMV immunogenic composition (e.g., mRNA vaccine) of the present disclosure is used in the priming of immune effector cells, for example, to activate peripheral blood mononuclear cells (PBMCs) ex vivo, which are then infused (re-infused) into a subject.
- PBMCs peripheral blood mononuclear cells
- a subject may be any mammal, including non-human primate and human subjects.
- a subject is a human subject.
- the hCMV immunogenic composition (e.g., mRNA vaccine) is administered to a subject (e.g., a mammalian subject, such as a human subject) in an effective amount to induce an antigen-specific immune response.
- the RNA encoding the hCMV antigen is expressed and translated in vivo to produce the antigen, which then stimulates an immune response in the subject.
- the subject may be hCMV seropositive (e.g., has previously had a natural hCMV infection) or hCMV seronegative (e.g., has not previously had a natural hCMV infection) prior of being administered the hCMV immunogenic composition (e.g., mRNA vaccine).
- Prophylactic protection from hCMV can be achieved following administration of the hCMV immunogenic composition (e.g., mRNA vaccine) of the present disclosure.
- Vaccines can be administered once, twice, three times, four times or more but it is likely sufficient to administer the vaccine once (optionally followed by one or more boosters). It is possible, although less desirable, to administer the vaccine to an infected individual to achieve a therapeutic response. Dosing may need to be adjusted accordingly.
- a method of eliciting an immune response in a subject against hCMV is provided in aspects of the present disclosure.
- the method involves administering to the subject a hCMV immunogenic composition (e.g., mRNA vaccine) comprising at least one RNA (e.g., mRNA) having an open reading frame encoding at least one hCMV antigen, thereby inducing in the subject an immune response specific to a hCMV antigen, wherein anti-antigen antibody titer in the subject is increased following vaccination relative to anti-antigen antibody titer in a subject vaccinated with a prophylactically effective dose of a traditional vaccine against the hCMV.
- An “anti-antigen antibody” is a serum antibody the binds specifically to the antigen.
- a prophylactically effective dose is an effective dose that prevents infection with the virus at a clinically acceptable level.
- the effective dose is a dose listed in a package insert for the vaccine.
- an effective dose is sufficient to produce detectable levels of hCMV antigen (e.g., gH, gL, UL128, UL130, UL131A and/or gB polypeptide) as measured in serum of the subject administered the hCMV immunogenic composition (e.g., mRNA vaccine) at 1-72 hours (e.g., 1-72 hours, 1-60 hours, 1- 45 hours, 1-30 hours, 1-15 hours, 15-72 hours, 15-60 hours, 15-45 hours, 15-30 hours, 30-72 hours, 30-60 hours, 30-45 hours, 45-72 hours, 45-60 hours, or 60-72 hours) post administration.
- 1-72 hours e.g., 1-72 hours, 1-60 hours, 1- 45 hours, 1-30 hours, 1-15 hours, 15-72 hours, 15-60 hours, 15-45 hours, 15-30 hours
- the effective dose is sufficient to produce neutralization titer produced by neutralizing antibody against the hCMV antigen (e.g., gH, gL, UL128, UL130, UL131A and/or gB polypeptide) as measured in serum of the subject administered the hCMV immunogenic composition (e.g., mRNA vaccine) at 1-72 hours (e.g., 1-72 hours, 1-60 hours, 1-45 hours, 1-30 hours, 1-15 hours, 15-72 hours, 15-60 hours, 15-45 hours, 15-30 hours, 30-72 hours, 30-60 hours, 30-45 hours, 45-72 hours, 45-60 hours, or 60-72 hours) post administration.
- the hCMV antigen e.g., g., gH, gL, UL128, UL130, UL131A and/or gB polypeptide
- 1-72 hours e.g., 1-72 hours, 1-60 hours, 1-45 hours, 1-30 hours, 1-15 hours, 15-72 hours, 15-60 hours
- a traditional vaccine refers to a vaccine other than the mRNA vaccines of the present disclosure.
- a traditional vaccine includes, but is not limited, to live microorganism vaccines, killed microorganism vaccines, subunit vaccines, protein antigen vaccines, DNA vaccines, virus like particle (VLP) vaccines, etc.
- a traditional vaccine is a vaccine that has achieved regulatory approval and/or is registered by a national drug regulatory body, for example the Food and Drug Administration (FDA) in the United States or the European Medicines Agency (EMA).
- FDA Food and Drug Administration
- EMA European Medicines Agency
- the anti-antigen antibody titer in the subject is increased 1 log to 10 log following vaccination relative to anti-antigen antibody titer in a subject vaccinated with a prophylactically effective dose of a traditional vaccine against the hCMV or an unvaccinated subject. In some embodiments, the anti-antigen antibody titer in the subject is increased 1 log, 2 log, 3 log, 4 log, 5 log, or 10 log following vaccination relative to anti-antigen antibody titer in a subject vaccinated with a prophylactically effective dose of a traditional vaccine against the hCMV or an unvaccinated subject.
- a method of eliciting an immune response in a subject against hCMV is provided in other aspects of the disclosure.
- the method involves administering to the subject the hCMV mRNA vaccine comprising at least one RNA polynucleotide having an open reading frame encoding at least one hCMV antigen, thereby inducing in the subject an immune response specific to hCMV antigen, wherein the immune response in the subject is equivalent to an immune response in a subject vaccinated with a traditional vaccine against the hCMV at 2 times to 100 times the dosage level relative to the RNA vaccine.
- the immune response in the subject is equivalent to an immune response in a subject vaccinated with a traditional vaccine at twice the dosage level relative to the hCMV immunogenic composition (e.g., mRNA vaccine).
- the immune response in the subject is equivalent to an immune response in a subject vaccinated with a traditional vaccine at three times the dosage level relative to the hCMV immunogenic composition (e.g., mRNA vaccine). In some embodiments, the immune response in the subject is equivalent to an immune response in a subject vaccinated with a traditional vaccine at 4 times, 5 times, 10 times, 50 times, or 100 times the dosage level relative to the hCMV immunogenic composition (e.g., mRNA vaccine). In some embodiments, the immune response in the subject is equivalent to an immune response in a subject vaccinated with a traditional vaccine at 10 times to 1000 times the dosage level relative to the hCMV immunogenic composition (e.g., mRNA vaccine).
- the immune response in the subject is equivalent to an immune response in a subject vaccinated with a traditional vaccine at 100 times to 1000 times the dosage level relative to the hCMV immunogenic composition (e.g., mRNA vaccine).
- the immune response is assessed by determining [protein] antibody titer in the subject.
- the ability of serum or antibody from an immunized subject is tested for its ability to neutralize viral uptake or reduce hCMV transformation of human B lymphocytes.
- the ability to promote a robust T cell response(s) is measured using art recognized techniques.
- the disclosure provide methods of eliciting an immune response in a subject against hCMV by administering to the subject the hCMV immunogenic composition (e.g., mRNA vaccine) comprising at least one RNA polynucleotide having an open reading frame encoding at least one hCMV antigen, thereby inducing in the subject an immune response specific to hCMV antigen, wherein the immune response in the subject is induced 2 days to 10 weeks earlier relative to an immune response induced in a subject vaccinated with a prophylactically effective dose of a traditional vaccine against hCMV.
- the hCMV immunogenic composition e.g., mRNA vaccine
- the immune response in the subject is induced in a subject vaccinated with a prophylactically effective dose of a traditional vaccine at 2 times to 100 times the dosage level relative to the RNA vaccine. In some embodiments, the immune response in the subject is induced 2 days, 3 days, 1 week, 2 weeks, 3 weeks, 5 weeks, or 10 weeks earlier relative to an immune response induced in a subject vaccinated with a prophylactically effective dose of a traditional vaccine.
- hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition may be administered by any route which results in a therapeutically effective outcome. These include, but are not limited, to intradermal, intramuscular, intranasal, and/or subcutaneous administration.
- the present disclosure provides methods comprising administering RNA vaccines to a subject in need thereof.
- the exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like.
- the hCMV mRNA vaccine is typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the hCMV mRNA vaccine may be decided by the attending physician within the scope of sound medical judgment.
- the specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
- the hCMV immunogenic composition (e.g., mRNA vaccine A) is administered at a dose of about 1 ⁇ g, 2 ⁇ g, 3 ⁇ g, 4 ⁇ g, 5 ⁇ g, 6 ⁇ g, 7 ⁇ g, 8 ⁇ g, 9 ⁇ g, 10 ⁇ g, 11 ⁇ g, 12 ⁇ g, 13 ⁇ g, 14 ⁇ g, 15 ⁇ g, 16 ⁇ g, 17 ⁇ g, 18 ⁇ g, 19 ⁇ g, 20 ⁇ g, 21 ⁇ g, 22 ⁇ g, 23 ⁇ g, 24 ⁇ g 25 ⁇ g, 26 ⁇ g, 27 ⁇ g, 28 ⁇ g, 29 ⁇ g, 30 ⁇ g, 31 ⁇ g, 32 ⁇ g, 33 ⁇ g, 34 ⁇ g, 35 ⁇ g, 36 ⁇ g, 37 ⁇ g, 38 ⁇ g, 39 ⁇ g, 40 ⁇ g, 41 ⁇ g , 42 ⁇ g, 43 ⁇ g , 44 ⁇ g, 45
- the effective amount of the hCMV immunogenic composition e.g., mRNA vaccine A, including mRNAs encoding gH/gL/UL128/UL130/UL131A/gB), as provided herein, may be as low as 90 ⁇ g, administered for example as a single dose or as three 30 ⁇ g doses.
- the effective amount of hCMV immunogenic composition is a single dose of 25 ⁇ g - 500 ⁇ g or 30 ⁇ g - 450 ⁇ g.
- the effective amount of hCMV immunogenic composition may be a single dose of 1 ⁇ g, 2 ⁇ g, 3 ⁇ g, 4 ⁇ g, 5 ⁇ g, 6 ⁇ g, 7 ⁇ g, 8 ⁇ g, 9 ⁇ g, 10 ⁇ g, 11 ⁇ g, 12 ⁇ g, 13 ⁇ g, 14 ⁇ g, 15 ⁇ g, 16 ⁇ g, 17 ⁇ g, 18 ⁇ g, 19 ⁇ g, 20 ⁇ g, 21 ⁇ g, 22 ⁇ g, 23 ⁇ g, 24 ⁇ g 25 ⁇ g, 26 ⁇ g, 27 ⁇ g, 28 ⁇ g, 29 ⁇ g, 30 ⁇ g, 31 ⁇ g, 32 ⁇ g, 33 ⁇ g, 34
- the effective amount of hCMV immunogenic composition is a single dose of 30 ⁇ g - 180 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is a single dose of 30 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is a single dose of 90 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is a single dose of 180 ⁇ g.
- the effective amount of hCMV immunogenic composition is a single dose of 300 ⁇ g - 450 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is a single dose of 300 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is a single dose of 450 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 2 doses of 25 ⁇ g - 500 ⁇ g or 30 ⁇ g - 450 ⁇ g.
- the effective amount of hCMV immunogenic composition may be 2 doses of 1 ⁇ g, 2 ⁇ g, 3 ⁇ g, 4 ⁇ g, 5 ⁇ g, 6 ⁇ g, 7 ⁇ g, 8 ⁇ g, 9 ⁇ g, 10 ⁇ g, 11 ⁇ g, 12 ⁇ g, 13 ⁇ g, 14 ⁇ g, 15 ⁇ g, 16 ⁇ g, 17 ⁇ g, 18 ⁇ g, 19 ⁇ g, 20 ⁇ g, 21 ⁇ g, 22 ⁇ g, 23 ⁇ g, 24 ⁇ g 25 ⁇ g, 26 ⁇ g, 27 ⁇ g, 28 ⁇ g, 29 ⁇ g, 30 ⁇ g, 31 ⁇ g, 32 ⁇ g, 33 ⁇ g, 34 ⁇ g, 35 ⁇ g, 36 ⁇ g, 37 ⁇ g, 38 ⁇ g, 39 ⁇ g, 40 ⁇ g, 41 ⁇ g , 42 ⁇ g, 43 ⁇ g , 44 ⁇ g, 45 ⁇ g, 45 ⁇ g, 40 ⁇ g, 41
- the effective amount of hCMV immunogenic composition is 2 doses of 30 ⁇ g - 180 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 2 doses of 30 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 2 doses of 90 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 2 doses of 180 ⁇ g.
- the effective amount of hCMV immunogenic composition is 2 doses of 300 ⁇ g - 450 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 2 doses of 300 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 2 doses of 450 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 3 or more doses of 25 ⁇ g - 500 ⁇ g or 30 ⁇ g - 450 ⁇ g.
- the effective amount of hCMV immunogenic composition may be 3 doses of 1 ⁇ g, 2 ⁇ g, 3 ⁇ g, 4 ⁇ g, 5 ⁇ g, 6 ⁇ g, 7 ⁇ g, 8 ⁇ g, 9 ⁇ g, 10 ⁇ g, 11 ⁇ g, 12 ⁇ g, 13 ⁇ g, 14 ⁇ g, 15 ⁇ g, 16 ⁇ g, 17 ⁇ g, 18 ⁇ g, 19 ⁇ g, 20 ⁇ g, 21 ⁇ g, 22 ⁇ g, 23 ⁇ g, 24 ⁇ g 25 ⁇ g, 26 ⁇ g, 27 ⁇ g, 28 ⁇ g, 29 ⁇ g, 30 ⁇ g, 31 ⁇ g, 32 ⁇ g, 33 ⁇ g, 34 ⁇ g, 35 ⁇ g, 36 ⁇ g, 37 ⁇ g, 38 ⁇ g, 39 ⁇ g, 40 ⁇ g, 41 ⁇ g , 42 ⁇ g, 43 ⁇ g , 44 ⁇ g, 45 ⁇ g, 45 ⁇ g, 40 ⁇ g, 41
- the effective amount of hCMV immunogenic composition is 3 or more doses of 30 ⁇ g - 180 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 3 or more doses of 30 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 3 or more doses of 90 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 3 or more doses of 180 ⁇ g.
- the effective amount of hCMV immunogenic composition is 3 or more doses of 300 ⁇ g - 450 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 3 or more doses of 300 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine A) is 3 or more doses of 450 ⁇ g.
- the effective amount of the hCMV immunogenic composition (e.g., mRNA vaccine B, including mRNAs encoding pp65mut), as provided herein, may be around 30 ⁇ g, administered for example as a single dose or as three 10 ⁇ g doses.
- the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is a single dose of 5 ⁇ g - 100 ⁇ g or 10 ⁇ g - 80 ⁇ g.
- the effective amount of hCMV immunogenic composition may be a single dose of 5 ⁇ g, 10 ⁇ g, 15 ⁇ g, 20 ⁇ g, 25 ⁇ g, 30 ⁇ g, 35 ⁇ g, 40 ⁇ g, 45 ⁇ g, 50 ⁇ g, 55 ⁇ g, 60 ⁇ g, 65 ⁇ g, 70 ⁇ g, 75 ⁇ g, 80 ⁇ g, 85 ⁇ g, 90 ⁇ g, 95 ⁇ g, or 100 ⁇ g.
- the effective amount of hCMV immunogenic composition is a single dose of 10 ⁇ g- 80 ⁇ g.
- the effective amount of hCMV immunogenic composition is a single dose of 10 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is a single dose of 40 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is a single dose of 80 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is 2 doses of 5 ⁇ g - 100 ⁇ g or 10 ⁇ g - 80 ⁇ g.
- the effective amount of hCMV immunogenic composition may be 2 doses of 5 ⁇ g, 10 ⁇ g, 15 ⁇ g, 20 ⁇ g, 25 ⁇ g, 30 ⁇ g, 35 ⁇ g, 40 ⁇ g, 45 ⁇ g, 50 ⁇ g, 55 ⁇ g, 60 ⁇ g, 65 ⁇ g, 70 ⁇ g, 75 ⁇ g, 80 ⁇ g, 85 ⁇ g, 90 ⁇ g, 95 ⁇ g, or 100 ⁇ g.
- the effective amount of hCMV immunogenic composition is 2 doses of 10 ⁇ g- 80 ⁇ g.
- the effective amount of hCMV immunogenic composition is 2 doses of 10 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is 2 doses of 40 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is 2 doses of 80 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is 3 or more doses of 5 ⁇ g - 100 ⁇ g or 10 ⁇ g - 80 ⁇ g.
- the effective amount of hCMV immunogenic composition may be 3 or more doses of 5 ⁇ g, 10 ⁇ g, 15 ⁇ g, 20 ⁇ g, 25 ⁇ g, 30 ⁇ g, 35 ⁇ g, 40 ⁇ g, 45 ⁇ g, 50 ⁇ g, 55 ⁇ g, 60 ⁇ g, 65 ⁇ g, 70 ⁇ g, 75 ⁇ g, 80 ⁇ g, 85 ⁇ g, 90 ⁇ g, 95 ⁇ g, or 100 ⁇ g.
- the effective amount of hCMV immunogenic composition is 3 or more doses of 10 ⁇ g- 80 ⁇ g.
- the effective amount of hCMV immunogenic composition is 3 or more doses of 10 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is 3 or more doses of 40 ⁇ g. In some embodiments, the effective amount of hCMV immunogenic composition (e.g., mRNA vaccine B) is 3 or more doses of 80 ⁇ g. In some embodiments, one, two, three, or more than three doses (of any of the doses described herein) of the hCMV mRNA vaccine A and/or hCMV mRNA vaccine B are administered to a subject.
- one, two, or three doses (of any of the doses described herein) of the hCMV mRNA vaccine A and hCMV mRNA vaccine B are administered to a subject.
- the doses are administered on day 1, around the beginning of month 2 (e.g., day 29), and around the beginning of month 6 (e.g., day 169).
- a dose of hCMV mRNA vaccine A and/or hCMV mRNA vaccine B are administered to a subject on day 1, day 2, day 3, day 4, day 5, day 6, day 7, day 8, day 9, day 10, day 11, day 12, day 13, day 14, day 15, day 16, day 17, day 18, day 19, day 20, day 21, day 22, day 23, day 24, day 25, day 26, day 27, day 28, day 29, day 30, day 31, day 32, day 33, day 34, day 35, day 36, day 37, day 38, day 39, day 40, day 41, day 42, day 43, day 44, day 45, day 46, day 47, day 48, day 49, day 50, day 51, day 52, day 53, day 54, day 55, day 56, day 57, day 58, day 59, day 60, day 61, day 62, day 63, day 64, day 65, day 66, day 67, day 68, day 69, day 70, day 71, day 72, day 73, day 74, day 75, day 76, day 77, day 78
- a dose of hCMV mRNA vaccine A and/or hCMV mRNA vaccine B are administered to a subject after day 199.
- the effective amount of an hCMV immunogenic composition e.g., mRNA vaccine
- is at least 1 dose e.g., 1, 2, 3 doses at any of the dosages levels described herein, such as 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g
- the hCMV immunogenic composition e.g., mRNA vaccine
- the effective amount of an hCMV immunogenic composition is at least 1 dose (e.g., 1, 2, 3 doses at any of the dosages levels described herein, such as 10 ⁇ g, 40 ⁇ g, or 80 ⁇ g).
- the hCMV immunogenic compositions (e.g., mRNA vaccines) described herein can be formulated into a dosage form described herein, such as an intranasal, intratracheal, or injectable (e.g., intravenous, intraocular, intravitreal, intramuscular, intradermal, intracardiac, intraperitoneal, and subcutaneous).
- Vaccine Efficacy Some aspects of the present disclosure provide formulations of the hCMV immunogenic composition (e.g., mRNA vaccine), wherein the hCMV immunogenic composition (e.g., mRNA vaccine) is formulated in an effective amount to produce an antigen specific immune response in a subject (e.g., production of antibodies specific to an anti- hCMV antigen). “An effective amount” is a dose of the hCMV immunogenic composition (e.g., mRNA vaccine) effective to produce an antigen-specific immune response. Also provided herein are methods of inducing an antigen-specific immune response in a subject.
- an immune response to a vaccine or LNP of the present disclosure is the development in a subject of a humoral and/or a cellular immune response to a (one or more) hCMV protein(s) present in the vaccine.
- a “humoral” immune response refers to an immune response mediated by antibody molecules, including, e.g., secretory (IgA) or IgG molecules, while a “cellular” immune response is one mediated by T- lymphocytes (e.g., CD4+ helper and/or CD8+ T cells (e.g., CTLs) and/or other white blood cells.
- T- lymphocytes e.g., CD4+ helper and/or CD8+ T cells (e.g., CTLs) and/or other white blood cells.
- CTLs cytolytic T- cells
- CTLs have specificity for peptide antigens that are presented in association with proteins encoded by the major histocompatibility complex (MHC) and expressed on the surfaces of cells. CTLs help induce and promote the destruction of intracellular microbes or the lysis of cells infected with such microbes. Another aspect of cellular immunity involves and antigen- specific response by helper T-cells. Helper T-cells act to help stimulate the function, and focus the activity nonspecific effector cells against cells displaying peptide antigens in association with MHC molecules on their surface.
- MHC major histocompatibility complex
- the antigen-specific immune response is characterized by measuring an anti-hCMV antigen antibody titer produced in a subject administered the hCMV mRNA vaccine as provided herein.
- An antibody titer is a measurement of the amount of antibodies within a subject, for example, antibodies that are specific to a particular antigen (e.g., an anti-hCMV antigen) or epitope of an antigen.
- Antibody titer is typically expressed as the inverse of the greatest dilution that provides a positive result.
- Enzyme-linked immunosorbent assay is a common assay for determining antibody titers, for example.
- an antibody titer is used to assess whether a subject has had an infection or to determine whether immunizations are required.
- an antibody titer is used to determine the strength of an autoimmune response, to determine whether a booster immunization is needed, to determine whether a previous vaccine was effective, and to identify any recent or prior infections.
- an antibody titer may be used to determine the strength of an immune response induced in a subject by the hCMV mRNA vaccine.
- an anti- hCMV antigen antibody titer produced in a subject is increased by at least 1 log relative to a control.
- anti-hCMV antigen antibody titer produced in a subject may be increased by at least 1.5, at least 2, at least 2.5, at least 3 log, at least 4 log, or at least 5 log , or more, relative to a control.
- the anti-hCMV antigen antibody titer produced in the subject is increased by 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 log relative to a control.
- the anti-hCMV antigen antibody titer produced in the subject is increased by 1-5 log relative to a control.
- the anti-hCMV antigen antibody titer produced in a subject may be increased by 1-1.5, 1-2, 1-2.5, 1-3, 1-4, 1-5, 1.5-2, 1.5-2.5, 1.5-3, 1.5-4, 1.5-5, 2-2.5, 2-3, 2-4, 2-5, 2.5-3, 2.5-4, 2.5-5, 3-4.3-5, or 4-5 log relative to a control.
- the anti-hCMV antigen antibody titer produced in a subject is increased at least 2 times relative to a control.
- the anti-hCMV antigen antibody titer produced in a subject may be increased at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, or at least 10 times relative to a control.
- the anti-hCMV antigen antibody titer produced in the subject is increased 2, 3, 4, 5, 6, 7, 8, 9, or 10 times relative to a control.
- the anti-hCMV antigen antibody titer produced in a subject is increased 2-10 times relative to a control.
- the anti-hCMV antigen antibody titer produced in a subject may be increased 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10 times relative to a control.
- an antigen-specific immune response is measured as a ratio of geometric mean titer (GMT), referred to as a geometric mean ratio (GMR), of serum neutralizing antibody titers to hCMV.
- GTT geometric mean titer
- a geometric mean titer (GMT) is the average antibody titer for a group of subjects calculated by multiplying all values and taking the nth root of the number, where n is the number of subjects with available data.
- administration of an effective amount of hCMV immunogenic composition e.g., mRNA vaccine A
- an effective amount of hCMV immunogenic composition e.g., mRNA vaccine B
- administration a single dose (e.g., any of the doses described herein), or multiple doses, of hCMV mRNA vaccine A or a single dose (e.g., any of the doses described herein), or multiple doses, of hCMV mRNA vaccine B elicits serum neutralizing antibody titers against hCMV.
- the GMT of serum neutralizing antibodies to hCMV increases in the subject administered hCMV mRNA vaccine A by at least 3-fold or at least 4-fold, relative to baseline.
- the GMT of serum neutralizing antibodies to hCMV may increase in the subject by at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8- fold, at least 9-fold, or at least 10-fold, relative to baseline.
- the serum neutralizing antibodies are antibodies against epithelial cell infection. In other embodiments, the serum neutralizing antibodies are antibodies against fibroblast infection.
- the GMT of serum neutralizing antibodies to hCMV increases in the subject by 2-fold to 10-fold (e.g., at least 3-fold) after administering a single dose (e.g., a single dose of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- a single dose e.g., a single dose of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- the serum neutralizing antibodies are antibodies against epithelial cell infection. In other embodiments, the serum neutralizing antibodies are antibodies against fibroblast infection.
- the GMT of serum neutralizing antibodies to hCMV increases in the subject by 2-fold to 10-fold (e.g., at least 3-fold) after administering two doses (e.g., two doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or two doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- two doses e.g., two doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or two doses of 30-200 ⁇ g
- the GMT of serum neutralizing antibodies to hCMV increases in the subject by 2-fold to 10-fold after administering three doses (e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- the serum neutralizing antibodies are antibodies against epithelial cell infection. In other embodiments, the serum neutralizing antibodies are antibodies against fibroblast infection.
- the GMT of serum neutralizing antibodies to hCMV increases in the subject administered hCMV mRNA vaccine A by 9-fold to 20-fold (e.g., 9-20, 10-20, 15-20, 9-15, 10-15, or 9-10 fold) after administering two doses (e.g., two doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or two doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- two doses e.g., two doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or two doses of 30-200 ⁇ g
- the GMT of serum neutralizing antibodies to hCMV may increase in the subject by 9-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18- fold, 19-fold, or 20-fold after administering two doses (e.g., two doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or two doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- the serum neutralizing antibodies are antibodies against epithelial cell infection.
- the serum neutralizing antibodies are antibodies against fibroblast infection.
- the GMT of serum neutralizing antibodies to hCMV increases in the subject administered hCMV mRNA vaccine A by up to 40-fold (e.g., up to 40, up to 35, up to 30, up to 25 fold) after administering three doses (e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- three doses e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g
- the GMT of serum neutralizing antibodies to hCMV may increase in the subject by 20-fold to 40-fold (e.g., 20-40, 20-35, 20-30, 20-25, 25-40, 25-35, 25-30, 30-40, 30- 35, or 35-40 fold) after administering three doses (e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- three doses e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g
- the GMT of serum neutralizing antibodies to hCMV may increase in the subject by 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 26-fold, 27-fold, 28-fold, 29-fold, 30-fold, 31-fold, 32-fold, 33-fold, 34-fold, 35-fold, 36-fold, 37-fold, 38-fold, 39-fold, or 40-fold after administering three doses (e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g) of hCMV mRNA vaccine A, relative to baseline.
- three doses e.g., three doses of ⁇ 30 ⁇ g, such as 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or three doses of 30-200 ⁇ g
- the serum neutralizing antibodies are antibodies against epithelial cell infection. In other embodiments, the serum neutralizing antibodies are antibodies against fibroblast infection.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose (e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g, or 1, 2, or 3 doses of 30-200 ⁇ g) of hCMV mRNA vaccine A is in the range of 0.6-11.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g, or 1, 2, or 3 doses of 30-200 ⁇ g
- hCMV mRNA vaccine A may be about 0.6, 0.8, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g, or 1, 2, or 3 doses of 30-200 ⁇ g
- ⁇ 30 ⁇ g dose e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g, or 1, 2, or 3 doses of 30-200 ⁇ g
- hCMV mRNA vaccine A is in the range of 30-180.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose may be about 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, or 180.
- the average GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose (e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g doses, or 1, 2, or 3 doses of 30-200 ⁇ g) of hCMV mRNA vaccine A is about 120.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 30 ⁇ g dose of hCMV mRNA vaccine A is 30-40 (e.g., 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40).
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 30 ⁇ g dose of hCMV mRNA vaccine A is about 38.15. In some embodiments, the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 90 ⁇ g dose of hCMV mRNA vaccine A is 130-150 (e.g., 130, 135, 140, 145, or 150).
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 90 ⁇ g dose of hCMV mRNA vaccine A is about 142.57. In some embodiments, the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 180 ⁇ g dose of hCMV mRNA vaccine A is 140-160 (e.g., 140, 145, 150, 155, or 160).
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 180 ⁇ g dose of hCMV mRNA vaccine A is about 157.96.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose (e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or 1, 2, or 3 doses of 30-200 ⁇ g) of hCMV mRNA vaccine A is in the range of 380-4000.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or 1, 2, or 3 doses of 30- 200 ⁇ g
- hCMV mRNA vaccine A may be about 380, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 1000, 1500, 2000, 2500, 3000, 3500, or 4000).
- the average GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one ⁇ 30 ⁇ g dose (e.g., 1, 2, or 3 doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or 1, 2, or 3 doses of 30-200 ⁇ g) of hCMV mRNA vaccine A is about 2100.
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 30 ⁇ g dose of hCMV mRNA vaccine A is 380-420 (e.g., 380, 390, 400, 410, or 420).
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 30 ⁇ g dose of hCMV mRNA vaccine A is about 407.86. In some embodiments, the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 90 ⁇ g dose of hCMV mRNA vaccine A is 1800-2100 (e.g., 1800, 1900, 2000, or 2100).
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 90 ⁇ g dose of hCMV mRNA vaccine A is about 1913.17. In some embodiments, the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 180 ⁇ g dose of hCMV mRNA vaccine A is 3600-4100 (e.g., 3600, 3700, 3800, 3900, 4000, or 4100).
- the GMR for hCMV in subjects (e.g., seronegative subjects) administered at least one (e.g., 1 or 2) ⁇ 180 ⁇ g dose of hCMV mRNA vaccine A is about 3842.87.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose (e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g) of hCMV mRNA vaccine A is in the range of 9-41.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- the GMR is of neutralizing antibodies against epithelial cell infection.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- hCMV mRNA vaccine A is in the range of 4-8.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- dose of hCMV mRNA vaccine A may be about 4, 5, 6, 7, 8, 9, or 10.
- the GMR is of neutralizing antibodies against fibroblast infection.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- hCMV mRNA vaccine A is in the range of 2-3.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose may be about 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3.
- the average GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g) of hCMV mRNA vaccine A is about 2.7.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 30 ⁇ g of hCMV mRNA vaccine A is 2.3-2.5 (e.g., 2.3, 2.4, or 2.5).
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 30 ⁇ g of hCMV mRNA vaccine A is about 2.43. In some embodiments, the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 90 ⁇ g of hCMV mRNA vaccine A is 2.5-2.8 (e.g., 2.5, 2.6, 2.7, or 2.8). In some embodiments, the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 90 ⁇ g of hCMV mRNA vaccine A is about 2.66.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 180 ⁇ g of hCMV mRNA vaccine A is 2.6-3 (e.g., 2.6, 2.7, 2.8, 2.9, or 3). In some embodiments, the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 180 ⁇ g of hCMV mRNA vaccine A is about 2.83.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or a single dose of 30-200 ⁇ g
- hCMV mRNA vaccine A is in the range of 6-10.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose may be about 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10.
- the average GMR for hCMV in subjects (e.g., seropositive subjects) administered at least one ⁇ 30 ⁇ g dose is about 7.7.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 30 ⁇ g of hCMV mRNA vaccine A is 6-7 (e.g., 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, or 7).
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 30 ⁇ g of hCMV mRNA vaccine A is about 6.85.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 90 ⁇ g of hCMV mRNA vaccine A is 6-7 (e.g., 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, or 7).
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 90 ⁇ g of hCMV mRNA vaccine A is about 6.93.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 180 ⁇ g of hCMV mRNA vaccine A is 9-10 (e.g., 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, or 10). In some embodiments, the GMR for hCMV in subjects (e.g., seropositive subjects) administered a single dose of ⁇ 180 ⁇ g of hCMV mRNA vaccine A is about 9.26.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., a single dose of 30 ⁇ g, 90 ⁇ g, or 180 ⁇ g, or a single dose of 30-200 ⁇ g
- hCMV mRNA vaccine A is in the range of 2-5.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose may be about 2, 2.5, 3, 3.5, 4, 4.5, or 5.
- the average GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose is about 3.2.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered two doses of ⁇ 30 ⁇ g of hCMV mRNA vaccine A is 12-14 (e.g., 12, 12.5, 13, 13.5, or 14). In some embodiments, the GMR for hCMV in subjects (e.g., seropositive subjects) administered two doses of ⁇ 30 ⁇ g of hCMV mRNA vaccine A is about 13.15. In some embodiments, the GMR for hCMV in subjects (e.g., seropositive subjects) administered two doses of ⁇ 90 ⁇ g of hCMV mRNA vaccine A is 8-10 (e.g.,8, 8.5, 9, 9.5, or 10).
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered two doses of ⁇ 90 ⁇ g of hCMV mRNA vaccine A is about 9.91.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered two doses of ⁇ 180 ⁇ g of hCMV mRNA vaccine A is 18-20 (e.g., 18, 18.5, 19, 19.5, or 20).
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered two doses of ⁇ 180 ⁇ g of hCMV mRNA vaccine A is about 19.36.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the average GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- hCMV mRNA vaccine A is about 14.2.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose e.g., at least two doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least two doses of 30-200 ⁇ g
- at least 2.5- fold e.g., at least 2.5-fold, at least 3-fold, at least 3.5 fold
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least two ⁇ 30 ⁇ g dose may be may be increased by 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, or 3.8 fold relative to the baseline.
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least three ⁇ 30 ⁇ g dose e.g., at least three doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least three doses of 30-200 ⁇ g
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least three ⁇ 30 ⁇ g dose e.g., at least three doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least three doses of 30-200 ⁇ g
- at least 3.9- fold e.g., at least 3.9-fold, at least 4-fold, at least 5 fold
- the GMR for hCMV in subjects (e.g., seropositive subjects) administered at least three ⁇ 30 ⁇ g dose (e.g., at least three doses of 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, or 300 ⁇ g, or at least three doses of 30- 200 ⁇ g) of hCMV mRNA vaccine A may be may be increased by 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5-fold relative to the baseline.
- a control/baseline in some embodiments, is the anti-hCMV antigen antibody titer produced in a subject who has not been administered the hCMV mRNA vaccine.
- a control/baseline is an anti-hCMV antigen antibody titer produced in a subject who has a natural hCMV infection, i.e., a subject who is hCMV seropositive prior to being administered the hCMV mRNA vaccine.
- a control/baseline is an anti- hCMV antigen antibody titer produced in a subject who is hCMV seronegative prior to being administered the hCMV mRNA vaccine.
- the GMT of serum neutralizing antibodies to hCMV increases in a dose-dependent manner.
- the ability of the hCMV immunogenic composition e.g., mRNA vaccine
- the hCMV immunogenic composition (e.g., mRNA vaccine) may be administered to a murine model and the murine model assayed for induction of neutralizing antibody titers.
- Viral challenge studies may also be used to assess the efficacy of a vaccine of the present disclosure.
- the hCMV immunogenic composition (e.g., mRNA vaccine) may be administered to a murine model, the murine model challenged with hCMV, and the murine model assayed for survival and/or immune response (e.g., neutralizing antibody response, T cell response (e.g., cytokine response)).
- an effective amount of the hCMV immunogenic composition is a dose that is reduced compared to the standard of care dose of a recombinant hCMV protein vaccine.
- a “standard of care,” as provided herein, refers to a medical or psychological treatment guideline and can be general or specific. “Standard of care” specifies appropriate treatment based on scientific evidence and collaboration between medical professionals involved in the treatment of a given condition. It is the diagnostic and treatment process that a physician/ clinician should follow for a certain type of patient, illness or clinical circumstance.
- a “standard of care dose,” as provided herein, refers to the dose of a recombinant or purified hCMV protein vaccine, or a live attenuated or inactivated hCMV mRNA vaccine, or a hCMV VLP vaccine, that a physician/clinician or other medical professional would administer to a subject to treat or prevent hCMV, or a hCMV-related condition, while following the standard of care guideline for treating or preventing hCMV, or a hCMV-related condition.
- the anti-hCMV antigen antibody titer produced in a subject administered an effective amount of the hCMV immunogenic composition is equivalent to an anti- hCMV antigen antibody titer produced in a control subject administered a standard of care dose of a recombinant or purified hCMV protein vaccine, or a live attenuated or inactivated hCMV mRNA vaccine, or a hCMV VLP vaccine.
- Vaccine efficacy may be assessed using standard analyses (see, e.g., Weinberg et al., J Infect Dis.2010 Jun 1;201(11):1607-10).
- vaccine efficacy may be measured by double-blind, randomized, clinical controlled trials.
- AR disease attack rate
- RR relative risk
- vaccine effectiveness may be assessed using standard analyses (see, e.g., Weinberg et al., J Infect Dis.2010 Jun 1;201(11):1607-10).
- Vaccine effectiveness is an assessment of how a vaccine (which may have already proven to have high vaccine efficacy) reduces disease in a population. This measure can assess the net balance of benefits and adverse effects of a vaccination program, not just the vaccine itself, under natural field conditions rather than in a controlled clinical trial. Vaccine effectiveness is proportional to vaccine efficacy (potency) but is also affected by how well target groups in the population are immunized, as well as by other non-vaccine-related factors that influence the ‘real-world’ outcomes of hospitalizations, ambulatory visits, or costs. For example, a retrospective case control analysis may be used, in which the rates of vaccination among a set of infected cases and appropriate controls are compared.
- efficacy of the hCMV mRNA vaccine is at least 60% relative to unvaccinated control subjects.
- efficacy of the hCMV mRNA vaccine may be at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 95%, at least 98%, or 100% relative to unvaccinated control subjects.
- Sterilizing Immunity Sterilizing immunity refers to a unique immune status that prevents effective pathogen infection into the host.
- the effective amount of an hCMV mRNA vaccine of the present disclosure is sufficient to provide sterilizing immunity in the subject for at least 1 year.
- the effective amount of the hCMV mRNA vaccine of the present disclosure may be sufficient to provide sterilizing immunity in the subject for at least 2 years, at least 3 years, at least 4 years, or at least 5 years.
- the effective amount of the hCMV mRNA vaccine of the present disclosure is sufficient to provide sterilizing immunity in the subject at an at least 5-fold lower dose relative to control.
- the effective amount may be sufficient to provide sterilizing immunity in the subject at an at least 10-fold lower, 15-fold, or 20-fold lower dose relative to a control. Detectable Antigen.
- the effective amount of the hCMV mRNA vaccine of the present disclosure is sufficient to produce detectable levels of hCMV antigen as measured in serum of the subject at 1-72 hours post administration.
- An antibody titer is a measurement of the amount of antibodies within a subject, for example, antibodies that are specific to a particular antigen (e.g., an anti- hCMV antigen). Antibody titer is typically expressed as the inverse of the greatest dilution that provides a positive result. Enzyme-linked immunosorbent assay (ELISA) is a common assay for determining antibody titers, for example.
- the effective amount of the hCMV mRNA vaccine of the present disclosure is sufficient to produce a 1,000-10,000 neutralizing antibody titer produced by neutralizing antibody against the hCMV antigen as measured in serum of the subject at 1-72 hours post administration. In some embodiments, the effective amount is sufficient to produce a 1,000-5,000 neutralizing antibody titer produced by neutralizing antibody against the hCMV antigen as measured in serum of the subject at 1-72 hours post administration. In some embodiments, the effective amount is sufficient to produce a 5,000-10,000 neutralizing antibody titer produced by neutralizing antibody against the hCMV antigen as measured in serum of the subject at 1-72 hours post administration. In some embodiments, the neutralizing antibody titer is at least 100 NT50.
- the neutralizing antibody titer may be at least 200, 300, 400, 500, 600, 700, 800, 900 or 1000 NT 50 . In some embodiments, the neutralizing antibody titer is at least 10,000 NT 50 . In some embodiments, the neutralizing antibody titer is at least 100 neutralizing units per milliliter (NU/mL). For example, the neutralizing antibody titer may be at least 200, 300, 400, 500, 600, 700, 800, 900 or 1000 NU/mL. In some embodiments, the neutralizing antibody titer is at least 10,000 NU/mL. In some embodiments, an anti-hCMV antigen antibody titer produced in the subject is increased by at least 1 log relative to a control.
- an anti-hCMV antigen antibody titer produced in the subject may be increased by at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 log relative to a control.
- an anti-hCMV antigen antibody titer produced in the subject is increased at least 2 times relative to a control.
- an anti-hCMV antigen antibody titer produced in the subject is increased by at least 3, 4, 5, 6, 7, 8, 9 or 10 times relative to a control.
- a geometric mean which is the nth root of the product of n numbers, is generally used to describe proportional growth. Geometric mean, in some embodiments, is used to characterize antibody titer produced in a subject.
- hCMV mRNA vaccine A consists of distinct mRNA molecules having sequences that encode the full length CMV glycoprotein B (gB) and the pentameric gH/gL/UL128/UL130/UL131A glycoprotein complex (Pentamer).
- hCMV mRNA vaccine B consists of an mRNA molecule having a sequence that encodes a phosphorylation mutant of the pp65 protein, which lacks amino acids 435-438, and is aimed at eliciting T-cell responses. The phosphorylation site has been deleted in order to mitigate any theoretical safety concerns of expressing wild type pp65 protein.
- hCMV mRNA vaccine A and hCMV mRNA vaccine B have demonstrated non- clinical safety and immunogenicity and thus hold the potential for preventing human primary CMV infection and CMV re-infection/re-activation in CMV-positive individuals.
- Choice of Study Population Immune response to investigational CMV vaccines in subjects who are seronegative may be different from responses in those who are seropositive.
- this study enrolled approximately equal numbers of healthy CMV-seronegative and CMV-seropositive subjects in dose-selection phase B and the expansion cohorts of sentinel-expansion phase C of the study.
- hCMV mRNA vaccine A (30 ⁇ g, 90 ⁇ g, 180 ⁇ g, 300 ⁇ g, and either 240 ⁇ g or 450 ⁇ g [depending on safety review of Phase C Arm 1]) and 3 dose levels of hCMV mRNA vaccine B (10 ⁇ g, 40 ⁇ g, and 80 ⁇ g) are tested in this Phase I study.
- the initial doses for both compounds are within the range for which non-clinical safety and immunogenicity data have been evaluated. There were no toxic effects, but some mild and expected local inflammatory reactions were observed.
- the dose levels up to 180 ⁇ g are also within the dose range that had a favorable safety profile and induced immune responses in a Phase 1/2 mRNA vaccine study (Bahl et al 2017).
- a 3-dose vaccination series was evaluated in this clinical study.
- the planned dose schedule of administration (Day 1, Month 2, and Month 6) had previously been found to be the optimal vaccination schedule for recombinant protein vaccines.
- This schedule also allowed co-administration of the vaccine in the target population with human papillomavirus (HPV; Gardasil 2015) or hepatitis B virus (HBV; Engerix-B 2016) vaccines.
- HPV human papillomavirus
- HBV hepatitis B virus
- the immune response was evaluated after each study vaccination as well as 4 months after the second dose and 6 months after the third dose.
- Safety Monitoring Plan As hCMV mRNA vaccine A and hCMV mRNA vaccine B was administered for the first time to humans, safety precautions such as sequential enrollment, dose escalation, and continuous safety evaluations are taken. Study vaccines were initially administered to a small number of subjects and then, following the confirmation of acceptable tolerability, enrollment is expanded.
- Study pause rules were defined, and safety evaluation from this study are overseen by an Internal Safety Team (IST) and an unblinded, independent Safety Monitoring Committee (SMC). The study is conducted in multiple phases as described below. Use of Placebo Because there are currently no licensed CMV vaccines available, a placebo group was used as a control for the safety, reactogenicity, and immunogenicity assessments. Study Blinding Because the physical appearance of the placebo was different from hCMV mRNA vaccine A and hCMV mRNA vaccine B, and because hCMV mRNA vaccine A and hCMV mRNA vaccine B required dilution prior to administration, the study was conducted in an observer-blinded manner.
- Dose-escalation phase A Sequential enrollment of 27 CMV-seronegative subjects into the 3 lower dose levels of the study vaccines or placebo.
- Nine subjects per dose level were randomly assigned in a 4:4:1 ratio to receive hCMV mRNA vaccine A (30, 90, or 180 ⁇ g), hCMV mRNA vaccine B (10, 40, or 80 ⁇ g), or placebo.
- the Safety Monitoring Committee (SMC) reviewed all safety and reactogenicity data through Day 63 (6 days after the second vaccination in the 180 ⁇ g/80 ⁇ g dose level) for hCMV mRNA vaccine A and hCMV mRNA vaccine B and confirmed the hCMV mRNA vaccine A dose levels evaluated in dose-selection phase B of the study, pending SMC safety review of dose-escalation phase B through Day 63.
- the SMC also reviews all available safety data through Day 175 (6 days after the third vaccination in the 180 ⁇ g/80 ⁇ g dose level) for hCMV mRNA vaccine A and hCMV mRNA vaccine B to permit administration of the third vaccination of hCMV mRNA vaccine A in dose-selection phase B.
- Dose-escalation phase B To implement hCMV mRNA vaccine A in dose-selection phase B, 15 CMV-seronegative subjects were enrolled sequentially into the 3 lower dose levels of hCMV mRNA vaccine A or placebo. Five subjects per dose level were randomly assigned in a 4:1 ratio to receive hCMV mRNA vaccine A or placebo.
- Safety reviews by the IST permit dose continuation within each dose level and escalation to the next dose level.
- the SMC confirms the hCMV mRNA vaccine A dose levels evaluated in dose-selection phase B of the study.
- the SMC also reviews all available safety data through Day 175 (6 days after the third vaccination of the 180 ⁇ g dose level) for hCMV mRNA vaccine A to permit administration of the third vaccination in dose-selection phase B.
- Dose-selection phase B Parallel enrollment of approximately 104 subjects (26 per study group) into the 3 lower dose levels of hCMV mRNA vaccine A or placebo. Subjects were randomly assigned in a 1:1:1:1 ratio to receive 30, 90, or 180 ⁇ g hCMV mRNA vaccine A or placebo. Approximately equal numbers of CMV-seronegative and CMV-seropositive subjects were enrolled at each dose level. Safety and reactogenicity are periodically reviewed by the unblinded SMC. Sentinel-expansion phase C: To better understand the relationship between dose, tolerability, and immunogenicity, this phase will enroll up to 70 subjects (up to 2 arms, 35 subjects per arm) into 2 other dose levels of hCMV mRNA vaccine A or placebo.
- a sentinel cohort (5 CMV-seronegative subjects randomly assigned in a 4:1 ratio received hCMV mRNA vaccine A or placebo) and an expansion cohort (up to 30 subjects randomly assigned in a 4:1 ratio received hCMV mRNA vaccine A or placebo), with approximately equal numbers of CMV-seronegative and CMV-seropositive subjects.
- Arm 1 Sentinel subjects are randomly assigned to receive 300 ⁇ g of hCMV mRNA vaccine A or placebo, based on safety data from dose-escalation phase B through Day 63 (6 days after the second vaccination). The SMC reviews all safety and reactogenicity data from the Arm 1 sentinel cohort through Day 7 (6 days after the first vaccination) to permit enrollment of the Arm 1 expansion cohort.
- the SMC then reviews safety and reactogenicity data from all Arm 1 subjects through Day 7 to permit enrollment into Arm 2.
- Arm 2 Subjects are randomly assigned to receive hCMV mRNA vaccine A or placebo based on safety and tolerability data from Arm 1 through Day 7 (6 days after the first vaccination).
- the dose level of hCMV mRNA vaccine A in Arm 2 are determined in the following manner: When SMC review of all Arm 1 subjects through Day 7 raises no safety concerns, Arm 2 subjects are randomly assigned to receive a dose level of 450 ⁇ g of hCMV mRNA vaccine A or placebo.
- Arm 2 subjects are randomly assigned to receive a dose level of 240 ⁇ g of hCMV mRNA vaccine A or placebo.
- the IST reviews all safety and reactogenicity data from the Arm 2 sentinel cohort through Day 7 (6 days after the first vaccination) to permit enrollment of the Arm 2 expansion cohort.
- Control Saline placebo
- Study groups Dose-escalation phase A (CMV-seronegative subjects): • 9 subjects randomly assigned in a 4:4:1 ratio received 30 ⁇ g hCMV mRNA vaccine A, 10 ⁇ g hCMV mRNA vaccine B, or placebo • 9 subjects randomly assigned in a 4:4:1 ratio received 90 ⁇ g hCMV mRNA vaccine A, 40 ⁇ g hCMV mRNA vaccine B, or placebo • 9 subjects randomly assigned in a 4:4:1 ratio received 180 ⁇ g hCMV mRNA vaccine A, 80 ⁇ g hCMV mRNA vaccine B, or placebo
- Dose-escalation phase B (CMV-seronegative subjects): • 30 ⁇ g dose level: 5 subjects randomly assigned in a 4:1 ratio receive 30 ⁇ g hCMV mRNA vaccine A or placebo • 90 ⁇ g dose level: 5 subjects randomly
- hCMV mRNA vaccine A dose levels evaluated in dose-selection phase B of the study were confirmed by the SMC following review of the safety and reactogenicity data from dose- escalation phase B.
- Sentinel-expansion phase C Up to 70 subjects (up to 2 arms, 35 subjects per arm) are enrolled in a sentinel-expansion manner, randomly assigned in a 4:1 ratio to receive 2 other dose levels of hCMV mRNA vaccine A or placebo.
- Sentinel cohorts enroll CMV-seronegative subjects and expansion cohorts enroll approximately equal numbers of CMV-seronegative and CMV-seropositive subjects.
- Arm 1 Approximately 35 subjects randomly assigned in a 4:1 ratio receive 300 ⁇ g of hCMV mRNA vaccine A or placebo.
- Arm 2 Approximately 35 subjects randomly assigned in a 4:1 ratio receive either 240 or 450 ⁇ g hCMV mRNA vaccine A (depending on safety review of Phase C Arm 1) or placebo.
- the dose level for Arm 2 is based on safety data from all Arm 1 subjects through Day 7. Randomization An Interactive Response Technology was used in the study.
- the number of arms and the randomization ratio for dose-selection phase B was adjusted according to SMC recommendations based on the review of the safety and reactogenicity data from the dose- escalation phases. Blinding This was an observer-blind study. Blood sample schedule Blood samples for screening laboratory testing were collected at the Screening visit. Blood samples for safety laboratory assessments are collected at Visits Day 1, Day 7, Month 1, Month 2, Day 63, Month 3, Month 6, Day 175, and Month 7. Blood samples for antibody- mediated immunogenicity are collected at Visits Day 1, Month 1, Month 3, Month 6, Month 7, and Month 12.
- Blood samples for assessment of cell-mediated immunogenicity are collected from subjects in dose-escalation phase B, dose-selection phase B, and sentinel-expansion phase C at Visits Day 1, Day 7, Month 2, Day 63, Month 6, Day 175, and Month 12.
- Data collection Electronic case report forms (eCRFs). Study visits Eleven clinic visits at Screening, Day 1, Day 7, Month 1, Month 2, Day 63, Month 3, Month 6, Day 175, Month 7, and Month 12.
- Safety phone calls Six safety phone calls are conducted approximately 24 and 48 hours after each study vaccination (Days 2, 3, 58, 59, 170, and 171) in all subjects in dose-escalation phases A and B and sentinel cohorts of sentinel-expansion phase C to collect solicited adverse events (AEs) and other safety information.
- AEs adverse events
- AEs medically-attended adverse effects
- SAEs serious AEs
- AESIs AEs of special interest
- Solicited AEs Local (injection site pain, erythema, and swelling) and systemic (headache, fatigue, myalgia [muscle aches all over the body], arthralgia [aching in several joints], nausea, rash, fever, and chills) solicited AEs that occur from the time of each study vaccination through the following 6 days are recorded daily using Diary Cards for all subjects.
- Unsolicited AEs All observed or reported AEs that occurred through 28 days after each study vaccination and were not included as part of the protocol-defined solicited AEs are recorded using Diary Cards for all subjects. In addition, qualified site personnel interview the subject during the site visit approximately 28 days after each vaccination (Visits Month 1, Month 3, and Month 7) to assess the occurrence of any unsolicited AEs. Medically-attended AEs, AEs leading to study withdrawal, AESIs and SAEs Medically-attended AEs and AEs leading to study withdrawal, are collected from Day 1 and AESIs and SAEs are collected from the time the informed consent form is signed. These data are captured through the Diary Card, by interviewing subjects during site visits and safety phone calls, and by reviewing available medical records.
- Rescreening of an eligible subject is allowed if their originally intended dose level closes and their 28 day screening window was surpassed before another dose level opens. The subject is assigned a new screening number and all screening procedures are repeated. Subjects who did not meet all enrollment criteria at their first screening are not allowed to rescreen. Screen failures were defined as subjects who signed the consent form but who were not subsequently randomly assigned to the study intervention or entered in the study. Information on eligibility, demographics, SAEs, and informed consent was collected for all screen failures. Subject Characteristics and Main Criteria for Inclusion and Exclusion Subjects were included in the study if in good health as judged by physical examination and medical history and if they meet all specified eligibility criteria. Inclusion and exclusion criteria are provided below.
- Non- childbearing potential is defined as bilateral tubal ligation > 1 year prior to Screening, bilateral oophorectomy, or hysterectomy or menopause (refer to the Glossary of Terms).
- a follicle stimulating hormone level may be measured at the discretion of the Investigator to confirm menopausal status.
- Female subjects of childbearing potential must have a negative pregnancy test at Screening and the day of vaccination and must have practiced adequate contraception or abstaining from all activities which could lead to pregnancy for 30 days prior to the first vaccination, and must have agreed to continue adequate contraception through 3 months following the last vaccination. Male subjects must agree to practice adequate contraception for 30 days prior to the first vaccination and through 3 months following the last vaccination.
- Exclusion criteria Any acute or chronic disease determined to be clinically significant by the Investigator, including an immune-mediated disease or immunosuppressive condition.
- Asymptomatic conditions or findings e.g., mild hypertension, dyslipidemia
- Positive urine drug screens for amphetamines, benzodiazepines, or opiates are not exclusionary if the positive result is due to a prescribed concomitant medication, in the opinion of the Investigator.
- chronic administration defined as more than 14 days within 3 months before the first vaccination
- potentially hepatotoxic drugs or have other medical conditions that affect the liver e.g., alcohol abuse
- Had a history of idiopathic urticaria Had plans for administration or had been administered a vaccine not foreseen by the study protocol within the period from 30 days before through 30 days after each study vaccination, except for any licensed influenza vaccine administered ⁇ 15 days before or after any study vaccination.
- Fever is defined as a temperature ⁇ 38.0°C/100.4°F by the oral, axillary, or tympanic route. Subjects meeting this criterion may be rescheduled for Screening at a later date. Afebrile subjects with minor illnesses can be enrolled at the discretion of the Investigator. Any medical, psychiatric, or occupational condition that, in the opinion of the Investigator, might pose an additional risk to the subject due to participation in the study or can interfere with the evaluation of the study vaccines or the interpretation of study results. Subjects who were seropositive for CMV at Screening are excluded from dose-escalation phases A and B and sentinel cohorts of sentinel-expansion phase C. Was an immediate family member or household member of study personnel.
- Study Vaccine hCMV mRNA vaccine A consists of 6 mRNA Drug Substances in a liquid nanoparticle (LNP) formulation.
- hCMV mRNA vaccine B consists of a single mRNA Drug Substance in an LNP formulation.
- the LNP formulation for each vaccine includes 4 lipid excipients: an ionizable amino lipid, and the commercially-available lipids cholesterol, 1,2-distearoyl-sn-glycero-3- phosphocholine, and 1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol.
- hCMV mRNA vaccine A and hCMV mRNA vaccine B are each provided as a sterile liquid for injection at concentrations of 1.0 and 2.0 mg/mL, respectively, in 93 mM Tris buffer, 7% propylene glycol, and 1 mM DTPA.
- the placebo is 0.9% sodium chloride.
- Study vaccines were administered intramuscularly into the deltoid muscle, preferably in the non-dominant arm. Criteria for Evaluation Primary Safety and Reactogenicity Endpoints: 1. Occurrence of each solicited local and systemic AE during a 7-day follow-up period after each vaccination (i.e., the day of vaccination and 6 subsequent days). 2. Occurrence of any unsolicited AE during a 29-day follow-up period after each study vaccination (i.e., the day of vaccination and 28 subsequent days). 3. Occurrence of any laboratory test abnormality at Visits Day 1, Day 7, Month 1, Month 2, Day 63, Month 3, Month 6, Day 175, and Month 7. 4. Occurrence of any medically-attended AE from Day 1 to Month 18. 5.
- cut-off level i.e., neutralizing antibody titers associated with natural CMV infection
- the number of proposed subjects was sufficient to provide a descriptive summary of the safety and immunogenicity of hCMV mRNA vaccine A and a descriptive summary of the safety of hCMV mRNA vaccine B in dose-escalation phase A.
- Approximately equal numbers of CMV-seropositive and CMV-seronegative subjects are enrolled in dose-selection phase B and the expansion cohorts of sentinel-expansion phase C.
- the statistical analyses for GMTs is conducted using an analysis of covariance model with dose level as fixed effects and baseline antibody level as covariates.
- the primary immunogenicity analyses are based on a Per-protocol Set. If the number of subjects in the Full Analysis Set (FAS) and Per-protocol Set differ (defined as the difference divided by the total number of subjects in the PP set) by more than 10%, primary immunogenicity analyses will also be conducted on the FAS.
- Available safety and immunogenicity data up to Month 7 and/or Month 12 may be also summarized as part of these interim analyses. 2. Separate 7-month interim analyses of safety, reactogenicity, and immunogenicity data collected from Visit Day 1 through Month 7 may be performed for phase A, phase B, and Arms 1 and 2 of phase C. The analyses are conducted on cleaned data and are reported on a treatment group level. Available safety or immunogenicity data up to Month 12 are also summarized as part of these interim analyses. These are partially unblinded analyses, as access to individual treatment assignments are restricted to pre-identified Sponsor study team members. The Investigators and site personnel remained blinded. 3.
- the purpose of this Phase I, first-in-human, randomized, observer-blind, placebo- controlled, dose-ranging study is to evaluate the safety and immunogenicity of hCMV mRNA vaccine A and the safety of hCMV mRNA vaccine B in healthy adults 18-49 years of age.
- Phase A and in dose-escalation Phase B All subjects in Phase A and in dose-escalation Phase B were CMV-seronegative at enrollment, and approximately equal numbers of subjects in dose-selection Phase B were CMV- seronegative or CMV-seropositive at enrollment. Data are summarized for each phase separately unless otherwise specified.
- Phase A demographic and safety data are presented separately by receipt of hCMV mRNA vaccine B or hCMV mRNA vaccine A.
- Phase B demographic data are presented separately by dose-escalation and dose-selection subjects.
- Phase B safety and immunogenicity data are presented by dose-escalation and dose-selection subjects combined, and are summarized by CMV serostatus and overall. Summary of Results • Demographics Demographics and baseline characteristics were generally balanced across treatment groups and Phase A and Phase B.
- the female:male ratio was consistent between Phase A and Phase B and was approximately 3:2. • Safety Solicited safety data were collected through 7 days after each vaccination and are based on the Solicited Safety Set. Unsolicited events were collected through 28 days after each vaccination and are based on the Exposed Set. Overall In Phase A, the hCMV mRNA vaccine B and hCMV mRNA vaccine A vaccines were generally well-tolerated though subject numbers were low, and the hCMV mRNA vaccine A vaccine in Phase B was generally well-tolerated at the two lower dose levels.
- Phase A injection site pain was the most common solicited local AE reported in up to 100% of hCMV mRNA vaccine B and hCMV mRNA vaccine A recipients after each of the 3 vaccinations in a generally dose-related manner, and all were Grade 1-2.
- Phase B Dose Escalation and Dose Selection consolidated data
- Injection site pain was also the most common solicited local AE in Phase B, reported in 76.7-100% of subjects after the 1 st vaccination and in 74.1-84.6% of subjects after the 2 nd vaccination and in a generally dose-related manner.
- Rates of injection site swelling were low, reported by 3 subjects after the 1 st vaccination and 1 subject after and 2 nd vaccination, and all participants were CMV-seropositive.
- Solicited local AE data after the 3 rd vaccination in Phase B are limited to the dose- escalation cohort. Injection site pain was the only AE reported, occurring only in CMV- seronegative subjects at all dose levels, and all were Grade 1-2.
- Solicited Systemic Adverse Events Phase A Headache, fatigue, myalgia, and arthralgia were the most common solicited systemic AEs. In hCMV mRNA vaccine B recipients, rates of solicited systemic AEs in subjects receiving hCMV mRNA vaccine B generally did not appear to be dose-related.
- Rates of solicited systemic AEs in subjects receiving hCMV mRNA vaccine A were generally higher at the 90 ⁇ g and 180 ⁇ g dose levels after the 1 st and 2 nd vaccinations. After the 1 st vaccination, overall rates of solicited systemic AEs were similar between hCMV mRNA vaccine B and hCMV mRNA vaccine A recipients. After the 2 nd vaccination, rates of headache, fatigue, myalgia, and arthralgia were higher in hCMV mRNA vaccine B recipients (50-75%) compared to hCMV mRNA vaccine A (16.7-33.3%).
- Phase B Dose Escalation and Dose Selection
- Headache, fatigue, myalgia, and chills were the most common solicited systemic AEs, were more commonly reported after the 2 nd vaccination (51.3-64.7%) compared to the 1 st vaccination (30.3-48.7%), occurred in a dose-related pattern, and at somewhat higher rates in CMV-seropositive subjects compared to CMV-seronegative subjects.
- Rates of solicited systemic AEs were generally higher after the 2 nd vaccination compared to the 1 st vaccination in CMV-seronegative participants.
- Rates of fever were dose-related and higher after the 2 nd vaccination reported in 2% of CMV-seronegative participants and 33.3% of CMV-seropositive participants after the 1 st vaccination, and in 23.9% of CMV-seronegative participants and 41.2% of CMV-seropositive participants after the 2 nd vaccination. All 3 reports of Grade 3 fever after the 1 st vaccination and 5 of the 6 reports of Grade 3 fever after the 2 nd vaccination were reported in CMV-seropositive participants. Of the 56 Grade 3 solicited systemic AEs in Phase B, 19 were after the 1 st vaccination and 36 were after the 2 nd vaccination.
- hCMV mRNA vaccine B group 9 subjects reported 25 unsolicited AEs; of these, 8 subjects reported 23 unsolicited AEs deemed related to study product.
- hCMV mRNA vaccine A group 9 subjects reported 12 unsolicited AEs; of these, 6 subjects reported 5 unsolicited AEs deemed related to study product.
- Two hCMV mRNA vaccine B recipients and 1 hCMV mRNA vaccine A recipient reported Grade 3 unsolicited AEs, all of which were deemed related to study product. No subjects experienced AEs that led to study discontinuation.
- the most common unsolicited AE was chills, reported in 12 participants (7 randomized to hCMV mRNA vaccine B and 5 randomized to hCMV mRNA vaccine A), with ⁇ 1 participant in each of the treatment arms, and all were deemed related to study product A total of 5 subjects reported medically-attended AEs (3 randomized to hCMV mRNA vaccine B and 2 randomized to hCMV mRNA vaccine A), and the 2 medically-attended AEs deemed related to study product occurred in participants randomized to hCMV mRNA vaccine B.
- One participant randomized to placebo reported an unsolicited AE that was a medically-attended event that was not related to study product.
- the most frequent unsolicited AEs fell into Preferred Term categories collected as solicited AEs, but were categorized as unsolicited AEs due to being initially reported outside of the Diary Card collection tool.
- the next most frequent unsolicited AE related to study product was lymphadenopathy.
- 2 were CMV-seronegative and 5 were CMV-seropositive; 1 placebo recipient in the CMV-seropositive group reported an AE that was deemed related to study product.
- Phase B 2 CMV- seronegative participants (1 each in the 90 ⁇ g and 180 ⁇ g treatment groups) and 3 CMV- seropositive participants in the 180 ⁇ g treatment group reported lymphadenopathy. There have been no SAEs or AEs of special interest (AESI) in the study. Immunogenicity Immunogenicity data are based on the Per Protocol (PP) immunogenicity set, and are reported as neutralizing antibody (nAb) against fibroblast infection and nAb against epithelial cell infection. Overall Serum nAb responses after the 1 st and 2 nd vaccinations were dose-related and of comparable magnitude between Phase A subjects receiving hCMV mRNA vaccine A and Phase B CMV-seronegative subjects receiving hCMV mRNA vaccine A.
- PP Per Protocol
- nAb neutralizing antibody
- nAb GMTs against fibroblast infection and against epithelial cell infection in all treatment groups of Phase A and all treatment groups of CMV-seronegative subjects in Phase B were below the LLOQ (reported as 8, 0.5 x LLOQ), indicating the absence of natural CMV infection prior to immunization.
- nAb GMTs are comparable to healthy CMV-seropositive populations in a published report [Wang et al, Vaccine 2011:29].
- hCMV mRNA vaccine A Neutralizing Antibody Responses Phase A In Phase A participants, nAb GMT against fibroblast infection remained at baseline after the 1st vaccination, increased to ⁇ 4 fold over baseline in all subjects after the 2nd vaccination in a dose-related manner, and remained at ⁇ 4 fold over baseline after the 3rd vaccination with similar GMTs across dose levels. Decline in neutralizing antibodies titers was slower post 3 rd dose.
- nAb GMTs against fibroblast infection approached that of natural CMV infection at the 180 ⁇ g dose level (251.0, 418.6, and 1047.3 in the 30, 90, and 180 ⁇ g treatment groups, respectively), with GMT ranges overlapping the natural CMV infection benchmark at all dose levels.
- the nAb GMTs against epithelial cell infection at Month 12 exceeded the natural CMV infection benchmark at the 90 ⁇ g and 180 ⁇ g dose levels (5078.8, 13089.0, and 18915.9 in the 30, 90, and 180 ⁇ g treatment groups, respectively).
- Phase B CMV-seronegative Participants In Phase B CMV-seronegative participants, GMTs against fibroblast and against epithelial cell infection after the 1 st and 2 nd vaccinations were generally similar to or exceeded that of Phase A.
- Phase B nAb GMT against fibroblast infection increased in a dose-related manner after the 1 st vaccination, and increased further in a dose-related manner after the 2 nd vaccination to levels similar to the natural CMV infection benchmark in the 90 ⁇ g and 180 ⁇ g treatment groups (1140.6 and 1263.6, respectively).
- the nAb GMT against epithelial cell infection also increased in a dose-related manner after the 1 st vaccination, and increased further in a dose-related manner after the 2 nd vaccination to levels exceeding the natural CMV infection benchmark in the 90 ⁇ g and 180 ⁇ g treatment groups (15,305.3 and 30,742.9, respectively).
- Phase B CMV-seropositive Participants In Phase B CMV-seropositive subjects, the 1 st vaccination boosted nAb against fibroblast infection and against epithelial cell infection in a dose-related manner, with nAb GMRs against fibroblast infection of 2.43, 2.66, and 2.83, and against epithelial cell infection of 6.85, 6.93, and 9.26 in the 30, 90, and 180 ⁇ g treatment groups, respectively.
- the 2 nd vaccination slightly increased nAb GMRs against fibroblast infection at the two higher dose levels and substantially increased with GMRs against epithelial cell infection at all dose levels, with nAb GMRs against fibroblast infection of 2.30, 3.00, and 4.08, and nAb GMRs against epithelial cell infection of 13.15, 9.91, and 19.36 in the 30, 90, and 180 ⁇ g treatment groups, respectively.
- Serum nAb GMTs increased after each vaccination in a dose-related manner, and were numerically similar between Phase A subjects receiving hCMV mRNA vaccine A and Phase B CMV-seronegative subjects receiving hCMV mRNA vaccine A.
- nAb GMT against fibroblast infection approached the benchmark of natural CMV infection in the 90 ⁇ g and 180 ⁇ g treatment groups, and nAb GMT against epithelial cell infection exceeded the benchmark of natural CMV infection in all treatment groups.
- Neutralizing antibody GMTs were sufficiently boosted in CMV-seropositive subjects after a single vaccination, which increased further after the second vaccination for nAb GMTs against epithelial cell infection.
- seroresponses percentage of subjects with GMTs ⁇ 4x baseline titer
- were robust through the 2 nd vaccination and continued to be robust through 12 months in Phase A, suggesting sustained antibody responses to hCMV mRNA vaccine A through at least 6 months after the 3 rd vaccination.
- the proportions of subjects reporting injection site erythema after the 1 st or 2 nd vaccinations were generally low, with rates ranging 0-22% in CMV-seronegative subjects and 0- 18% in CMV-seropositive subjects across treatment groups. All 7 subjects reporting injection site erythema after either the 1 st or 2 nd vaccinations were in the 180 ⁇ g or 300 ⁇ g hCMV mRNA vaccine A treatment groups.
- One CMV-seronegative subject in the 300 ⁇ g treatment group and one CMV-seropositive subject in the 180 ⁇ g treatment group reported Grade 3 injection site erythema after the 2 nd vaccination.
- Phase B subjects after the 3 rd vaccination the rate and severity of injection site erythema reported did not substantially increase after the 3 rd vaccination compared to the 2nd vaccination. No subjects in the placebo group reported injection site erythema.
- the proportions of subjects reporting injection site swelling after the 1 st or 2 nd vaccinations were also low, with rates ranging 0-25% in CMV-seronegative subjects and 0-14% in CMV-seropositive subjects across treatment groups. More subjects reporting injection site swelling after either the 1 st or 2 nd vaccinations were in the 180 ⁇ g or 300 ⁇ g hCMV mRNA vaccine A treatment groups.
- the rates of injection site swelling remained low after the 3 rd vaccination.
- Phase B the following Grade 3 shifts from baseline of safety laboratory parameters were reported: hemoglobin in 2 placebo and 2 hCMV mRNA vaccine A recipients, hypoglycemia in 2 hCMV mRNA vaccine A recipients, high leukocytes in 1 placebo recipient, and elevated PTT in 1 hCMV mRNA vaccine A recipient.
- Phase C the following Grade 3 shifts from baseline of safety laboratory parameters were reported: hemoglobin in 1 placebo and hCMV mRNA vaccine A recipients, and hyperglycemia in 2 hCMV mRNA vaccine A recipients.
- Immunogenicity Neutralizing antibody data against epithelial cell infection and against fibroblast infection were based on the Per Protocol (PP) Immunogenicity Set, and were reported as geometric mean titer (GMT) and geometric mean ratio (GMR, defined as the ratio of baseline/post-baseline titers).
- the microneutralization assay for measurement of nAb titers against epithelial cell infection utilized CMV isolate VR1814 and ARPE-19 cells, and for measurement of nAb titers against fibroblast infection CMV isolate AD169 and HEL299 cells were utilized.
- Cell mediated immunogenicity data were based on the Cell-mediated Immunogenicity Set and were reported as SFC/10 6 PBMC. 1.
- Neutralizing antibodies against epithelial cell infection and against fibroblast infection increased in a dose-related manner and increased with subsequent hCMV mRNA vaccine A vaccinations within each hCMV mRNA vaccine A treatment group through Month 7 (1 month after the 3rd vaccination) in both CMV-seronegative and CMV-seropositive participants.
- nAb GMTs against epithelial infection remained at least 3.5-fold higher than the natural infection benchmark, and nAb GMTs against fibroblast infection approximated that of the natural infection benchmark in the in the 90 ⁇ g and 180 ⁇ g treatment groups.
- Neutralizing antibody responses were reported after each of the 3 vaccinations for Phase B and after the first 2 vaccinations for Phase C (Table 3, FIG.10, FIG.11).
- Neutralizing antibody GMT against epithelial cell infection increased in a dose-related manner and after each subsequent vaccination within hCMV mRNA vaccine A treatment groups.
- nAb GMT against epithelial cell infection were 3,263; 15,305; 30,743; and 43,564 in the 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, and 300 ⁇ g treatment groups, respectively, which exceeded the natural infection benchmark in the 90 ⁇ g, 180 ⁇ g, and 300 ⁇ g treatment groups.
- nAb GMTs against epithelial cell infection increased further to 16,587; 63,929; and 62,118 in the 30 ⁇ g, 90 ⁇ g, 180 ⁇ g treatment groups, respectively, which exceeded the natural infection benchmark in all hCMV mRNA vaccine A treatment groups.
- Neutralizing antibody against fibroblast infection generally increased in a dose-related manner and after each subsequent vaccination within hCMV mRNA vaccine A treatment groups.
- nAb GMTs against fibroblast infection were 1,131; 1,890; and 2,029 in the 30 ⁇ g, 90 ⁇ g, 180 ⁇ g treatment groups, respectively, exceeding the natural infection benchmark in the 90 ⁇ g, 180 ⁇ g treatment groups.
- nAb seroresponse percentage of subjects with nAb titer ⁇ 4x baseline titer
- epithelial cell infection was achieved in 100% of subjects in all treatment groups across Phase B and Phase C
- nAb seroresponse against fibroblast infection was achieved in 93% of subjects in the 30 ⁇ g treatment group and in 100% of subjects in the 90 ⁇ g, 180 ⁇ g, and 300 ⁇ g treatment groups.
- Table 3, Figure 12 and Figure 13 summarize nAb data through Month 12 in the Phase B treatment groups.
- GMTs of nAbs against epithelial cell infection in the 30 ⁇ g, 90 ⁇ g and 180 ⁇ g treatment groups were 16,587 (95% CI 9,186; 29,952), 63,929 (95% CI 38,441; 106,317), and 62,118 (95% CI 33,829; 114,065), which represented GMTs that were 2.8-fold, 10.8-fold, and 10.5-fold higher than the natural infection benchmark.
- GMTs in the 30 ⁇ g, 90 ⁇ g and 180 ⁇ g treatment groups were 6,414 (95% CI 3,457; 10,908), 21,211 (95% CI 13,689; 32,865), and 23,020 (95%CI 12,473; 42,484), respectively, indicating GMTs were maintained at 3.6-fold and 3.9-fold higher than the natural infection benchmark 90 ⁇ g and 180 ⁇ g treatment groups at 6 months after the last vaccination (Table 3).
- GMTs of nAb against fibroblast infection in the 30 ⁇ g, 90 ⁇ g and 180 ⁇ g treatment groups were 1,131 (95%CI 531; 2,408), 1,890 (95%CI 918; 3,890), and 2,029 (95%CI 1,042; 3,953), exceeding the natural infection benchmark by 1.3-fold to 1.4-fold in the 90 ⁇ g and 180 ⁇ g treatment groups.
- GMT geometric mean titer
- GMR geometric mean ratio
- N number of participants in any Per Protocol set
- n number of participants contributing data at the corresponding timepoint.
- One CMV-seronegative placebo recipient has a seroconversion pattern onset between Month 1 and Month 3. ⁇ One participant had indeterminate result at previous interim analysis, sample re-run per protocol and included in this interim analysis. 4.
- CMV-seropositive Subjects Baseline nAb GMTs against epithelial cell infection ranged 3,614-7,179 in the hCMV mRNA vaccine A treatment groups and 6,900- 8,169 in the placebo groups, indicating presence of natural CMV infection prior to enrollment. Neutralizing antibody responses were reported after each of the 3 vaccinations for Phase B and after the first 2 vaccinations for Phase C (Table 4, FIG.10, FIG.11).
- nAb GMTs against epithelial cell infection 49,390; 62,400; 119,829, and 156,583 and nAb GMTs against fibroblast infection of 2,517; 3,891; 5,578; and 7,788 at 1 month after the 2 nd vaccination in the 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, and 300 ⁇ g treatment groups, respectively.
- nAb GMTs against epithelial cell infection were 76,914; 141,020; and 211,503 and nAb GMTs against fibroblast infection were 3,412; 8,433; and 6,098 in the 30 ⁇ g, 90 ⁇ g, and 180 ⁇ g treatment groups, respectively. Accordingly, GMRs also increased.
- nAb GMRs against epithelial cell infection were 14.4, 9.9, 19.4, and 17.3 and nAb GMRs against fibroblast infection were 2.5, 3.0, 4.1, and 3.8 in the 30 ⁇ g, 90 ⁇ g, 180 ⁇ g, and 300 ⁇ g treatment groups, respectively.
- nAb GMRs against epithelial cell infection were 26.2, 22.4, and 40.8 and nAb GMR against fibroblast infection were 4.0, 6.5, and 3.9 in the 30 ⁇ g, 90 ⁇ g, 180 ⁇ g treatment groups, respectively.
- Table 4 summarizes nAb data through Month 12 in CMV-seropositive participants in the Phase B treatment groups.
- GMTs of nAbs against epithelial cell infection in the 30 ⁇ g, 90 ⁇ g and 180 ⁇ g treatment groups were 76,914 (95%CI 49,001; 120,727), 141,020 (95%CI 57,649; 344,960), and 211,503 (95%CI 58,207; 768,525), yielding corresponding GMRs of 26.2, 22.4, and 40.8.
- GMTs of nAbs against fibroblast infection were 3,412 (95%CI 1,924; 6,052); 8,433 (95%CI 6,582; 10,804); and 6,427 (95%CI 3,426; 12,057) in the 30 ⁇ g, 90 ⁇ g, and 180 ⁇ g treatment groups, respectively, resulting in GMRs ranging 4-6.5 at the Month 7 timepoint.
- GMTs were 7,170 (95%CI 4,052; 12,686), 7,640 (95%CI 4,602; 12,685), and 10,030 (95%CI 7,577;13,276) in the 30 ⁇ g, 90 ⁇ g and 180 ⁇ g treatment groups, respectively, resulting in GMRs of 8.1, 5.9, and 6.3, respectively, after the 3rd vaccination (Table 4).
- the Month 12 nAb data were generated in assay runs that were separate from the assay runs generating the nAb data at all previous timepoints (Baseline through Month 7).
- the overall rates of solicited systemic ARs generally numerically increased with hCMV mRNA vaccine A dose through 180 ⁇ g and were generally similar between the 180 ⁇ g and 300 ⁇ g treatment groups.
- the frequencies of solicited ARs were generally numerically higher after the 1 st vaccination, a possible clinical manifestation of an immunologic “boosting” effect in subjects with a history of natural CMV infection prior to enrollment.
- Seven subjects reported transient, mild-moderate axillary lymph node symptoms ipsilateral to the vaccinated arm, which may represent a benign clinical manifestation of vaccine-induced immune activation.
- the frequency of solicited local and systemic ARs was generally higher in the 300 ⁇ g treatment group compared to the 180 ⁇ g treatment group. Proportions of participants reporting severe solicited ARs were similar between the 180 ⁇ g and 300 ⁇ g treatment groups.
- nAb GMTs generally met the natural infection benchmark after the 2 nd vaccination in the 90 ⁇ g, 180 ⁇ g, and 300 ⁇ g treatment groups and generally met or exceeded the natural infection benchmark after the 3 rd vaccination in all hCMV mRNA vaccine A treatment groups of Phase B.
- a single hCMV mRNA vaccine A vaccination boosted GMTs in a dose-related manner and further boosted nAb titers to GMRs at least 2.5-fold over baseline across all hCMV mRNA vaccine A treatment groups the 2 nd vaccination and to GMRs at least 3.9-fold after the 3 rd vaccination in the Phase B hCMV mRNA vaccine A treatment groups.
- Post-vaccination gB-specific T cell activation was observed across Phase B dose levels.
- GMRs of nAb against epithelial cell infection ranged 14-31 across the 30 ⁇ g, 90 ⁇ g and 180 ⁇ g treatment groups, and GMRs of nAb against fibroblast infection ranged 6-8.
- SEQUENCES It should be understood that any of the mRNA sequences described herein may include a 5' UTR and/or a 3' UTR.
- the UTR sequences may be selected from the following sequences, or other known UTR sequences may be used.
- any of the mRNA constructs described herein may further comprise a polyA tail and/or cap (e.g., 7mG(5’)ppp(5’)NlmpNp).
- a polyA tail and/or cap e.g., 7mG(5’)ppp(5’)NlmpNp.
- some of the mRNAs and encoded antigen sequences described herein may include a signal peptide and/or a peptide tag (e.g., C-terminal His tag), it should be understood that the indicated signal peptide and/or peptide tag may be substituted for a different signal peptide and/or peptide tag, or the signal peptide and/or peptide tag may be omitted. (SEQ ID NO: 13) 3’ UTR: Table 5 – hCMV mRNA and antigen sequences
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Dispersion Chemistry (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3154082A CA3154082A1 (en) | 2019-09-11 | 2020-09-11 | Human cytomegalovirus vaccine |
| JP2022515906A JP2022547313A (ja) | 2019-09-11 | 2020-09-11 | ヒトサイトメガロウイルスワクチン |
| US17/641,967 US20220347292A1 (en) | 2019-09-11 | 2020-09-11 | Human cytomegalovirus vaccine |
| EP20863988.0A EP4028030A4 (en) | 2019-09-11 | 2020-09-11 | VACCINE AGAINST HUMAN CYTOMEGALOVIRUS |
| AU2020346041A AU2020346041A1 (en) | 2019-09-11 | 2020-09-11 | Human cytomegalovirus vaccine |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962899129P | 2019-09-11 | 2019-09-11 | |
| US62/899,129 | 2019-09-11 | ||
| US201962899624P | 2019-09-12 | 2019-09-12 | |
| US62/899,624 | 2019-09-12 | ||
| US202062958623P | 2020-01-08 | 2020-01-08 | |
| US62/958,623 | 2020-01-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021050864A1 true WO2021050864A1 (en) | 2021-03-18 |
Family
ID=74867306
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/050392 Ceased WO2021050864A1 (en) | 2019-09-11 | 2020-09-11 | Human cytomegalovirus vaccine |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20220347292A1 (https=) |
| EP (1) | EP4028030A4 (https=) |
| JP (1) | JP2022547313A (https=) |
| AU (1) | AU2020346041A1 (https=) |
| CA (1) | CA3154082A1 (https=) |
| WO (1) | WO2021050864A1 (https=) |
Cited By (47)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11197927B2 (en) | 2016-10-21 | 2021-12-14 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11202793B2 (en) | 2016-09-14 | 2021-12-21 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US11207398B2 (en) | 2017-09-14 | 2021-12-28 | Modernatx, Inc. | Zika virus mRNA vaccines |
| US11235052B2 (en) | 2015-10-22 | 2022-02-01 | Modernatx, Inc. | Chikungunya virus RNA vaccines |
| WO2022046898A1 (en) * | 2020-08-25 | 2022-03-03 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11285222B2 (en) | 2015-12-10 | 2022-03-29 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US11364292B2 (en) | 2015-07-21 | 2022-06-21 | Modernatx, Inc. | CHIKV RNA vaccines |
| US11384352B2 (en) | 2016-12-13 | 2022-07-12 | Modernatx, Inc. | RNA affinity purification |
| US11406703B2 (en) | 2020-08-25 | 2022-08-09 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11464848B2 (en) | 2017-03-15 | 2022-10-11 | Modernatx, Inc. | Respiratory syncytial virus vaccine |
| US11485960B2 (en) | 2019-02-20 | 2022-11-01 | Modernatx, Inc. | RNA polymerase variants for co-transcriptional capping |
| US11484590B2 (en) | 2015-10-22 | 2022-11-01 | Modernatx, Inc. | Human cytomegalovirus RNA vaccines |
| US11497807B2 (en) | 2017-03-17 | 2022-11-15 | Modernatx, Inc. | Zoonotic disease RNA vaccines |
| US11547673B1 (en) | 2020-04-22 | 2023-01-10 | BioNTech SE | Coronavirus vaccine |
| CN115611757A (zh) * | 2021-07-16 | 2023-01-17 | 江苏慧聚药业股份有限公司 | mRNA传递剂的合成 |
| US11564893B2 (en) | 2015-08-17 | 2023-01-31 | Modernatx, Inc. | Methods for preparing particles and related compositions |
| US11576961B2 (en) | 2017-03-15 | 2023-02-14 | Modernatx, Inc. | Broad spectrum influenza virus vaccine |
| WO2023015904A1 (zh) * | 2021-08-13 | 2023-02-16 | 广州谷森制药有限公司 | 一种新型阳离子脂质化合物 |
| US11643441B1 (en) | 2015-10-22 | 2023-05-09 | Modernatx, Inc. | Nucleic acid vaccines for varicella zoster virus (VZV) |
| US11696946B2 (en) | 2016-11-11 | 2023-07-11 | Modernatx, Inc. | Influenza vaccine |
| US11744801B2 (en) | 2017-08-31 | 2023-09-05 | Modernatx, Inc. | Methods of making lipid nanoparticles |
| US11752206B2 (en) | 2017-03-15 | 2023-09-12 | Modernatx, Inc. | Herpes simplex virus vaccine |
| US11767548B2 (en) | 2017-08-18 | 2023-09-26 | Modernatx, Inc. | RNA polymerase variants |
| US11786607B2 (en) | 2017-06-15 | 2023-10-17 | Modernatx, Inc. | RNA formulations |
| WO2023212696A1 (en) | 2022-04-29 | 2023-11-02 | Modernatx, Inc. | Lyophilized human cytomegalovirus vaccines |
| US11851694B1 (en) | 2019-02-20 | 2023-12-26 | Modernatx, Inc. | High fidelity in vitro transcription |
| US11866696B2 (en) | 2017-08-18 | 2024-01-09 | Modernatx, Inc. | Analytical HPLC methods |
| US11872278B2 (en) | 2015-10-22 | 2024-01-16 | Modernatx, Inc. | Combination HMPV/RSV RNA vaccines |
| US11878055B1 (en) | 2022-06-26 | 2024-01-23 | BioNTech SE | Coronavirus vaccine |
| US11905525B2 (en) | 2017-04-05 | 2024-02-20 | Modernatx, Inc. | Reduction of elimination of immune responses to non-intravenous, e.g., subcutaneously administered therapeutic proteins |
| US11911453B2 (en) | 2018-01-29 | 2024-02-27 | Modernatx, Inc. | RSV RNA vaccines |
| US11912982B2 (en) | 2017-08-18 | 2024-02-27 | Modernatx, Inc. | Methods for HPLC analysis |
| US11918644B2 (en) | 2017-03-15 | 2024-03-05 | Modernatx, Inc. | Varicella zoster virus (VZV) vaccine |
| WO2024051150A1 (zh) * | 2022-09-09 | 2024-03-14 | 青岛大学 | 一种人巨细胞病毒重组载体及其制备方法和应用 |
| US12070495B2 (en) | 2019-03-15 | 2024-08-27 | Modernatx, Inc. | HIV RNA vaccines |
| US12090235B2 (en) | 2018-09-20 | 2024-09-17 | Modernatx, Inc. | Preparation of lipid nanoparticles and methods of administration thereof |
| US12128113B2 (en) | 2016-05-18 | 2024-10-29 | Modernatx, Inc. | Polynucleotides encoding JAGGED1 for the treatment of Alagille syndrome |
| US12151029B2 (en) | 2018-09-19 | 2024-11-26 | Modernatx, Inc. | PEG lipids and uses thereof |
| US12150980B2 (en) | 2015-07-30 | 2024-11-26 | Modernatx, Inc. | Concatemeric peptide epitope RNAs |
| US12186387B2 (en) | 2021-11-29 | 2025-01-07 | BioNTech SE | Coronavirus vaccine |
| US12274743B2 (en) | 2014-04-23 | 2025-04-15 | Modernatx, Inc. | Nucleic acid vaccines |
| US12329811B2 (en) | 2021-01-11 | 2025-06-17 | Modernatx, Inc. | Seasonal RNA influenza virus vaccines |
| US12383508B2 (en) | 2018-09-19 | 2025-08-12 | Modernatx, Inc. | High-purity peg lipids and uses thereof |
| US12428577B2 (en) | 2021-05-14 | 2025-09-30 | Modernatx, Inc. | Methods of monitoring in vitro transcription of mRNA and/or post-in vitro transcription processes |
| US12460259B2 (en) | 2019-03-11 | 2025-11-04 | Modernatx, Inc. | Fed-batch in vitro transcription process |
| US12529047B1 (en) | 2021-12-21 | 2026-01-20 | Modernatx, Inc. | mRNA quantification methods |
| US12582609B2 (en) | 2015-10-22 | 2026-03-24 | Modernatx, Inc. | Cancer vaccines |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017070613A1 (en) * | 2015-10-22 | 2017-04-27 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| WO2018075980A1 (en) * | 2016-10-21 | 2018-04-26 | Modernatx, Inc. | Human cytomegalovirus vaccine |
-
2020
- 2020-09-11 CA CA3154082A patent/CA3154082A1/en active Pending
- 2020-09-11 EP EP20863988.0A patent/EP4028030A4/en not_active Withdrawn
- 2020-09-11 WO PCT/US2020/050392 patent/WO2021050864A1/en not_active Ceased
- 2020-09-11 AU AU2020346041A patent/AU2020346041A1/en not_active Abandoned
- 2020-09-11 JP JP2022515906A patent/JP2022547313A/ja not_active Withdrawn
- 2020-09-11 US US17/641,967 patent/US20220347292A1/en not_active Abandoned
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017070613A1 (en) * | 2015-10-22 | 2017-04-27 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| WO2018075980A1 (en) * | 2016-10-21 | 2018-04-26 | Modernatx, Inc. | Human cytomegalovirus vaccine |
Non-Patent Citations (4)
| Title |
|---|
| ANONYMOUS: "Safety, Reactogenicity, and Immunogenicity of Cytomegalovirus Vaccines mRNA-1647 and mRNA-1443 in Healthy Adults", XP055911870, Retrieved from the Internet <URL:https://www.clinicaltrials.gov/ct2/show/study/NCT03382405?term=modernatx&draw=3&rank=14> [retrieved on 20220412] * |
| JOHN, S. ET AL.: "Multi-antigenic human cytomegalovirus mRNA vaccines that elicit potent humoral and cell -mediated immunity", VACCINE, vol. 36, no. 12, 14 March 2018 (2018-03-14), pages 1689 - 1699, XP055695626, DOI: 10.1016/j.vaccine. 2018.01.02 9. * |
| See also references of EP4028030A4 * |
| WUSSOW, FELIX, CHIUPPESI FLAVIA, CONTRERAS HEIDI, DIAMOND DON: "Neutralization of Human Cytomegalovirus Entry into Fibroblasts and Epithelial Cells", VACCINES (BASEL, vol. 5, no. 4, December 2017 (2017-12-01), pages 39, XP055803650, DOI: 10.3390/vaccines5040039 * |
Cited By (71)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12274743B2 (en) | 2014-04-23 | 2025-04-15 | Modernatx, Inc. | Nucleic acid vaccines |
| US12329812B2 (en) | 2014-04-23 | 2025-06-17 | Modernatx, Inc. | Nucleic acid vaccines |
| US11364292B2 (en) | 2015-07-21 | 2022-06-21 | Modernatx, Inc. | CHIKV RNA vaccines |
| US12150980B2 (en) | 2015-07-30 | 2024-11-26 | Modernatx, Inc. | Concatemeric peptide epitope RNAs |
| US11564893B2 (en) | 2015-08-17 | 2023-01-31 | Modernatx, Inc. | Methods for preparing particles and related compositions |
| US12521577B2 (en) | 2015-10-22 | 2026-01-13 | Modernatx, Inc. | Betacoronavirus RNA vaccines |
| US12551734B2 (en) | 2015-10-22 | 2026-02-17 | Modernatx, Inc. | Betacoronavirus mRNA vaccines |
| US11278611B2 (en) | 2015-10-22 | 2022-03-22 | Modernatx, Inc. | Zika virus RNA vaccines |
| US11872278B2 (en) | 2015-10-22 | 2024-01-16 | Modernatx, Inc. | Combination HMPV/RSV RNA vaccines |
| US12208288B2 (en) | 2015-10-22 | 2025-01-28 | Modernatx, Inc. | Betacoronavirus RNA vaccines |
| US12582609B2 (en) | 2015-10-22 | 2026-03-24 | Modernatx, Inc. | Cancer vaccines |
| US11235052B2 (en) | 2015-10-22 | 2022-02-01 | Modernatx, Inc. | Chikungunya virus RNA vaccines |
| US11484590B2 (en) | 2015-10-22 | 2022-11-01 | Modernatx, Inc. | Human cytomegalovirus RNA vaccines |
| US11643441B1 (en) | 2015-10-22 | 2023-05-09 | Modernatx, Inc. | Nucleic acid vaccines for varicella zoster virus (VZV) |
| US12403335B2 (en) | 2015-10-22 | 2025-09-02 | Modernatx, Inc. | Betacoronavirus MRNA vaccines |
| US12403336B2 (en) | 2015-10-22 | 2025-09-02 | Modernatx, Inc. | Betacorona virus mRNA vaccines |
| US12409347B2 (en) | 2015-10-22 | 2025-09-09 | Modernatx, Inc. | Betacoronavirus mRNA vaccines |
| US11285222B2 (en) | 2015-12-10 | 2022-03-29 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US12491260B2 (en) | 2015-12-10 | 2025-12-09 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US12128113B2 (en) | 2016-05-18 | 2024-10-29 | Modernatx, Inc. | Polynucleotides encoding JAGGED1 for the treatment of Alagille syndrome |
| US12233084B2 (en) | 2016-09-14 | 2025-02-25 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US12246029B2 (en) | 2016-09-14 | 2025-03-11 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US11202793B2 (en) | 2016-09-14 | 2021-12-21 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US11541113B2 (en) | 2016-10-21 | 2023-01-03 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11197927B2 (en) | 2016-10-21 | 2021-12-14 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11696946B2 (en) | 2016-11-11 | 2023-07-11 | Modernatx, Inc. | Influenza vaccine |
| US12318443B2 (en) | 2016-11-11 | 2025-06-03 | Modernatx, Inc. | Influenza vaccine |
| US12409218B2 (en) | 2016-11-11 | 2025-09-09 | Modernatx, Inc. | Influenza vaccine |
| US11384352B2 (en) | 2016-12-13 | 2022-07-12 | Modernatx, Inc. | RNA affinity purification |
| US11576961B2 (en) | 2017-03-15 | 2023-02-14 | Modernatx, Inc. | Broad spectrum influenza virus vaccine |
| US11752206B2 (en) | 2017-03-15 | 2023-09-12 | Modernatx, Inc. | Herpes simplex virus vaccine |
| US11464848B2 (en) | 2017-03-15 | 2022-10-11 | Modernatx, Inc. | Respiratory syncytial virus vaccine |
| US11918644B2 (en) | 2017-03-15 | 2024-03-05 | Modernatx, Inc. | Varicella zoster virus (VZV) vaccine |
| US11497807B2 (en) | 2017-03-17 | 2022-11-15 | Modernatx, Inc. | Zoonotic disease RNA vaccines |
| US11905525B2 (en) | 2017-04-05 | 2024-02-20 | Modernatx, Inc. | Reduction of elimination of immune responses to non-intravenous, e.g., subcutaneously administered therapeutic proteins |
| US11786607B2 (en) | 2017-06-15 | 2023-10-17 | Modernatx, Inc. | RNA formulations |
| US11912982B2 (en) | 2017-08-18 | 2024-02-27 | Modernatx, Inc. | Methods for HPLC analysis |
| US12195778B2 (en) | 2017-08-18 | 2025-01-14 | Modernatx, Inc. | RNA polymerase variants |
| US11767548B2 (en) | 2017-08-18 | 2023-09-26 | Modernatx, Inc. | RNA polymerase variants |
| US11866696B2 (en) | 2017-08-18 | 2024-01-09 | Modernatx, Inc. | Analytical HPLC methods |
| US11744801B2 (en) | 2017-08-31 | 2023-09-05 | Modernatx, Inc. | Methods of making lipid nanoparticles |
| US12357575B2 (en) | 2017-08-31 | 2025-07-15 | Modernatx, Inc. | Methods of making lipid nanoparticles |
| US11207398B2 (en) | 2017-09-14 | 2021-12-28 | Modernatx, Inc. | Zika virus mRNA vaccines |
| US11911453B2 (en) | 2018-01-29 | 2024-02-27 | Modernatx, Inc. | RSV RNA vaccines |
| US12453766B2 (en) | 2018-01-29 | 2025-10-28 | Modernatx, Inc. | RSV RNA vaccines |
| US12151029B2 (en) | 2018-09-19 | 2024-11-26 | Modernatx, Inc. | PEG lipids and uses thereof |
| US12383508B2 (en) | 2018-09-19 | 2025-08-12 | Modernatx, Inc. | High-purity peg lipids and uses thereof |
| US12090235B2 (en) | 2018-09-20 | 2024-09-17 | Modernatx, Inc. | Preparation of lipid nanoparticles and methods of administration thereof |
| US11851694B1 (en) | 2019-02-20 | 2023-12-26 | Modernatx, Inc. | High fidelity in vitro transcription |
| US12180518B2 (en) | 2019-02-20 | 2024-12-31 | Modernatx, Inc. | RNA polymerase variants for co-transcriptional capping |
| US11485960B2 (en) | 2019-02-20 | 2022-11-01 | Modernatx, Inc. | RNA polymerase variants for co-transcriptional capping |
| US12460259B2 (en) | 2019-03-11 | 2025-11-04 | Modernatx, Inc. | Fed-batch in vitro transcription process |
| US12070495B2 (en) | 2019-03-15 | 2024-08-27 | Modernatx, Inc. | HIV RNA vaccines |
| US11547673B1 (en) | 2020-04-22 | 2023-01-10 | BioNTech SE | Coronavirus vaccine |
| US11951185B2 (en) | 2020-04-22 | 2024-04-09 | BioNTech SE | RNA constructs and uses thereof |
| US11779659B2 (en) | 2020-04-22 | 2023-10-10 | BioNTech SE | RNA constructs and uses thereof |
| US12133899B2 (en) | 2020-04-22 | 2024-11-05 | BioNTech SE | Coronavirus vaccine |
| US11925694B2 (en) | 2020-04-22 | 2024-03-12 | BioNTech SE | Coronavirus vaccine |
| US11406703B2 (en) | 2020-08-25 | 2022-08-09 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| WO2022046898A1 (en) * | 2020-08-25 | 2022-03-03 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US12329811B2 (en) | 2021-01-11 | 2025-06-17 | Modernatx, Inc. | Seasonal RNA influenza virus vaccines |
| US12428577B2 (en) | 2021-05-14 | 2025-09-30 | Modernatx, Inc. | Methods of monitoring in vitro transcription of mRNA and/or post-in vitro transcription processes |
| CN115611757A (zh) * | 2021-07-16 | 2023-01-17 | 江苏慧聚药业股份有限公司 | mRNA传递剂的合成 |
| WO2023284217A1 (zh) * | 2021-07-16 | 2023-01-19 | 江苏慧聚药业有限公司 | mRNA传递剂的合成 |
| WO2023015904A1 (zh) * | 2021-08-13 | 2023-02-16 | 广州谷森制药有限公司 | 一种新型阳离子脂质化合物 |
| US12208136B2 (en) | 2021-11-29 | 2025-01-28 | BioNTech SE | Coronavirus vaccine |
| US12186387B2 (en) | 2021-11-29 | 2025-01-07 | BioNTech SE | Coronavirus vaccine |
| US12529047B1 (en) | 2021-12-21 | 2026-01-20 | Modernatx, Inc. | mRNA quantification methods |
| WO2023212696A1 (en) | 2022-04-29 | 2023-11-02 | Modernatx, Inc. | Lyophilized human cytomegalovirus vaccines |
| US11878055B1 (en) | 2022-06-26 | 2024-01-23 | BioNTech SE | Coronavirus vaccine |
| WO2024051150A1 (zh) * | 2022-09-09 | 2024-03-14 | 青岛大学 | 一种人巨细胞病毒重组载体及其制备方法和应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022547313A (ja) | 2022-11-11 |
| CA3154082A1 (en) | 2021-03-18 |
| AU2020346041A1 (en) | 2022-03-31 |
| US20220347292A1 (en) | 2022-11-03 |
| EP4028030A1 (en) | 2022-07-20 |
| EP4028030A4 (en) | 2023-09-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220347292A1 (en) | Human cytomegalovirus vaccine | |
| US11406703B2 (en) | Human cytomegalovirus vaccine | |
| JP7443608B2 (ja) | SARS-COV-2 mRNAドメインワクチン | |
| US20220378904A1 (en) | Hmpv mrna vaccine composition | |
| US20240299531A1 (en) | Therapeutic use of sars-cov-2 mrna domain vaccines | |
| US20240285754A1 (en) | Mrna vaccines encoding flexible coronavirus spike proteins | |
| US20240139309A1 (en) | Variant strain-based coronavirus vaccines | |
| US20240293534A1 (en) | Coronavirus glycosylation variant vaccines | |
| US20230355743A1 (en) | Multi-proline-substituted coronavirus spike protein vaccines | |
| WO2021211343A1 (en) | Zika virus mrna vaccines | |
| WO2021222304A1 (en) | Sars-cov-2 rna vaccines | |
| WO2023092069A1 (en) | Sars-cov-2 mrna domain vaccines and methods of use | |
| WO2021159130A2 (en) | Coronavirus rna vaccines and methods of use | |
| WO2023283642A2 (en) | Pan-human coronavirus concatemeric vaccines | |
| AU2017345766A1 (en) | Human cytomegalovirus vaccine | |
| US20220401551A1 (en) | Human cytomegalovirus vaccine | |
| KR20220010500A (ko) | 난소암 치료용 rna | |
| TW202217000A (zh) | Sars—cov—2 mrna結構域疫苗 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20863988 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2022515906 Country of ref document: JP Kind code of ref document: A Ref document number: 3154082 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020346041 Country of ref document: AU Date of ref document: 20200911 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020863988 Country of ref document: EP Effective date: 20220411 |