WO2021034976A1 - T-cell immunotherapy specific for wt-1 - Google Patents

T-cell immunotherapy specific for wt-1 Download PDF

Info

Publication number
WO2021034976A1
WO2021034976A1 PCT/US2020/047071 US2020047071W WO2021034976A1 WO 2021034976 A1 WO2021034976 A1 WO 2021034976A1 US 2020047071 W US2020047071 W US 2020047071W WO 2021034976 A1 WO2021034976 A1 WO 2021034976A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
cell
acid sequence
modified immune
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/047071
Other languages
English (en)
French (fr)
Inventor
Thomas M. Schmitt
Aude G. CHAPUIS
Philip D. Greenberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fred Hutchinson Cancer Center
Original Assignee
Fred Hutchinson Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fred Hutchinson Cancer Center filed Critical Fred Hutchinson Cancer Center
Priority to CN202080071763.9A priority Critical patent/CN114555790B/zh
Priority to EP20771665.5A priority patent/EP4017872A1/en
Priority to US17/636,314 priority patent/US20220409661A1/en
Priority to AU2020334064A priority patent/AU2020334064A1/en
Priority to KR1020227009102A priority patent/KR20220050176A/ko
Priority to JP2022510984A priority patent/JP7737978B2/ja
Priority to CA3147717A priority patent/CA3147717A1/en
Publication of WO2021034976A1 publication Critical patent/WO2021034976A1/en
Priority to IL290609A priority patent/IL290609A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/15Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2013IL-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2086IL-13 to IL-16
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001152Transcription factors, e.g. SOX or c-MYC
    • A61K39/001153Wilms tumor 1 [WT1]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4242Transcription factors, e.g. SOX or c-MYC
    • A61K40/4243Wilms tumor 1 [WT1]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5158Antigen-pulsed cells, e.g. T-cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/54Pancreas
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/32Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/106Plasmid DNA for vertebrates
    • C12N2800/107Plasmid DNA for vertebrates for mammalian
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/22Vectors comprising a coding region that has been codon optimised for expression in a respective host

Definitions

  • T cell receptor (TCR) gene therapy is an emerging treatment approach designed to overcome obstacles associated with conventional T cell adoptive immunotherapy, such as the extensive time and labor required to isolate, characterize, and expand tumor antigen-specific T cells (Schmitt et al ., Hum. Gene Ther. 20: 1240, 2009).
  • Another hurdle is that most identified tumor antigens that can be targeted by T cell immunotherapy are over-expressed self-proteins, so high affinity T cells specific for these antigens are generally eliminated during thymic selection, and are rare or non existent in the peripheral repertoire.
  • a precondition for targeted T-cell therapy achieving a maximal clinical effect that would be accompanied by minimal immunological toxicity involves identifying disease-associated antigens with high expression in and presentation by, for example, a malignant cell compartment, but without significant expression in normal tissue.
  • AML acute myeloid leukemia
  • WT-1 Wilms tumor protein 1
  • LSC leukemia stem cell
  • HSCs physiological hematopoietic stem cells
  • WT-1 expression has been reported to be a marker of minimal residual disease because increased transcript levels in patients with AML in morphologic remission were predictive of overt clinical relapse (Inoue etal., Blood 84: 3071, 1994; Ogawa etal., Blood 707:1698, 2003).
  • WT-1 is an intracellular (usually nuclear) protein
  • immunotherapies targeting WT-1 have used cellular approaches aimed at generating WT-1 -specific CD8 + cytotoxic T lymphocyte (CTL) responses that recognize peptides presented on the cell surface by MHC class I molecules.
  • CTL cytotoxic T lymphocyte
  • intracellular proteins are usually degraded by the proteasome or endo/lysosomes, with the resulting peptide fragments binding to MHC class I or class II molecules.
  • These peptide-MHC complexes are displayed on the cell surface where they are bound by T cells via the peptide-MHC-TCR interaction.
  • WT-1 human leukocyte antigen
  • HLA human leukocyte antigen
  • WT-1 is a self-protein
  • immunization may only elicit responses by T cells with low affinity TCRs.
  • antibodies against WT-1 are detectable in patients with hematopoietic malignancies and solid tumors, which show that WT-1 can be a highly immunogenic antigen (Gaiger et al., Clin. Cancer Res. 7 (Suppl. 3):761, 2001).
  • binding proteins that are capable of binding to a RMFPNAPYL (SEQ ID NO:94):human leukocyte antigen (HLA) complex, wherein the binding proteins comprise (a) a T cell receptor (TCR) a chain variable (Va) domain comprising the CDR3 amino acid sequence (CDR3a) according to any one of SEQ ID NOs.
  • TCR b chain variable (Ub) domain wherein the Ub optionally comprises or consists of an amino acid sequence having at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) identity to the amino acid sequence set forth in any one of SEQ ID NOs.:5-8 or 13-16; (b) a TCR nb domain comprising the CDR3 amino acid sequence (CDR3P) according to any one of SEQ ID NOs.:31, 34, 37, or 40, or a variant thereof, and a TCR Va domain, wherein the Va optionally comprises or consists of an amino acid sequence having at least 90% identity to the amino acid sequence set forth in any one of SEQ ID NOs.: 1-4 or 9-12; or (c) a TCR Va domain of (a), and a TCR nb domain of (b).
  • the Ub optionally comprises or consists of an amino acid sequence having at least 90% (e.g., 90%, 9
  • a binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.: 94): human leukocyte antigen (HLA) complex with an IFNy production pECso of 4.0, 4.5, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1,
  • an immune cell (such as, for example, a T cell, aNK-T cell, or aNK cell) comprising the binding protein has a SEQ ID NO.:94:HLA IFNy production pECsoof 4.0, 4.5, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2,
  • the HLA comprises HLA-A*0201.
  • the binding protein is human, humanized, or chimeric.
  • a binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.:94):human leukocyte antigen (HLA) complex, wherein the binding protein comprises a TCR nb domain and a TCR Va domain, wherein: (i) the nb domain comprises or consists of an amino acid sequence having at least 90% identity (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) to the amino acid sequence of any one of SEQ ID NOs.: 5-8 or 13-16; and/or (ii) the Va domain comprises or consists of an amino acid sequence having at least 90% identity to the amino acid sequence of any one of SEQ ID NOs.: 1- 4 or 9-12.
  • RMFPNAPYL SEQ ID NO.:94
  • HLA human leukocyte antigen
  • the encoded binding protein is a TCR, a CAR, or a scTCR.
  • modified immune cells that comprise a heterologous polynucleotide that encodes a binding protein as disclosed herein.
  • the immune cell comprises a T cell, a NK cell, a NK-T cell, or any combination thereof.
  • an immune cell encoding a binding protein as disclosed herein is activated in the presence of a peptide according to SEQ ID NO.:94 ( e.g ., comprised in a peptide:HLA complex).
  • an immune cell encoding a binding protein as disclosed herein is capable of killing a target cell expressing a SEQ ID NO: 94:HLA complex.
  • the encoded binding protein comprises: (i) the amino acid sequence set forth in any one of SEQ ID NOs.:
  • the polynucleotide comprises or consists of a polynucleotide having at least 75% (e.g, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identity to the nucleotide sequence set forth in any one of SEQ ID NOs.: 62-81.
  • the polynucleotide is codon- optimized for expression in a host cell, such an immune cell (e.g, human T cell).
  • Vectors that contain a polynucleotide as described herein are also provided, as well as compositions that comprise a presently disclosed modified cell, binding protein, polynucleotide, and/or vector.
  • the disease or disorder is a hematological malignancy or a solid cancer.
  • the hematological malignancy to be treated may be acute lymphoblastic leukemia (ALL), acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloid leukemia (AML, including refractory and relapsed AML, and including acute myeloblastic leukemia, acute promyelocitic leukemia, acute myelocytic leukemia, acute myelomonocytic leukemia (e.g ., with or without eosinophilia), acute monocytic leukemia, acute erythroid leukemia, and acute megakaryoblastic leukemia), chronic myelogenous leukemia (CML), chronic myelocytic leukemia, chronic eosinophilic leukemia (CEL), myelodysplastic syndrome (MDS), non-Hodgkin's lymphoma (NHL), or multiple myeloma (MM, including refractory and relapsed MM
  • ALL
  • Exemplary solid cancer to be treated may be biliary cancer, bladder cancer, bone and soft tissue carcinoma, brain tumor, breast cancer, breast carcinoma, cervical cancer, colon cancer, colorectal adenocarcinoma, colorectal cancer, desmoid tumor, embryonal cancer, endometrial cancer, esophageal cancer, gastric cancer, gastric adenocarcinoma, glioblastoma multiforme, glioblastoma, melanoma, diffuse peritoneal mesothelioma, malignant pleural mesothelioma, glioma, astrocytoma, gynecological tumor, head and neck squamous cell carcinoma, hepatic cancer, hepatocellular carcinoma, lung cancer, non small-cell lung cancer, malignant melanoma, osteosarcoma, ovarian cancer (e.g., epithelial ovarian cancer, ovarian carcinoma), fallopian tube cancer, endometrial
  • FIG. 1 shows identification of WT-1 -specific T cell lines.
  • WT-1- specific polyclonal T cell lines obtained from 4 healthy donors were cultured with peptide-pulsed autologous dendritic cells, stained with CD8-independent (CD8i) WT-1 peptide/HLA-A tetramer, and sorted for high tetramer staining cells. Twenty- four (24) WT-1 -specific clonotypes were identified. TCR repertoire analysis was performed by sequencing. The fold-enrichment of each clonotype within the sorted versus unsorted populations (y-axis) and the CD3 surface expression (x-axis) of each clonotype are shown.
  • FIGS 2A-2C show that exemplary WT-l-specific binding proteins are expressed in transduced host cells.
  • Ten (10) WT-1 specific TCRs from the 24 clonotypes shown in Figure 1 were used to transduce TCRa/TCRP -deficient J76 Jurkat T cells.
  • WT-1 :HLA-A tetramer binding and CD3 expression of the transduced cells (shown in light grey) was compared to cells transduced with a reference WT-1 -specific TCR (shown in dark grey) having an a chain according to SEQ ID NO.: 82 and a b chain according to SEQ ID NO.: 83 and described by Schmitt etal. ⁇ Nat. Biotechnol. 35:1188, 2017).
  • FIGS 3A and 3B show that binding proteins of the present disclosure are functional in transduced host cells.
  • A Jurkat cells expressing A7// 77-dtTomato reporter (reporting antigen-specific signaling in human T cells; see Ahsouri and Weiss, J Immunol 79S(2):657-668 (2017)) were transduced with WT-l-specific TCR and incubated for 24h with APCs loaded with WT-1 peptide at the indicated concentrations.
  • B Nur77 activation peptide ECso values of the indicated TCRs.
  • Figures 4A-4C show further functional characterization of exemplary binding proteins of the present disclosure.
  • A Peptide/MHC tetramer binding by CD8+ T cells that were transduced to express a WT-1 -specific TCR as indicated.
  • B IFNy production (as determined by flow cytometry) by expanded antigen-specific CD8+ T cells in a 4 hour co-culture with T2 target cells pulsed with titrated concentrations of peptide. Shown is the percentage of IFN-y+ T cells.
  • C IFNy peptide EC so for each TCR was determined by fitting the percentage of IFNy-producing cells to dose-response curves by linear regression.
  • FIGS 5A and 5B show lysis of tumor cells by T cells expressing an exemplary binding protein of the present disclosure (TCR DL6 or DL10), as compared to lysis by T cells expressing a reference TCR (a chain according to SEQ ID NO.: 82; b chain according to SEQ ID NO.:83).
  • TCR DL6 or DL10 an exemplary binding protein of the present disclosure
  • a reference TCR a chain according to SEQ ID NO.: 82; b chain according to SEQ ID NO.:83.
  • A Lysis of HLA-A2 -transduced tumor cell line MDA-MB-468 cells.
  • Both (A) and (B) show results from 4h assays in which target cells were loaded with 51 Cr and TCR-transduced T cell-mediated killing was calculated by measuring Cr-release in response to decreasing doses of effector T cells relative to tumor cell targets (E:T; x- axis).
  • Figure 6 shows IFN-g production by exemplary TCRDL10 of the present disclosure, as compared to the reference TCR (a chain according to SEQ ID NO.:82; b chain according to SEQ ID NO.:83), in the presence of T2 target cells pulsed with peptide.
  • Figure 7 shows reduced growth of Panc-1 tumor cells in the presence of T cells expressing exemplary TCR DL10 of the present disclosure, as compared to tumor cells alone or in the presence of T cells expressing the reference TCR (a chain according to SEQ ID NO.:82; b chain according to SEQ ID NO.:83).
  • Cell proliferation/survival was monitored over 7 days in an IncuCyte assay. Error bars indicate standard error of the mean.
  • binding protein e.g ., TCRs, CARs, scTCRs
  • WT-1 peptide antigen associated with a major histocompatibility complex MHC
  • MHC major histocompatibility complex
  • HLA human leukocyte antigen
  • polynucleotides that encode a binding protein vectors, modified immune cells that encode and/or express the binding proteins, and related compositions.
  • WT-1 specific compositions are useful in, for example, adoptive immunotherapy to treat cancer.
  • most tumor targets for T cell-based immunotherapies are self-antigens since tumors arise from previously normal tissue.
  • TAAs tumor-associated antigens
  • TAAs tumor-associated antigens
  • T cells may be expressed at high levels in a cancer cell, but may not be expressed or may be minimally expressed in other cells.
  • T cell development in the thymus T cells that bind weakly to self-antigens are allowed to survive in the thymus, which can undergo further development to increase specificity against foreign invaders, while T cells that bind strongly to self-antigens are eliminated by the immune system since such cells would mount an undesirable autoimmune response.
  • T cells are sorted by their relative ability to bind to antigens to prepare the immune system to respond against a foreign invader (i.e., recognition of non-self-antigen) while at the same time preventing an autoimmune response (i.e., recognition of self-antigen).
  • This tolerance mechanism limits naturally occurring T cells that can recognize tumor (self) antigens with high affinity and, therefore, eliminates the T cells that would effectively eliminate tumor cells. Consequently, isolating T cells having high affinity TCRs specific for tumor antigens is difficult because such cells are essentially eliminated by the immune system.
  • An advantage of the instant disclosure is to provide a binding protein specific for a WT-1 peptide, wherein the binding protein is capable of binding to a WT-1 (SEQ ID NO.:94):HLA (e.g ., HLA-A*0201) complex.
  • the binding protein is capable of binding to the WT-1 independent or in the absence of CD8, is capable of more efficiently associating with a CD3 protein as compared to an endogenous TCR, is capable of initiating a signal to a host cell expressing the binding protein to produce a cytokine, or any combination thereof.
  • a binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO: 94):HLA complex with an IFNy production pECso of 4.0, 4.5, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, or higher; and/or wherein the binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.: 94):HLA complex with a higher IFNy production pECso as compared to a TCR comprising an a-chain amino acid sequence of SEQ ID NO: 82 and a b-chain amino acid sequence of SEQ ID NO: 83.
  • compositions and methods described herein will in certain embodiments have therapeutic utility for the treatment of diseases and conditions associated with WT-1 expression (e.g., detectable WT-1 expression at a level that is greater in magnitude, in a statistically significant manner, than the level of WT-1 expression that is detectable in a normal or disease-free cell).
  • diseases include various diseases and disorders, such as hematological malignancies and solid cancers.
  • Non-limiting examples of these and related uses are described herein and include in vitro , ex vivo and in vivo stimulation of WT-1 antigen-specific T-cell responses, such as by the use of recombinant immune cells, such as T cells, encoding and/or expressing a heterologous binding protein specific for a WT-1 peptide (e.g ., RMFPNAPYL, SEQ ID NO.: 94).
  • a heterologous binding protein specific for a WT-1 peptide e.g ., RMFPNAPYL, SEQ ID NO.: 94.
  • any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
  • any number range recited herein relating to any physical feature, such as polymer subunits, size or thickness are to be understood to include any integer within the recited range, unless otherwise indicated.
  • the term “about” means ⁇ 20% of the indicated range, value, or structure, unless otherwise indicated. It should be understood that the terms “a” and “an” as used herein refer to “one or more" of the enumerated components.
  • a protein domain, region, or module e.g ., a binding domain, hinge region, linker module
  • a protein which may have one or more domains, regions, or modules
  • a host refers to a cell (e.g., T cell) or microorganism targeted for genetic modification with a heterologous or exogenous nucleic acid molecule to produce a polypeptide of interest (e.g, enhanced affinity anti-WT-1 TCR).
  • a host cell may optionally already possess or be modified to include other genetic modifications that confer desired properties related or unrelated to biosynthesis of the heterologous or exogenous protein (e.g, inclusion of a detectable marker; deleted, altered or truncated endogenous TCR; increased co-stimulatory factor expression).
  • a host cell is a human hematopoietic progenitor cell transduced with heterologous or exogenous nucleic acid molecule encoding a TCRa chain specific for a WT-1 antigen peptide.
  • an "immune system cell” means any cell of the immune system that originate from a hematopoietic stem cell in the bone marrow, which gives rise to two major lineages, a myeloid progenitor cell (which give rise to myeloid cells such as monocytes, macrophages, dendritic cells, meagakaryocytes and granulocytes) and a lymphoid progenitor cell (which give rise to lymphoid cells such as T cells, B cells and natural killer (NK) cells).
  • exemplary immune system cells include a CD4 + T cell, a CD8 + T cell, a CD4 CD8 double negative T cell, a gd T cell, a natural killer cell, and a dendritic cell.
  • Macrophages and dendritic cells may be referred to as "antigen presenting cells” or “APCs,” which are specialized cells that can activate T cells when a major histocompatibility complex (MHC) receptor on the surface of the APC interacts with a TCR on the surface of a T cell.
  • APCs antigen presenting cells
  • MHC major histocompatibility complex
  • an immune system cell is a human immune system cell.
  • hematopoietic progenitor cell is a cell that can be derived from hematopoietic stem cells or fetal tissue and is capable of further differentiation into mature cells types (e.g ., immune system cells).
  • exemplary hematopoietic progenitor cells include those with a CD24 Lo Lin- CD117 + phenotype or those found in the thymus (referred to as progenitor thymocytes).
  • MHC Major histocompatibility complex
  • MHC class I molecules are heterodimers having a membrane spanning a chain (with three a domains) and a non-covalently associated b2 microglobulin.
  • MHC class II molecules are composed of two transmembrane glycoproteins, a and b, both of which span the membrane. Each chain has two domains.
  • MHC class I molecules deliver peptides originating in the cytosol to the cell surface, where a peptide:MHC complex is recognized by CD8 + T cells.
  • MHC class II molecules deliver peptides originating in the vesicular system to the cell surface, where they are recognized by CD4 + T cells.
  • Human MHC are referred to as human leukocyte antigen (HLA).
  • T cell is an immune system cell that matures in the thymus and produces T cell receptors (TCRs).
  • T cells can be naive (not exposed to antigen; increased expression of CD62L, CCR7, CD28, CD3, CD 127, and CD45RA, and decreased expression of CD45RO as compared to TCM), memory T cells (TM) (antigen- experienced and long-lived), and effector cells (antigen-experienced, cytotoxic).
  • TM can be further divided into subsets of central memory T cells (TCM, increased expression of CD62L, CCR7, CD28, CD127, CD45RO, and CD95, and decreased expression of CD54RA as compared to naive T cells), stem cell memory T cells, and effector memory T cells (TEM, decreased expression of CD62L, CCR7, CD28,
  • TCM effector T cells
  • TE refers to a antigen-experienced CD8 + cytotoxic T lymphocytes that has decreased expression of CD62L ,CCR7, CD28, and are positive for granzyme and perforin as compared to TCM.
  • T cell receptor refers to an immunoglobulin superfamily member (having a variable binding domain, a constant domain, a transmembrane region, and a short cytoplasmic tail; see, e.g., Janeway el al., Immunobiology: The Immune System in Health and Disease, 3 rd Ed., Current Biology Publications, p.
  • a TCR can be found on the surface of a cell or in soluble form and generally is comprised of a heterodimer having a and b chains (also known as TCRa and TCR , respectively), or g and d chains (also known as TCRy and TCR6, respectively).
  • TCR chains e.g, a- chain, b-chain
  • a variable domain e.g, a-chain variable domain or V a , b-chain variable domain or Vp; typically amino acids 1 to 116 based on Rabat numbering Rabat etal., "Sequences of Proteins of Immunological Interest, US Dept.
  • variable domains contain complementary determining regions (CDRs) separated by framework regions (FRs) (see, e.g, lores et al., Proc. Nat'l Acad. Sci. U.S.A. 57:9138, 1990; Chothia etal., EMBO J.
  • CDRs complementary determining regions
  • FRs framework regions
  • a TCR is found on the surface of T cells (or T lymphocytes) and associates with the CD3 complex.
  • the source of a TCR as used in the present disclosure may be from various animal species, such as a human, mouse, rat, rabbit or other mammal.
  • variable region refers to the domain of an immunoglobulin superfamily binding protein (e.g., a TCR a-chain or b-chain (or g chain and d chain for gd TCRs)) that is involved in binding of the immunoglobulin superfamily binding protein (e.g., TCR) to antigen.
  • an immunoglobulin superfamily binding protein e.g., a TCR a-chain or b-chain (or g chain and d chain for gd TCRs)
  • TCR immunoglobulin superfamily binding protein
  • the variable domains of the a chain and b chain generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three CDRs.
  • the Va domain is encoded by two separate DNA segments, the variable gene segment and the joining gene segment (V-J); the nb domain is encoded by three separate DNA segments, the variable gene segment, the diversity gene segment, and the joining gene segment (V-D-J).
  • V-J variable gene segment
  • V-D-J joining gene segment
  • a single Va or nb domain, or a functional fragment or portion thereof, may be sufficient to confer antigen-binding specificity.
  • TCRs that bind a particular antigen may be isolated using a Va or nb domain from a TCR that binds the antigen to screen a library of complementary Va or nb domains, respectively.
  • CDR complementarity determining region
  • HVR hypervariable region
  • TCR immunoglobulin
  • CDR3 CDR3 is thought to be the main CDR responsible for recognizing processed antigen.
  • CDR1 and CDR2 mainly interact with the MHC.
  • CDR1 and CDR2 are encoded within the variable gene segment of a TCR variable region-coding sequence
  • CDR3 is encoded by the region spanning the variable and joining segments for Va, or the region spanning variable, diversity, and joining segments for nb.
  • the sequences of their corresponding CDR1 and CDR2 can be deduced.
  • CDR3 is typically significantly more diverse because of the addition and loss of nucleotides during the recombination process.
  • TCR variable domain sequences can be aligned to a numbering scheme (e.g., IMGT, Rabat, Chothia, Enhanced Chothia, Contact, and Aho), allowing equivalent residue positions to be annotated and for different molecules to be compared using, for example, ANARCI software tool (2016, Bioinformatics 15:298-300).
  • a numbering scheme provides a standardized delineation of framework regions and CDRs in the TCR variable domains. Accordingly, it will be understood that a CDR from a TCR Va or nb region or domain may have a particular sequence according to a particular numbering scheme, and may have a slightly shorter, longer, or shifted (e.g., partially overlapping) sequence according to a different numbering scheme.
  • CDRs are determined using the IMGT numbering scheme; for example, using IMGT V-Quest (imgt.org/IMGTindex/V-QUEST.php)
  • CD3 is known in the art as a multi -protein complex of six chains (see, Abbas and Lichtman, 2003; Janeway etal, pl72 and 178, 1999). In mammals, the complex comprises a CD3y chain, a CD35 chain, two CD3e chains, and a homodimer of O ⁇ 3z chains.
  • the CD3y, CD35, and CD3e chains are highly related cell surface proteins of the immunoglobulin superfamily containing a single immunoglobulin domain.
  • the transmembrane regions of the CD3y, CD35, and CD3e chains are negatively charged, which is a characteristic that is thought to allow these chains to associate with positively charged regions of T cell receptor chains.
  • CD3 as used in the present disclosure may be from various animal species, including human, mouse, rat, or other mammals.
  • TCR complex refers to a complex formed by the association of CD3 with TCR.
  • a TCR complex can be composed of a CD3y chain, a CD35 chain, two CD3e chains, a homodimer of CD3z chains, a TCRa chain, and a TCRP chain.
  • a TCR complex can be composed of a CD3y chain, a CD35 chain, two CD3e chains, a homodimer of CD3z chains, a TCRy chain, and a TCR5 chain.
  • a “component of a TCR complex,” as used herein, refers to a TCR chain (i.e., TCRa, TCRp, TCRy or TCR5), a CD3 chain (i.e., CD3y, CD35, CD3e or CD3C), or a complex formed by two or more TCR chains or CD3 chains (e.g., a complex of TCRa and TCRP, a complex of TCRy and TCR5, a complex of CD3e and CD35, a complex of CD3y and CD3e, or a sub-TCR complex of TCRa, TCRP, CD3y, CD35, and two CD3e chains).
  • CD8 co-receptor means the cell surface glycoprotein CD8, which can be expressed by T cells as a homodimer comprising two CD8a chains, or as a heterodimer comprising an a chain and a b chain.
  • the CD8 co- receptor is believed to assist in the function of cytotoxic T cells (CD8 + ) and functions through signaling via its cytoplasmic tyrosine phosphorylation pathway (Gao and Jakobsen, Immunol. Today 27:630-636, 2000; Cole and Gao, Cell. Mol. Immunol. 7:81- 88, 2004).
  • the CD8 co-receptor binds to an MHC-I protein complex expressed on the surface of an antigen-expressing cell, and that this binding in the context of TCR:antigen-MHC binding initiates or assists in a T cell signaling pathway that produces an immune response (e.g ., transcription and expression of cytokines, calcium secretion, cytolytic activity, or the like) against the antigen-expressing cell.
  • an immune response e.g ., transcription and expression of cytokines, calcium secretion, cytolytic activity, or the like
  • CD8 beta chain isoforms In humans, eight (8) different CD8 beta chain isoforms are known ("M1"-"M8"; see UniProtKB identifiers P10966-1, 2, 3, 4, 6, 7, 8, and 9); of these, isoforms 1, 2, 4, and 5 are thought to associate with the cell membrane in nature, while isoforms 3, 6, 7, and 8 are believed to associate with extracellular regions or be secreted. Also in humans, three CD8 alpha chain isoforms are known (see UniProtKB identifiers P01732-1, 2, and 3).
  • CD4 refers to an immunoglobulin co-receptor glycoprotein that assists the TCR in communicating with antigen-presenting cells (see, Campbell & Reece, Biology 909 (Benjamin Cummings, Sixth Ed., 2002); UniProtKB P01730).
  • CD4 is found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells, and typically includes four immunoglobulin domains (D1 (comprising an Ig-like V-type domain), D2, D3, and D4 (respectively comprising Ig-like C2-type domains 1,
  • CD4 binds MHCII b2
  • TCR complex binds MHCII a ⁇ /b ⁇
  • TAMs immunoreceptor tyrosine activation motifs
  • binding domain refers to a peptide, oligopeptide, polypeptide, or protein that possesses the ability to specifically and non-covalently associate, unite, or combine with a target (e.g., WT-1 or WT-1 peptide:MHC complex).
  • a binding domain includes any naturally occurring, synthetic, semi-synthetic, or recombinantly produced binding partner for a biological molecule, a molecular complex (i.e., complex comprising two or more biological molecules), or other target of interest.
  • binding domains include single chain immunoglobulin variable regions (e.g, scTCR, scFv), receptor ectodomains, ligands (e.g, cytokines, chemokines), or synthetic polypeptides selected for the specific ability to bind to a biological molecule, a molecular complex or other target of interest.
  • scTCR single chain immunoglobulin variable regions
  • scFv single chain immunoglobulin variable regions
  • receptor ectodomains e.g, cytokines, chemokines
  • synthetic polypeptides selected for the specific ability to bind to a biological molecule, a molecular complex or other target of interest.
  • binding protein e.g, TCR receptor
  • binding domain or fusion protein thereof
  • K a an affinity or K a (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10 5 M 1 (which equals the ratio of the on-rate [k 0n ] to the off-rate [k 0ff ] for this association reaction), while not significantly associating or uniting with any other molecules or components in a sample.
  • Binding proteins or binding domains may be classified as “high affinity” binding proteins or binding domains (or fusion proteins thereof) or as “low affinity” binding proteins or binding domains (or fusion proteins thereof).
  • “High affinity” binding proteins or binding domains refer to those binding proteins or binding domains having a K a of at least 10 7 M 1 , at least 10 8 M 1 , at least 10 9 M 1 , at least 10 10 M 1 , at least 10 11 M 1 , at least 10 12 M l , or at least 10 13 M 1 .
  • “Low affinity” binding proteins or binding domains refer to those binding proteins or binding domains having a K a of up to 10 7 M 1 , up to 10 6 M 1 , up to 10 5 M 1 .
  • affinity may be defined as an equilibrium dissociation constant (K d ) of a particular binding interaction with units of M (e.g, 10 5 M to 10 13 M).
  • a receptor or binding domain may have "enhanced affinity," which refers to a selected or engineered receptors or binding domain with stronger binding to a target antigen than a wild type (or parent) binding domain.
  • enhanced affinity may be due to a K a (equilibrium association constant) for the target antigen that is higher than the wild type binding domain, due to a Kd (dissociation constant) for the target antigen that is less than that of the wild type binding domain, due to an off-rate (k 0ff ) for the target antigen that is less than that of the wild type binding domain, or a combination thereof.
  • enhanced affinity TCRs may be codon optimized to enhance expression in a particular host cell, such as T cells (Scholten etal ., Clin. Immunol. 119: 135, 2006).
  • the term "functional avidity” refers to a biological measure or activation threshold of an in vitro immune cell (e.g., T cell, NK cell, NK-T cell) response to a given concentration of a ligand, wherein the biological measures can include cytokine production (e.g, IFNy production, IL-2 production, etc.), cytotoxic activity, activation, and proliferation.
  • cytokine production e.g, IFNy production, IL-2 production, etc.
  • T cells that biologically (immunologically) respond in vitro to a low antigen dose by producing cytokines, being cytotoxic, expressing an activation marker, or proliferating are considered to have high functional avidity, while T cells having lower functional avidity require higher amounts of antigen before an immune response, similar to the high-avidity T cells, is elicited.
  • functional avidity is different from affinity and avidity. Affinity refers to the strength of any given bond between a binding protein and its antigen/ligand. Some binding proteins are multivalent and bind to multiple antigens - in this case, the strength of the overall connection is the avidity.
  • T cell functions e.g., proliferation, cytokines production, etc.
  • thresholds see, e.g., Betts et al., J. Immunol. 772:6407, 2004; Langenkamp etal., Eur. J.
  • Factors that can affect functional avidity include (a) the affinity of a TCR for the pMHC-complex, that is, the strength of the interaction between the TCR and pMHC (Cawthon etal., J. Immunol. 167:2511 , 2001), (b) expression levels of the TCR and the CD4 or CD8 co-receptors, and (c) the distribution and composition of signaling molecules (Viola and Lanzavecchia, Science 273:104, 1996), as well as expression levels of molecules that attenuate T cell function and TCR signaling.
  • the concentration of antigen needed to induce a half-maximum response between the baseline and maximum response after a specified exposure time is referred to as the "half maximal effective concentration" or "ECso".
  • the ECso value is generally presented as a molar (moles/liter) amount, but it is often converted into a logarithmic value as follows - logio(EC5o) (see, e.g., Figure 4(C)). For example, if the ECso equals 1 mM (10 6 M), the logio(EC5o) value is -6. Another value used is pECso, which is defined as the negative logarithm of the EC so (-logio(EC5o)).
  • the EC50 equaling 1 mM has a pEC50 value of 6.
  • the functional avidity of a binding protein of this disclosure will be a measure of its ability to promote IFNy production by immune cells (e.g, T cells, NK-T cells, NK cells), which can be measured using assays known in the art and/or described herein.
  • "High functional avidity" TCRs or binding domains thereof refer to those TCRs or binding domains thereof having a EC50 of at least 10 4 M, at least about 10 5 M, or at least about 10 6 M.
  • a pECso is used to describe the amount of peptide antigen required for 50% of immune cells to express the activation marker Nur77.
  • binding domains of the present disclosure that specifically bind a particular target, as well as determining binding domain or fusion protein affinities, such as Western blot, ELISA, analytical ultracentrifugation, spectroscopy and surface plasmon resonance (Biacore®) analysis (see, e.g., Scatchard etal., Ann. N.Y. Acad. Sci. 57:660, 1949; Wilson, Science 295: 2103, 2002; Wolff et al, Cancer Res. 53: 2560, 1993; and U.S. Patent Nos. 5,283,173, 5,468,614, or the equivalent), and peptide:MHC tetramer staining.
  • Biacore® surface plasmon resonance
  • WT-1 -specific immunoglobulin superfamily binding protein or "WT-1 -specific binding protein” refers in certain embodiments to a protein or polypeptide of the present disclosure that specifically binds to WT-1 or a peptide thereof, optionally in complex with a HLA molecule.
  • WT-1 binding domain or “WT-1 binding fragment” refer to a domain or portion of a WT-l-specific binding protein responsible for the specific WT-1 binding.
  • a WT-1 -specific binding domain alone i.e., without any other portion of a WT-1 -specific binding protein) can be soluble.
  • Exemplary WT-1 -specific binding domains include those from a WT-1- specific TCR, such as can be found in a TCR or a scTCR (e.g, single chain o ⁇ TCR proteins such as Va-L-nb, nb-L-Va, Va-Ca-L-Va, or na-E-nb-Eb, wherein Va and nb are TCRa and b variable domains respectively, Ca and Eb are TCRa and b constant domains, respectively, and L is a linker) and scFv fragments as described herein, which can be derived from an anti -WT-1 TCR or antibody.
  • a WT-1-specific TCR such as can be found in a TCR or a scTCR (e.g, single chain o ⁇ TCR proteins such as Va-L-nb, nb-L-Va, Va-Ca-L-Va, or na-E-nb-Eb,
  • WT-1 antigen or “WT-1 peptide antigen” refer to a naturally or synthetically produced portion of a WT-1 protein ranging in length from about 7 amino acids to about 15 amino acids, which can form a complex with a MHC (e.g, HLA) molecule and such a complex can bind with a TCR specific for a WT-1 peptide:MHC (e.g, HLA) complex.
  • MHC e.g, HLA
  • APC antigen presenting cells
  • MHC major histocompatibility complex
  • processed antigen peptides originating in the cytosol are generally from about 7 amino acids to about 11 amino acids in length and will associate with class I MHC molecules
  • peptides processed in the vesicular system e.g, bacterial, viral
  • WT-1 antigen peptides will be presented in the context of class I MHC.
  • a WT-1 peptide is RMFPNAPYL (SEQ ID NO.:94), which is known to associate with human class I HLA (and, more specifically, associates with allele HLA- A*201).
  • a “linker” refers to an amino acid sequence that connects two proteins, polypeptides, peptides, domains, regions, or motifs and may provide a spacer function compatible with interaction of the two sub-binding domains so that the resulting polypeptide retains a specific binding affinity (e.g., scTCR) to a target molecule or retains signaling activity (e.g., TCR complex).
  • a linker is comprised of about two to about 35 amino acids, for instance, or about four to about 20 amino acids or about eight to about 15 amino acids or about 15 to about 25 amino acids.
  • fusion protein refers to a protein that, in a single chain, has at least two distinct domains or motifs, wherein the domains or motifs are not naturally found together in a protein.
  • a polynucleotide encoding a fusion protein may be constructed using PCR, recombinantly engineered, or the like, or such fusion proteins can be synthesized.
  • a fusion protein may further contain other components, such as a tag, a linker, or a transduction marker.
  • a fusion protein expressed or produced by a host cell locates to the cell surface, where the fusion protein is anchored to the cell membrane (e.g., via a transmembrane component or domain) and comprises an extracellular component (e.g, capable of associating with a MHC molecule) and an intracellular component (e.g, containing a signaling domain, effector domain, co stimulatory domain or portions or combinations thereof).
  • a host cell e.g ., an immune cell, such as, for example, a T cell
  • “Junction amino acids” or “junction amino acid residues” refer to one or more (e.g., about 2-10) amino acid residues between two adjacent motifs, regions or domains of a polypeptide, such as, for example, between a binding domain and an adjacent constant domain or between a TCR chain and an adjacent self-cleaving peptide. Junction amino acids may result from the construct design of a fusion protein (e.g., amino acid residues resulting from the use of a restriction enzyme site during the construction of a nucleic acid molecule encoding a fusion protein).
  • altered domain refers to a motif, region, domain, peptide, polypeptide, or protein with a sequence identity to a wild type motif, region, domain, peptide, polypeptide, or protein (e.g, a wild type TCRa chain, TCR chain, TCRa constant domain, TCR constant domain) of at least 85% (e.g, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5%).
  • nucleic acid or “nucleic acid molecule” or “polynucleotide” refers to any of deoxyribonucleic acid (DNA), ribonucleic acid (RNA), oligonucleotides, fragments generated, for example, by the polymerase chain reaction (PCR) or by in vitro translation, and fragments generated by any of ligation, scission, endonuclease action, or exonuclease action.
  • the polynucleotides of the present disclosure are produced by PCR.
  • Polynucleotides may be composed of monomers that are naturally occurring nucleotides (such as deoxyribonucleotides and ribonucleotides), analogs of naturally occurring nucleotides (e.g, a-enantiomeric forms of naturally-occurring nucleotides), or a combination of both.
  • Modified nucleotides can have modifications in or replacement of sugar moieties, or pyrimidine or purine base moieties.
  • Nucleic acid monomers can be linked by phosphodiester bonds or analogs of such linkages.
  • Analogs of phosphodiester linkages include phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phosphoranilidate, phosphoramidate, and the like.
  • Polynucleotides can be either single stranded or double stranded.
  • isolated means that the material is removed from its original environment (e.g ., the natural environment if it is naturally occurring).
  • a naturally occurring nucleic acid or polypeptide present in a living animal is not isolated, but the same nucleic acid or polypeptide, separated from some or all of the co-existing materials in the natural system, is isolated.
  • Such nucleic acid could be part of a vector and/or such nucleic acid or polypeptide could be part of a composition (e.g., a cell lysate), and still be isolated in that such vector or composition is not part of the natural environment for the nucleic acid or polypeptide.
  • gene means the segment of DNA involved in producing a polypeptide chain; it includes regions preceding and following the coding region "leader and trailer” as well as intervening sequences (introns) between individual coding segments (exons).
  • Any host cell, binding protein, polynucleotide, or vector of the present disclosure can be “isolated”.
  • the terms "recombinant”, “engineered”, and “modified” refer to a cell, microorganism, nucleic acid molecule, or vector that has been modified by introduction of an exogenous nucleic acid molecule, or refers to a cell or microorganism that has been altered such that expression of an endogenous nucleic acid molecule or gene is controlled, deregulated or constitutive, where such alterations or modifications may be introduced by genetic engineering.
  • Genetic alterations may include, for example, modifications introducing nucleic acid molecules (which may include an expression control element, such as a promoter) encoding one or more proteins or enzymes, or other nucleic acid molecule additions, deletions, substitutions, or other functional disruption of or addition to a cell’s genetic material.
  • Exemplary modifications include those in coding regions or functional fragments thereof of heterologous or homologous polypeptides from a reference or parent molecule.
  • mutation refers to a change in the sequence of a nucleic acid molecule or polypeptide molecule as compared to a reference or wild-type nucleic acid molecule or polypeptide molecule, respectively.
  • a mutation can result in several different types of change in sequence, including substitution, insertion or deletion of nucleotide(s) or amino acid(s).
  • a mutation is a substitution of one or three codons or amino acids, a deletion of one to about 5 codons or amino acids, or a combination thereof.
  • a "conservative substitution” is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
  • Exemplary conservative substitutions are well known in the art (see, e.g. , WO 97/09433 at page 10; Lehninger, Biochemistry, 2 nd Edition; Worth Publishers, Inc. NY, NY, pp.71-77, 1975; Lewin, Genes IV, Oxford University Press, NY and Cell Press, Cambridge, MA, p. 8, 1990).
  • a variety of criteria known to persons skilled in the art indicate whether an amino acid that is substituted at a particular position in a peptide or polypeptide is conservative (or similar).
  • a similar amino acid or a conservative amino acid substitution is one in which an amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Similar amino acids may be included in the following categories: amino acids with basic side chains (e.g., lysine, arginine, histidine); amino acids with acidic side chains (e.g, aspartic acid, glutamic acid); amino acids with uncharged polar side chains (e.g, glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, histidine); amino acids with nonpolar side chains (e.g, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan); amino acids with beta- branched side chains (e.g, threonine, valine, isoleucine), and amino acids with aromatic side chains (e.g, tyrosine, phenylalanine, trypto
  • Proline which is considered more difficult to classify, shares properties with amino acids that have aliphatic side chains (e.g, leucine, valine, isoleucine, and alanine).
  • substitution of glutamine for glutamic acid or asparagine for aspartic acid may be considered a similar substitution in that glutamine and asparagine are amide derivatives of glutamic acid and aspartic acid, respectively.
  • similarity between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide (e.g, using GENEWORKS, Align, the BLAST algorithm, or other algorithms described herein and practiced in the art).
  • proteins e.g ., binding proteins
  • proteins comprise a variant sequence as compared to a reference sequence (e.g., a variant TCR CDR as compared to a reference TCR CDR disclosed herein).
  • variant proteins, peptides, polypeptides, and amino acid sequences of the present disclosure can, in certain embodiments, comprise one or more conservative substitutions relative to a reference amino acid sequence.
  • variants of polynucleotides and polypeptides of this disclosure are also contemplated.
  • Variant nucleic acid molecules or polypeptides are at least 70%, 75%, 80%, 85%, 90%, and are preferably at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical to a defined or reference polynucleotide or polypeptide (respectively) as described herein, or that, for a polynucleotide, hybridize to a reference polynucleotide under stringent hybridization conditions of 0.015M sodium chloride, 0.0015M sodium citrate at about 65-68°C or 0.015M sodium chloride, 0.0015M sodium citrate, and 50% formamide at about 42°C.
  • Nucleic acid molecule variants retain the capacity to encode a binding protein or a binding domain thereof having a functionality described herein, such as specifically binding a target molecule.
  • stringency of hybridization reactions see Ausubel, F. M. (1995), Current Protocols in Molecular Biology. John Wiley & Sons, Inc.
  • the person skilled in the art may follow the instructions given in the manual Boehringer Mannheim GmbH (1993) The DIG System Users Guide for Filter Hybridization, Boehringer Mannheim GmbH, Mannheim, Germany and in Liebl, W., Ehrmann, M., Ludwig, W., and Schleifer, K. H. (1991) International Journal of Systematic Bacteriology 41: 255-260 on how to identify DNA sequences by means of hybridization.
  • Variants can also refer to fragments (e.g., a portion resulting from truncation, cleavage, or the like) of a defined or reference sequence, and fragments can be of any length shorter than the length of the defined or reference sequence.
  • a "functional portion” or “functional fragment” refers to a polypeptide or polynucleotide that comprises only a domain, portion or fragment of a parent or reference compound, and the polypeptide or encoded polypeptide retains at least 50% activity associated with the domain, portion or fragment of the parent or reference compound, preferably at least 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.9%, or 100% level of activity of the parent polypeptide, or provides a biological benefit (e.g., effector function).
  • a biological benefit e.g., effector function
  • a “functional portion” or “functional fragment” of a polypeptide or encoded polypeptide of this disclosure has “similar binding” or “similar activity” when the functional portion or fragment displays no more than a 50% reduction in performance in a selected assay as compared to the parent or reference polypeptide (preferably no more than 20% or 10%, or no more than a log difference as compared to the parent or reference with regard to affinity), such as an assay for measuring binding affinity or measuring effector function (e.g., cytokine release).
  • a functional portion refers to a "signaling portion" of an effector molecule, effector domain, costimulatory molecule, or costimulatory domain.
  • a variant binding protein or a portion (e.g., binding domain) or fragment thereof can comprise one or more amino acid substitutions relative to a parent or reference binding protein or domain, wherein the one or more amino acid substitutions remove, change, or attenuate, a potential undesired feature or characteristic, if present in the parent or reference binding domain or protein; e.g, an amino acid sequence that is potentially immunogenic, or an amino acid sequence that may provide an undesired glycosylation site, an undesired deamidation site, an undesired oxidation site, an undesired isomerization site, or a reduction in thermodynamic stability, or that may result in mis-pairing or mis-folding in a binding protein (e.g, unpaired cysteine residues in close proximity).
  • Amino acid sequences, patterns, and motifs that may provide for an undesired feature or characteristic are known (see, e.g., Seeliger etal., mAbs 7(3): 505-515
  • an amino acid substitution comprises a substitution to remove a somatic mutation, such as, for example, a reversion to a germline-encoded amino acid.
  • a variant of a reference CDR amino acid sequence, or of a TCR variable domain sequence or TCR constant region sequence comprises a substitution to remove or attenuate a potential undesired feature or characteristic. It will be understood that such variants are selected so as not to compromise, or substantially compromise, a desired function (e.g, binding specificity and/or affinity for a WT-1 antigemHLA complex).
  • the term "construct" refers to any polynucleotide that contains a recombinant nucleic acid.
  • a construct may be present in a vector (e.g ., a bacterial vector, a viral vector) or may be integrated into a genome.
  • a "vector” is a nucleic acid molecule that is capable of transporting another nucleic acid.
  • Vectors may be, for example, plasmids, cosmids, viruses, a RNA vector or a linear or circular DNA or RNA molecule that may include chromosomal, non-chromosomal, semi-synthetic or synthetic nucleic acids.
  • Exemplary vectors are those capable of autonomous replication (episomal vector) or expression of nucleic acids to which they are linked (expression vectors).
  • Viral vectors include retrovirus, adenovirus, parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as ortho-myxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g., measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g., vaccinia, fowlpox and canarypox).
  • ortho-myxovirus e.g., influenza virus
  • rhabdovirus e.g., rabies and vesicular stomatitis virus
  • viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example.
  • retroviruses include avian leukosis-sarcoma, mammalian C- type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields etal., Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • Lentiviral vector means HIV-based lentiviral vectors for gene delivery, which can be integrative or non-integrative, have relatively large packaging capacity, and can transduce a range of different cell types. Lentiviral vectors are usually generated following transient transfection of three (packaging, envelope and transfer) or more plasmids into producer cells. Like HIV, lentiviral vectors enter the target cell through the interaction of viral surface glycoproteins with receptors on the cell surface. On entry, the viral RNA undergoes reverse transcription, which is mediated by the viral reverse transcriptase complex. The product of reverse transcription is a double-stranded linear viral DNA, which is the substrate for viral integration into the DNA of infected cells.
  • operably-linked refers to the association of two or more nucleic acid molecules on a single nucleic acid fragment so that the function of one is affected by the other.
  • a promoter is operably-linked with a coding sequence when it is capable of affecting the expression of that coding sequence (i.e., the coding sequence is under the transcriptional control of the promoter).
  • Unlinked means that the associated genetic elements are not closely associated with one another and the function of one does not affect the other.
  • expression vector refers to a DNA construct containing a nucleic acid molecule that is operably-linked to a suitable control sequence capable of effecting the expression of the nucleic acid molecule in a suitable host.
  • control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation.
  • the vector may be a plasmid, a phage particle, a virus, or simply a potential genomic insert. Once transformed into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself.
  • "plasmid,” “expression plasmid,” “virus” and “vector” are often used interchangeably.
  • expression refers to the process by which a polypeptide is produced based on the nucleic acid sequence of a gene.
  • the process includes both transcription and translation.
  • the term "introduced” in the context of inserting a nucleic acid sequence into a cell means “transfection", or ‘transformation” or “transduction” and includes reference to the incorporation of a nucleic acid sequence into a eukaryotic or prokaryotic cell wherein the nucleic acid molecule may be incorporated into the genome of a cell (e.g ., chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
  • a cell e.g ., chromosome, plasmid, plastid, or mitochondrial DNA
  • transiently expressed e.g., transfected mRNA
  • heterologous or exogenous nucleic acid molecule, construct or sequence refers to a nucleic acid molecule or portion of a nucleic acid molecule that is not native to a host cell, but may be homologous to a nucleic acid molecule or portion of a nucleic acid molecule from the host cell.
  • the source of the heterologous or exogenous nucleic acid molecule, construct or sequence may be from a different genus or species.
  • a heterologous or exogenous nucleic acid molecule is added (i.e., not endogenous or native) to a host cell or host genome by, for example, conjugation, transformation, transfection, electroporation, or the like, wherein the added molecule may integrate into the host genome or exist as extra-chromosomal genetic material (e.g ., as a plasmid or other form of self-replicating vector), and may be present in multiple copies.
  • heterologous refers to a non-native enzyme, protein or other activity encoded by an exogenous nucleic acid molecule introduced into the host cell, even if the host cell encodes a homologous protein or activity.
  • a cell comprising a "modification” or a “heterologous" polynucleotide or binding protein includes progeny of that cell, regardless of whether the progeny were themselves transduced, transfected, or otherwise manipulated or changed.
  • heterologous or exogenous nucleic acid molecule can be introduced into a host cell as separate nucleic acid molecules, as a plurality of individually controlled genes, as a polycistronic nucleic acid molecule, as a single nucleic acid molecule encoding a fusion protein, or any combination thereof.
  • a host cell can be modified to express two or more heterologous or exogenous nucleic acid molecules encoding desired TCR specific for a WT-1 antigen peptide (e.g., TCRa and TCR ).
  • the two more exogenous nucleic acid molecules can be introduced as a single nucleic acid molecule (e.g., on a single vector), on separate vectors, integrated into the host chromosome at a single site or multiple sites.
  • the number of referenced heterologous nucleic acid molecules or protein activities refers to the number of encoding nucleic acid molecules or the number of protein activities, not the number of separate nucleic acid molecules introduced into a host cell.
  • Exogenous nucleic acid molecules e.g, encoding a binding protein or a CD8 co-receptor of the present disclosure
  • Exogenous nucleic acid molecules can also be introduced into the genome of a host cell by gene-editing techniques, e.g, using a CRISPR-Cas system, a meganuclease, or the like.
  • endogenous refers to a gene, protein, or activity that is normally present in a host cell. Moreover, a gene, protein or activity that is mutated, overexpressed, shuffled, duplicated or otherwise altered as compared to a parent gene, protein or activity is still considered to be endogenous or native to that particular host cell.
  • an endogenous control sequence from a first gene e.g ., promoter, translational attenuation sequences
  • a second native gene or nucleic acid molecule may be used to alter or regulate expression of a second native gene or nucleic acid molecule, wherein the expression or regulation of the second native gene or nucleic acid molecule differs from normal expression or regulation in a parent cell.
  • homologous refers to a molecule or activity found in or derived from a host cell, species or strain.
  • a heterologous or exogenous nucleic acid molecule may be homologous to a native host cell gene, and may optionally have an altered expression level, a different sequence, an altered activity, or any combination thereof.
  • Sequence identity refers to the percentage of amino acid residues in one sequence that are identical with the amino acid residues in another reference polypeptide sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
  • the percentage sequence identity values can be generated using the NCBI BLAST2.0 software as defined by Altschul et al. (1997) "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402, with the parameters set to default values.
  • similarity between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide (e.g., using GENEWORKSTM, Align, ClustalTM, the BLAST algorithm, or the like).
  • hyperproliferative disorder refers to excessive growth or proliferation as compared to a normal or undiseased cell.
  • exemplary hyperproliferative disorders include tumors, cancers, neoplastic tissue, carcinoma, pre-malignant cells, as well as non-neoplastic or non-malignant hyperproliferative disorders (e.g., adenoma, fibroma, lipoma, leiomyoma, hemangioma, restenosis, as well as autoimmune diseases such as rheumatoid arthritis, osteoarthritis, psoriasis, inflammatory bowel disease, or the like).
  • proliferative diseases include certain tumors, cancers, neoplastic tissue, carcinoma, sarcoma, malignant cells, pre malignant cells, as well as non-neoplastic or non-malignant disorders.
  • the instant disclosure provides a binding protein, comprising (a) a T cell receptor (TCR) a chain variable (Va) domain comprising a CDR3 amino acid sequence (CDR3a) according to any one of SEQ ID NOs: 19, 22, 25, or 28, or a variant thereof, and a TCR nb domain; (b) a TCR nb domain comprising a CDR3 amino acid sequence (CDR3b) according to any one of SEQ ID NOs: 31, 34, 37, or 40, or a variant thereof, and a TCR Va domain; or (c) a TCR Va domain of (a), and a TCR nb domain of (b), wherein the binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.: 94):human leukocyte antigen (HLA) complex wherein, optionally, the HLA comprises HLA-A*0201.
  • RMFPNAPYL SEQ ID NO.: 94
  • HLA human leukocyte antigen
  • the binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.: 94):HLA complex with an IFNy production pECso of 4.0, 4.5, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, or higher.
  • the nb domain of (a), (b), or (c) comprises or consists of an amino acid sequence having at least 90% (e.g ., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identity to the amino acid sequence set forth in any one of SEQ ID NOs: 5-8 or 13-16, and/or the Va domain of (a), (b), or (c) comprises or consists of any amino acid sequence having at least 90% identity to the amino acid sequence set forth in any one of SEQ ID NOs: 1-4 or 9-12.
  • the O ⁇ E3b comprises or consists of the amino acid sequence set forth in SEQ ID NO: 31 and the CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 19.
  • the O ⁇ E3b comprises or consists of the amino acid sequence set forth in SEQ ID NO: 34
  • the CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 22.
  • the O ⁇ E3b comprises or consists of the amino acid sequence set forth in SEQ ID NO: 37
  • the CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 25.
  • the CDR3P comprises or consists of the amino acid sequence set forth in SEQ ID NO: 40
  • the CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 28.
  • the binding protein comprises a Va domain comprising a CDRla, a CDR2a, and a CDR3a, and a nb domain comprising a CDR1 b, a OO ⁇ 12b, and a O ⁇ E3b.
  • the nb domain comprises the CDR1 b amino acid sequence of any one of SEQ ID NOs: 29, 32, 35, or 38, or a variant thereof, and/or the O ⁇ E2b amino acid sequence of any one of SEQ ID NOs: 30, 33, 36, or 39, or a variant thereof.
  • the Va domain comprises the CDRla amino acid sequence of any one of SEQ ID NOs: 17, 20, 23, or 26, or a variant thereof, and/or the CDR2a amino acid sequence of any one of SEQ ID NOs: 18, 21, 24, or 27, or a variant thereof.
  • the TCR Va and nb domains comprise, respectively, CDRla, CDR2a, CDR3a, and CDR1 b, CDR2b, CDR3b and amino acid sequences of: (i) SEQ ID NOs.:26-28 and 38-40, respectively; (ii) SEQ ID NOs.:23, 27, 28, and 38- 40, respectively; (iii) SEQ ID NOs.: 17-19 and 29-31, respectively; (iv) SEQ ID NOs.: 20-22 and 32-34, respectively; or (v) SEQ ID NOs.: 23-25 and 35-37, respectively.
  • the binding protein binds to a WT-1 peptide:HLA-A*201 complex. In any of the presently disclosed embodiments, the binding protein is capable of binding to a WT-1 peptide:HLA complex on a cell surface independent of CD8 or in the absence of CD8.
  • a binding protein as described herein includes variant polypeptide species that have one or more amino acid substitutions, insertions, or deletions in the amino acid sequence relative to the sequences of SEQ ID NOS: 1-61 as presented herein.
  • a substitution is or comprises a conservative substitution.
  • Conservative substitutions of amino acids are well known and may occur naturally or may be introduced when the binding protein is recombinantly produced.
  • Amino acid substitutions, deletions, and additions may be introduced into a protein using mutagenesis methods known in the art (see, e.g., Sambrook el a/., Molecular Cloning: A Laboratory Manual, 3d ed., Cold Spring Harbor Laboratory Press, NY, 2001). Oligonucleotide-directed site-specific (or segment specific) mutagenesis procedures may be employed to provide an altered polynucleotide that has particular codons altered according to the substitution, deletion, or insertion desired.
  • random or saturation mutagenesis techniques such as alanine scanning mutagenesis, error prone polymerase chain reaction mutagenesis, and oligonucleotide- directed mutagenesis may be used to prepare immunogen polypeptide variants (see, e.g., Sambrook el al ., supra).
  • species (or variants) of a particular binding protein specific for WT-1 may include a protein that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity to any of the exemplary amino acid sequences disclosed herein (e.g., SEQ ID NOs.:l-61).
  • a binding protein comprises a nb domain having at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to an amino acid sequence as set forth in any one of SEQ ID NOs.: 1-4 or 9-12, and/or a Va domain having at least 90% sequence identity to an amino acid sequence as set forth in any one of SEQ ID NOs.: 5-8 or 13-16, wherein the binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO:94):HLA complex.
  • any one or more of the b or a CDR amino acid sequences as provided herein can be present in the nb domain and/or the Va domain, respectively.
  • the binding protein comprises a nb domain comprising or consisting of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs.: 5-8 or 13-16, and/or a Va domain comprising or consisting of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs.: 1-4 or 9-12, provided that(a) at least three or four of the CDRs have no mutations, (b) the CDRs that do have mutations have only up to two amino acid substitutions, up to a contiguous five amino acid deletion, or a combination thereof, and (c) the binding protein retains its ability to bind to a RMFPNAPYL (SEQ ID NO:94):HLA complex, optoinally with an IFNy production pECso of 4.0, 4.5, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, or higher.
  • a binding protein comprises a TCR variable domain comprising an amino acid sequence encoded by a human TCR V, D, and/or J allele.
  • V-J variable and joining gene segments
  • V-D-J nb exons are assembled from different variable, diversity, and joining gene segments
  • the TCRa chromosomal locus has 70-80 variable gene segments and 61 joining gene segments.
  • the TCRP chromosomal locus has 52 variable gene segments, and two separate clusters of each containing a single diversity gene segment, together with six or seven joining gene segments.
  • Functional Va and nb gene exons are generated by the recombination of a variable gene segment with a joining gene segment for Va, and a variable gene segment with a diversity gene segment and a joining gene segment for nb.
  • Nucleotide and amino acid sequences according to TCR gene segments of various alleles are known in the art and are can be found on the ImMunoGeneTics website; for example, at imgt.org/IMGTrepertoire/LocusGenes/listIG_TR/TR/human/Hu_TRgroup.html.
  • polynucleotide encoding a binding protein can comprise a same nucleotide sequence according to a TCR gene segment as disclosed herein, any nucleotide sequence that encodes the amino acid sequence of the gene segment may be used within the context of the present disclosure.
  • the binding protein comprises a nb domain comprising (i) an amino acid sequence according to a TRBJ02-03 gene segment; and/or (ii) an amino acid sequence according to a TRBV06-05 gene segment, an amino acid sequence according to a TRBV07-09 gene segment, or an amino acid sequence according to a TRBV20-01 gene segment.
  • the binding protein comprises a Va domain comprising (i) an amino acid sequence according to a TRAJ43 gene segment; and/or (ii) an amino acid sequence according to a TRAV20-02 gene segment; an amino acid sequence encoded by a TRAV38DV08 gene segment; or an amino acid sequence according to a TRAV38-01 gene segment.
  • the nb domain comprises an amino acid sequence according to a TRBJ02-03 gene segment and the Va domain comprises an amino acid sequence according to a TRAJ43 gene segment; the nb domain comprises an amino acid sequence according to TRBV06-05 gene segment and the Va domain comprises an amino acid sequence according to a TRAV20-02 gene segment; the nb domain comprises an amino acid sequence according to TRBV07-09 gene segment and the Va domain comprises an amino acid sequence according to a TRAV38DV08 gene segment; or the nb domain comprises an amino acid sequence according to a TRBV20-01 gene segment and the Va domain comprises an amino acid sequence according to a TRAV38-01 gene segment.
  • the amino acid sequence according to a TRA or TRB gene segment is 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 amino acids in length, and including any length of amino acids between these exemplary lengths ( e.g ., 11, 12, 13, 14 amino acids, or the like).
  • a binding protein is provided that is capable of binding to a RMFPNAPYL (SEQ ID NO.:94):HLA complex, wherein the binding protein comprises a TCR Va domain and a TCR nb domain.
  • the Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 1 or 9 and the nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 5 or 13.
  • the Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 2 or 10 and the nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 6 or 14.
  • the Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 3 or 11 and the nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 7 or 15. In certain embodiments, the Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 4 or 12 and the nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 8 or 16.
  • a binding protein can comprise an a-chain constant domain (Ca) or a fragment thereof and/or a b-chain constant domain (Ob) or a fragment or portion thereof.
  • the Ca comprises or consists of an amino acid sequence having at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) sequence identity to any one of SEQ ID NOs.:41-44.
  • the Eb comprises or consists of an amino acid sequence having at least 90% sequence identity to SEQ ID NO:45.
  • a TCR Ob comprises a cysteine amino acid in place of a native serine at amino acid position 57 (e.g., GV(S- C)TD) and a TCR Ca comprises a cysteine amino acid in place of a native threonine at amino acid position 48 (e.g., DK(T- C)VL; see, e.g., Cohen etal, Cancer Res. 67 ( 8):3898-3903 (2007)).
  • the binding protein is a T cell receptor (TCR), a chimeric antigen receptor or an antigen-binding fragment of a TCR, any of which can be chimeric, humanized or human.
  • TCR T cell receptor
  • an antigen-binding fragment of the TCR comprises a single chain TCR (scTCR) or a chimeric antigen receptor (CAR).
  • CAR Chimeric antigen receptor
  • CARs can include an extracellular portion comprising an antigen-binding domain (e.g, obtained or derived from an immunoglobulin or immunoglobulin-like molecule, such as a TCR binding domain derived or obtained from a TCR specific for a cancer antigen, a scFv derived or obtained from an antibody, or an antigen-binding domain derived or obtained from a killer immunoreceptor from an NK cell) linked to a transmembrane domain and one or more intracellular signaling domains (optionally containing co- stimulatory domain(s)) (see, e.g, Sadelain etal., Cancer Discov., 3(4):388 (2013); see also Harris and Kranz, Trends Pharmacol.
  • an antigen-binding domain e.g, obtained or derived from an immunoglobulin or immunoglobulin-like molecule, such as a TCR binding domain derived or obtained from a TCR specific for a cancer antigen, a scFv derived or
  • CARs of the present disclosure that specifically bind to a WT-1 antigen (e.g, in the context of a peptide:HLA complex) comprise a TCR Va domain and a nb domain, or a functional fragment or portion thereof.
  • a WT-1 specific binding protein is a TCR.
  • the binding protein (a) comprises a TCR a-chain having at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identity to, comprising, or consisting of the amino acid sequence as set forth in SEQ ID NO: 50 or 46, and a TCR b-chain having at least 90% identity to, comprising, or consisting of the amino acid sequence set forth in SEQ ID NO: 58 or 54;
  • the binding protein comprises a fusion protein comprising (i) an extracellular component comprising a binding domain that comprises a T cell receptor (TCR) a chain variable (Va) domain and a T cell receptor (TCR) b chain variable (nb) domain, wherein the Va domain comprises the CDR3 amino acid sequence (CDR3a) according to any one of SEQ ID NOs: 19, 22, 25, or 28, or a variant thereof, and the TCR nb domain comprises the CDR3 amino acid sequence (CDR3b) according to any one of SEQ ID NOs: 31, 34, 37, or 40, or a variant thereof; (ii) an intracellular component; and (iii) a transmembrane component disposed between the extracellular component and the intracellular component.
  • the fusion protein is a CAR.
  • the binding protein comprises a fusion protein comprising (i) an extracellular component comprising a binding domain that specifically binds to a RMFPNAPYL (SEQ ID NO:94) peptide:HLA complex, wherein the binding domain comprises a T cell receptor (TCR) a chain variable (Va) domain and a T cell receptor (TCR) b chain variable (nb) domain, wherein the Va domain comprises or consists of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 1, 2, 3, 4, 9, 10, 11, or 12, or a variant thereof, and the nb domain comprises or consists of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 5, 6, 7, 8, 13, 14, 15, or 16, or a variant thereof, optionally provided that: (a) at least three or four of the CDRs have no mutations, (b) the CDRs that do have mutations have only up to two amino acid substitutions, up to a contiguous five amino acid deletion, or a combination thereof;
  • binding domains including the exemplary CDR and variable domain sequences and variants thereof, can be comprised in a fusion protein according to the present disclosure.
  • an encoded polypeptide of this disclosure can comprise a "signal peptide” (also known as a leader sequence, leader peptide, or transit peptide).
  • Signal peptides target newly synthesized polypeptides to their appropriate location inside or outside the cell.
  • Amino acid sequences of exemplary proteins or polypeptides of the present disclosure that comprise a signal peptide are provided in, for example, SEQ ID NOs.:l-8, 46-49, and 54-57.
  • a signal peptide may be removed from the polypeptide during or once localization or secretion is completed.
  • a binding protein or fusion protein comprises, or is, a mature protein, or is or comprises a pre-protein.
  • Amino acid sequences of exemplary mature proteins or polypeptides of the present disclosure are provided in SEQ ID NOs.:9-16, 50-53, and 58-61.
  • a binding protein of the present disclosure comprises one or more junction amino acids.
  • a binding protein comprises a linker.
  • a linker is comprised of about two to about 35 amino acids, for instance, or about four to about 20 amino acids or about eight to about 15 amino acids or about 15 to about 25 amino acids.
  • Exemplary linkers include glycine-serine linkers ( e.g .,
  • a composition comprising a WT-specific binding protein according to any one of the aforementioned embodiments and a pharmaceutically acceptable carrier, diluent, or excipient.
  • a WT-l-specific binding protein is provided in soluble form (see, e.g., Walseng et al., PLoS One doi: 10.1371/journal. pone.0119559 (2015)), and can optionally be conjugated to a cytotoxic agent and/or a detectable agent.
  • Methods useful for isolating and purifying recombinantly produced soluble TCR may include obtaining supernatants from suitable host cell/vector systems that secrete the recombinant soluble TCR into culture media and then concentrating the media using a commercially available filter. Following concentration, the concentrate may be applied to a single suitable purification matrix or to a series of suitable matrices, such as an affinity matrix or an ion exchange resin. One or more reverse phase HPLC steps may be employed to further purify a recombinant polypeptide. These purification methods may also be employed when isolating an immunogen from its natural environment.
  • Methods for large scale production of one or more of the isolated/recombinant soluble TCR described herein include batch cell culture, which is monitored and controlled to maintain appropriate culture conditions. Purification of the soluble TCR may be performed according to methods described herein and known in the art and that comport with laws and guidelines of domestic and foreign regulatory agencies.
  • nucleic acid molecules encoding a binding protein specific for WT-1 are used to transfect/transduce a host cell (e.g., T cells) for use in adoptive transfer therapy.
  • a host cell e.g., T cells
  • Advances in TCR sequencing have been described (e.g., Robins et al., 2009 Blood 114:4099; Robins et al., 2010 Sci. Translat. Med. 2:47ra64, PMID: 20811043; Robins et al. 2011 (Sept. 10) J. Imm. Meth. Epub ahead of print, PMID: 21945395; Warren et al., 2011 Genome Res. 21:790) and may be employed in the course of practicing the embodiments according to the present disclosure.
  • WT-1 -specific binding proteins or domains as described herein may expressed by a host T cell and can be functionally characterized according to any of a large number of art accepted methodologies for assaying T cell activity, including determination of T cell binding, activation or induction and also including determination of T cell responses that are antigen-specific.
  • the binding protein is capable of promoting an antigen-specific T cell response against human WT-1 in a class I HLA-restricted manner.
  • the class I HLA-restricted response is transporter-associated with antigen processing (TAP)-independent.
  • the antigen-specific T cell response comprises at least one of a CD4 + helper T lymphocyte (Th) response and a CD8 + cytotoxic T lymphocyte (CTL) response.
  • the CTL response is directed against a WT-1 -overexpressing cell.
  • methodologies for assaying T cell activity include determination of T cell proliferation, T cell cytokine release, antigen-specific T cell stimulation, MHC restricted T cell stimulation, CTL activity ( e.g ., by detecting 51 Cr release from pre-loaded target cells), changes in T cell phenotypic marker expression, and other measures of T-cell functions.
  • MHC-peptide tetramer staining refers to an assay used to detect antigen- specific T cells, which features a tetramer of MHC molecules, each comprising an identical peptide having an amino acid sequence that is cognate ⁇ e.g., identical or related to) at least one antigen ⁇ e.g, WT-1), wherein the complex is capable of binding T cell reeceptors specific for the cognate antigen.
  • Each of the MHC molecules may be tagged with a biotin molecule. Biotinylated MHC/peptides are tetramerized by the addition of streptavidin, which can be fluorescently labeled. The tetramer may be detected by flow cytometry via the fluorescent label.
  • an MHC- peptide tetramer assay is used to detect or select enhanced affinity TCRs of the instant disclosure.
  • cytokines may be determined according to methods described herein and practiced in the art, including for example, ELISA, ELISPOT, intracellular cytokine staining, and flow cytometry and combinations thereof (e.g ., intracellular cytokine staining and flow cytometry).
  • Immune cell proliferation and clonal expansion resulting from an antigen-specific elicitation or stimulation of an immune response may be determined by isolating lymphocytes, such as circulating lymphocytes in samples of peripheral blood cells or cells from lymph nodes, stimulating the cells with antigen, and measuring cytokine production, cell proliferation and/or cell viability, such as by incorporation of tritiated thymidine or non-radioactive assays, such as MTT assays and the like.
  • lymphocytes such as circulating lymphocytes in samples of peripheral blood cells or cells from lymph nodes
  • stimulating the cells with antigen and measuring cytokine production, cell proliferation and/or cell viability, such as by incorporation of tritiated thymidine or non-radioactive assays, such as MTT assays and the like.
  • Thl cytokines such as IFN-g, IL-12, IL-2, and TNF-b
  • Type 2 cytokines such as IL-4, IL-5, IL-9, IL-10, and IL-13.
  • polynucleotides e.g., isolated polynucleotides
  • Isolated or recombinant polynucleotides encoding binding proteins specific for WT-1 as described herein may be produced and prepared according to various methods and techniques of the molecular biology or polypeptide purification arts.
  • a polynucleotide is codon optimized for efficient expression in a target host cell.
  • Codon optimization can be performed using known techniques and tools, e.g., using the GenScript® OptimumGeneTM tool; GeneArt ® GeneOptimizerTM(Sigma), or the like.
  • Codon-optimized sequences include sequences that are partially codon-optimized (i.e., at least one codon is optimized for expression in the host cell) and those that are fully codon-optimized. Codon optimization for expression in certain immune host cells is disclosed in, for example, Scholten etal, Clin. Immunol. 779:135, 2006.
  • a polynucleotide may refer to a single- or a double-stranded DNA, cDNA or RNA in any form, and may include a positive and a negative strand of the nucleic acid which complement each other, including anti-sense DNA, cDNA and RNA. Also included are siRNA, microRNA, RNA — DNA hybrids, ribozymes, and other various naturally occurring or synthetic forms of DNA or RNA.
  • a polynucleotide encoding a binding protein of the present disclosure comprises a polynucleotide having at least 75% identity (e.g ., 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) to the polynucleotide sequence set forth in any one of SEQ ID NOs: 62-81.
  • the polynucleotide encoding a binding protein comprises (i) a TCRP chain-encoding polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO: 74, and a TCRa chain-encoding polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO: 66; (ii) TCRP chain-encoding a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO: 75, and a TCRa chain encoding polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO: 67; (iii) a TCRP chain-encoding polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO: 76, and a TCRa
  • a single polynucleotide encodes a binding protein as described herein, or, alternatively, the binding protein may be encoded by more than one polynucleotide.
  • components or portions of a binding protein may be encoded by two or more polynucleotides, which may be contained on a single nucleic acid molecule or may be contained on two or more nucleic acid molecules.
  • a polynucleotide encoding two or more components or portions of a binding protein of the present disclosure comprises the two or more coding sequences operatively associated in a single open reading frame.
  • Such an arrangement can advantageously allow coordinated expression of desired gene products, such as, for example, contemporaneous expression of alpha- and beta-chains of a TCR, such that they are produced in about a 1 : 1 ratio.
  • two or more substituent gene products of a binding protein of this disclosure such as a TCR ( e.g ., alpha- and beta-chains) or CAR, are expressed as separate molecules and associate post- translationally.
  • two or more substituent gene products of a binding protein of this disclosure are expressed as a single polypeptide with the parts separated by a cleavable or removable segment.
  • self-cleaving peptides useful for expression of separable polypeptides encoded by a single polynucleotide or vector include, for example, a Porcine teschovirus-1 2 A (P2A- 1) peptide, a Porcine teschovirus-22 A (P2A-2) peptide, a Thosea asigna virus 2 A (T2A) peptide, an Equine rhinitis A virus (ERAV) 2A (E2A) peptide, and a Foot-and- Mouth disease virus 2A (F2A) peptide.
  • P2A- 1 Porcine teschovirus-1 2 A
  • P2A-2A-2 A Porcine teschovirus-22 A
  • T2A Thosea asigna virus 2 A
  • E2A Equine rhinitis A virus
  • F2A Foot-and- Mouth disease virus 2A
  • nucleotide and amino acid sequences of self-cleaving peptides are provided in SEQ ID NOs: 84-93.
  • the polynucleotide encoding a self-cleaving peptide comprises or consists of a polynucleotide sequence having at least 75% identity to the polynucleotide sequence set forth in any one of SEQ ID NOs: 89-93.
  • the encoded self-cleaving peptide comprises or consists of an amino acid sequence having at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identity to the amino acid sequence set forth in any one of SEQ ID NOs: 84-88.
  • polynucleotides encoding two polypeptides of interest separated by a self-cleaving peptide e.g., b-chain-encoding polynucleotide-self-cleaving peptide-a-chain-encoding polynucleotide; a-chain- encoding polynucleotide-self-cleaving peptide-P-chain-encoding polynucleotide
  • a self-cleaving peptide e.g., b-chain-encoding polynucleotide-self-cleaving peptide-a-chain-encoding polynucleotide; a-chain- encoding polynucleotide-self-cleaving peptide-P-chain-encoding polynucleotide
  • the polynucleotide encoding a binding protein has a structure comprising or having 5’-end to 3’-end of (TCRP domain (e.g, chain)-encoding polynucleotide)-(self-cleaving peptide-encoding polynucleotide)- (TCRa domain (e.g, chain)-encoding polynucleotide).
  • TCRP domain e.g, chain
  • TCRa domain e.g, chain
  • the polynucleotide encoding a binding protein comprises or consists of a polynucleotide sequence having at least 75% (e.g, 75%,
  • the polynucleotide comprises a polynucleotide sequence comprising or consisting of the polynucleotide sequence set forth in any one of SEQ ID NOs: 78-81.
  • an encoded binding protein is expressed as part of a transgene construct that encodes, and/or a modified immune cell can encode: one or more additional accessory protein, such as a safety switch protein; a tag, a selection marker; a CD8 co-receptor b-chain; a CD8 co-receptor a-chain or both; or any combination thereof.
  • additional accessory protein such as a safety switch protein; a tag, a selection marker; a CD8 co-receptor b-chain; a CD8 co-receptor a-chain or both; or any combination thereof.
  • WO 2018/058002 the polynucleotides, transgene constructs, and accessory components, including the nucleotide and amino acid sequences of which, are hereby incorporated by reference. It will be understood that any or all of a binding protein of the present disclosure, a safety switch protein, a tag, a selection marker, a CD8 co-receptor b-chain, or a CD8 co-receptor a-chain may be encoded by a single nucleic acid molecule or may be encoded by polynucleotide sequences that are, or are present on, separate nucleic acid molecules.
  • Exemplary safety switch proteins include, for example, a truncated EGF receptor polypeptide (huEGFRt) that is devoid of extracellular N-terminal ligand binding domains and intracellular receptor tyrosine kinase activity, but that retains its native amino acid sequence, has type I transmembrane cell surface localization, and has a conformationally intact binding epitope for pharmaceutical-grade anti-EGFR monoclonal antibody, cetuximab (Erbitux) tEGF receptor (tEGFr; Wang etal. , Blood 118:1255-1263, 2011); a caspase polypeptide (e.g ., iCasp9; Straathof etal.
  • huEGFRt truncated EGF receptor polypeptide
  • accessory components useful for modified immune cells of the present disclosure comprise a tag or selection marker that allows the cells to be identified, sorted, isolated, enriched, or tracked.
  • marked immune cells having desired characteristics e.g, an antigen-specific TCR and a safety switch protein
  • selection marker comprises a nucleic acid construct (and the encoded gene product) that confers an identifiable change to a cell permitting detection and positive selection of immune cells transduced with a polynucleotide comprising a selection marker.
  • RQR is a selection marker that comprises a major extracellular loop of CD20 and two minimal CD34 binding sites.
  • an RQR-encoding polynucleotide comprises a polynucleotide that encodes the 16-amino-acid CD34 minimal epitope.
  • the CD34 minimal epitope is incorporated at the amino terminal position of a CD8 co-receptor stalk domain (Q8).
  • the CD34 minimal binding site sequence can be combined with a target epitope for CD20 to form a compact marker/suicide gene for T cells (RQR8) (Philip etal. , 2014, incorporated by reference herein).
  • RQR8 compact marker/suicide gene for T cells
  • This construct allows for the selection of immune cells expressing the construct, with for example, CD34 specific antibody bound to magnetic beads (Miltenyi) and that utilizes clinically accepted pharmaceutical antibody, rituximab, that allows for the selective deletion of a transgene expressing engineered T cell (Philip et al ., 2014).
  • selection markers also include several truncated type I transmembrane proteins normally not expressed on T cells: the truncated low-affinity nerve growth factor, truncated CD 19, and truncated CD34 (see for example, Di Stasi et al, N. Engl. J Med. 365:1673-1683, 2011; Mavilio etal, Blood 83: 1988-1997, 1994; Fehse et al, Mol. Ther. 7:448-456, 2000; each incorporated herein in their entirety).
  • a useful feature of CD 19 and CD34 is the availability of the off-the-shelf Miltenyi CliniMACsTM selection system that can target these markers for clinical-grade sorting.
  • CD 19 and CD34 are relatively large surface proteins that may tax the vector packaging capacity and transcriptional efficiency of an integrating vector.
  • Surface markers containing the extracellular, non-signaling domains or various proteins e.g., CD 19, CD34, LNGFR
  • Any selection marker may be employed and should be acceptable for Good Manufacturing Practices.
  • selection markers are expressed with a polynucleotide that encodes a gene product of interest (e.g, a binding protein of the present disclosure, such as a TCR or CAR).
  • selection markers include, for example, reporters such as GFP, EGFP, b-gal or chloramphenicol acetyltransferase (CAT).
  • a selection marker such as, for example, CD34 is expressed by a cell and the CD34 can be used to select enrich for, or isolate (e.g, by immunomagnetic selection) the transduced cells of interest for use in the methods described herein.
  • a CD34 marker is distinguished from an anti-CD34 antibody, or, for example, a scFv, TCR, or other antigen recognition moiety that binds to CD34.
  • a selection marker comprises an RQR polypeptide, a truncated low-affinity nerve growth factor (tNGFR), a truncated CD 19 (tCD19), a truncated CD34 (tCD34), or any combination thereof.
  • tNGFR truncated low-affinity nerve growth factor
  • tCD19 truncated CD 19
  • tCD34 truncated CD34
  • CD4 + T cells inclusion of CD4 + T cells in an immunotherapy cell product can provide antigen-induced IL-2 secretion and augment persistence and function of introduced cytotoxic CD8 + T cells (see, e.g., Kennedy etal, Immunol. Rev. 222 129 (2008); Nakanishi et ah, Nature 4 ⁇ 52(7272):510 (2009)).
  • a class I restricted TCR in CD4 + T cells may require the transfer of a CD8 co-receptor to enhance sensitivity of the TCR to class I HLA peptide complexes.
  • CD4 co-receptors differ in structure to CD8 and have been shown to be ineffective substitutes for CD8 co-receptors (see, e.g, Stone & Kranz, Front. Immunol. 4:244 (2013); see also Cole et al, Immunology 737(2): 139 (2012).
  • another accessory protein for use in the compositions and methods of this disclosure comprises a CD8 co receptor or component thereof.
  • Engineered immune cells comprising a heterologous polynucleotide encoding a binding protein of the present disclosure may, in certain embodiments, further comprise a heterologous polynucleotide encoding a CD8 co-receptor protein, or a beta-chain or alpha-chain component thereof.
  • An encoded CD8 co-receptor includes, in some embodiments, an a-chain or a fragment or variant thereof.
  • An amino acid sequence of the human CD8 co-receptor a - chain precursor is known and is provided at, for example, UniProtKB -P30433 (see also UniProtKB - P31783; -P10732; and -P10731).
  • An encoded CD8 co-receptor includes, in some embodiments, a b-chain or a fragment or variant thereof.
  • An amino acid sequence of the human CD8 co-receptor b- chain precursor is known and is provided at, for example, UniProtKB -PI 0966 (see also UniProtKB - Q9UQ56; -E9PD41; Q8TD28; and -P30434; and -P05541).
  • the encoded RQR polypeptide is contained in a b-chain, an a-chain, or both, or a fragment or variant of either or both, of the encoded CD8 co-receptor.
  • a modified immune cell comprises a heterologous polynucleotide encoding iCasp9 and a heterologous polynucleotide encoding a recombinant CD8 co-receptor protein that comprises a b-chain containing a RQR polypeptide and further comprises a CD8 a- chain.
  • An isolated polynucleotide of this disclosure may further comprise a polynucleotide encoding a safety switch protein, a selection marker, a CD8 co-receptor beta chain, or a CD8 co-receptor alpha chain as disclosed herein, or may comprise a polynucleotide encoding any combination thereof.
  • a modified immune cell of the present disclosure further comprises: (i) a heterologous polynucleotide encoding a polypeptide that comprises an extracellular portion of a CD8 co-receptor a chain, wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor a chain; (ii) a heterologous polynucleotide encoding a polypeptide that comprises an extracellular portion of a CD8 co-receptor b chain, wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor b chain; or (iii)the polynucleotide of (i) and the polynucleotide of (ii), wherein, optionally, the host cell comprises a CD4+ T cell, a CD8+ T cell, or both.
  • the modified immune cell comprises: (a) the heterologous polynucleotide encoding a polypeptide comprising an extracellular portion of a CD8 co-receptor a chain wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor a chain; (b) the heterologous polynucleotide encoding a polypeptide comprising an extracellular portion of a CD8 co-receptor b chain, wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor b chain; and (c) a polynucleotide encoding a self-cleaving peptide disposed between the polynucleotide of (a) and the polynucleotide of (b).
  • a polynucleotide encoding a binding protein further comprises a polynucleotide that encodes a selection marker.
  • Standard techniques may be used for recombinant DNA, peptide and oligonucleotide synthesis, immunoassays and tissue culture and transformation (e.g ., electroporation, lipofection).
  • Enzymatic reactions and purification techniques may be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein.
  • These and related techniques and procedures may be generally performed according to conventional methods well-known in the art and as described in various general and more specific references in microbiology, molecular biology, biochemistry, molecular genetics, cell biology, virology and immunology techniques that are cited and discussed throughout the present specification.
  • Certain embodiments include a polynucleotide contained in a vector.
  • a typical vector may comprise a polynucleotide capable of transporting another nucleic acid to which it has been linked, or which is capable of replication in a host organism.
  • Some examples of vectors include plasmids, viral vectors, cosmids, and others.
  • Some vectors may be capable of autonomous replication in a host cell into which they are introduced (e.g . bacterial vectors having a bacterial origin of replication and episomal mammalian vectors), whereas other vectors may be integrated into the genome of a host cell upon introduction into the host cell and thereby replicate along with the host genome.
  • vectors are capable of directing the expression of genes to which they are operatively linked.
  • agents e.g., polynucleotides encoding binding proteins specific for WT-1, or variants thereof, as described herein
  • each agent may reside in separate or the same vectors, and multiple vectors (each containing a different agent the same agent) may be introduced to a cell or cell population or administered to a subject.
  • polynucleotides of the present disclosure may be operatively linked to certain elements of a vector.
  • polynucleotide sequences that are needed to effect the expression and processing of coding sequences to which they are ligated may be operatively linked.
  • Expression control sequences may include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e. Kozak consensus sequences); sequences that enhance protein stability; and possibly sequences that enhance protein secretion.
  • Expression control sequences may be operatively linked if they are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
  • the vector comprises a plasmid vector or a viral vector (e.g ., a vector selected from lentiviral vector or a g-retroviral vector).
  • Viral vectors include retrovirus, adenovirus, parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as ortho-myxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g., measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegaHovirus), and poxvirus (e.g., vaccinia, fowlpox and canarypox).
  • herpesvirus
  • viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example.
  • retroviruses include avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, and spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields et ak, Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • “Retroviruses” are viruses having an RNA genome, which is reverse-transcribed into DNA using a reverse transcriptase enzyme, the reverse-transcribed DNA is then incorporated into the host cell genome.
  • “Gammaretrovirus” refers to a genus of the retroviridae family. Examples of gammaretroviruses include mouse stem cell virus, murine leukemia virus, feline leukemia virus, feline sarcoma virus, and avian reticuloendotheliosis viruses.
  • "Lentiviral vector,” as used herein, means HIV-based lentiviral vectors for gene delivery, which can be integrative or non-integrative, have relatively large packaging capacity, and can transduce a range of different cell types.
  • Lentiviral vectors are usually generated following transient transfection of three (packaging, envelope and transfer) or more plasmids into producer cells. Like HIV, lentiviral vectors enter the target cell through the interaction of viral surface glycoproteins with receptors on the cell surface. On entry, the viral RNA undergoes reverse transcription, which is mediated by the viral reverse transcriptase complex. The product of reverse transcription is a double-stranded linear viral DNA, which is the substrate for viral integration into the DNA of infected cells.
  • the viral vector can be a gammaretrovirus, e.g., Moloney murine leukemia virus (MLV)-derived vectors.
  • the viral vector can be a more complex retrovirus-derived vector, e.g., a lentivirus-derived vector. HIV- 1 -derived vectors belong to this category.
  • Other examples include lentivirus vectors derived from HIV-2, FIV, equine infectious anemia virus, SIV, and Maedi-Visna virus (ovine lentivirus).
  • Retroviral and lentiviral vector constructs and expression systems are also commercially available.
  • Other viral vectors also can be used for polynucleotide delivery including DNA viral vectors, including, for example adenovirus-based vectors and adeno-associated virus (AAV)-based vectors; vectors derived from herpes simplex viruses (HSVs), including amplicon vectors, replication-defective HSV and attenuated HSV (Krisky et ak, Gene Ther. 5:1517, 1998).
  • HSVs herpes simplex viruses
  • vectors developed for gene therapy uses can also be used with the compositions and methods of this disclosure.
  • Such vectors include those derived from baculoviruses and a- viruses. (Jolly, D J. 1999. Emerging Viral Vectors pp 209-40 in Friedmann T. ed. The Development of Human Gene Therapy. New York: Cold Spring Harbor Lab), or plasmid vectors (such as Sleeping Beauty or other transposon vectors).
  • plasmid vectors such as Sleeping Beauty or other transposon vectors.
  • the viral vector may also comprise additional sequences between the two (or more) transcripts allowing for bicistronic or multi cistronic expression. Examples of such sequences used in viral vectors include internal ribosome entry sites (IRES), furin cleavage sites, viral 2A peptide, or any combination thereof.
  • a vector is capable of delivering the polynucleotide or transgene construct to a host cell (e.g., a hematopoietic progenitor cell or a human immune system cell).
  • a vector is capable of delivering a polynucleotide or transgene construct to human immune system cell, such as, for example, a CD4+ T cell, a CD8+ T cell, a CD4- CD8- double negative T cell, a stem cell memory T cell, a gd T cell, a natural killer cell, a dendritic cell, or any combination thereof.
  • a vector is capable of delivering a transgene construct to a naive T cell, a central memory T cell, an effector memory T cell, or any combination thereof.
  • a vector that encodes a polynucleotide or transgene construct of the present disclosure may further comprise a polynucleotide that encodes a nuclease that can be used to perform a chromosomal knockout in a host cell (e.g., a CRISPR-Cas endonuclease or another endonuclease as disclosed herein) or that can be used to to deliver a therapeutic polynucleotide or transgene or portion thereof to a host cell in a gene therapy replacement or gene repair therapy.
  • a host cell e.g., a CRISPR-Cas endonuclease or another endonuclease as disclosed herein
  • a nuclease used for a chromosomal knockout or a gene replacement or gene repair therapy can be delivered to a host cell independent of a vector that encodes a polynucleotide or transgene construct of this disclosure.
  • host cells that comprise a heterologous polynucleotide of the present disclosure (e.g., encoding any presently disclosed binding protein or fusion protein and optionally encoding one or more additional proteins, such as a selection marker a self-cleaving peptide, a CD8 co-receptor polypeptide, or any combination thereof) and/or express any binding protein as disclosed herein.
  • a host cell may be generated by, for example, transfection or transduction with a vector of the present disclosure, and/or by gene-editing.
  • a host cell comprises an immune system cell, which may be any human immune system cell, such as those exemplary immune system cells described herein.
  • the host cell comprises a T cell, a NK cell, a NK-T cell, or any combination thereof.
  • the T cell comprises a CD8 + T cell, a CD4 + T cell, or both.
  • a modified immune cell comprises a heterologous polynucleotide that encodes a binding protein according to the present disclosure, wherein the encoded binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.: 94): human leukocyte antigen (HLA) complex.
  • RMFPNAPYL SEQ ID NO.: 94
  • HLA human leukocyte antigen
  • the encoded binding protein is capable of binding to the SEQ ID NO.:94:HLA complex with an IFNy production pECso of 4.0, 4.5, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, or higher.
  • the peptide:HLA complex comprises a peptide:HLA- A*201 complex.
  • the modified immune cells in a population produce interferon-gamma (IFN-g) when the population of the modified immune cells is co-cultured for 4 hours with antigen-presenting cells (e.g ., T2 cells, Jurkat cells, dendritic cells, expressing an HLA such as HLA-A*0201) pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 4 mM, or 10 5 pM, or 10 6 pM in the co-culture.
  • antigen-presenting cells e.g ., T2 cells, Jurkat cells, dendritic cells, expressing an HLA such as HLA-A*0201
  • RMFPNAPYL amino acid sequence
  • 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, or more of the modified immune cells in a population are Nur77 + (i.e., express Nur77) when the population of the modified immune cells is co-cultured with antigen-presenting cells (also called "target cells” in some contexts) pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of about 10 2 pM in the co-culture, wherein the antigen-presenting cells express optionally comprise T2 cells, Jurkat cells, or both, and are optionally HLA-A*0201+.
  • antigen-presenting cells also called "target cells” in some contexts
  • 10%, 15%, 20%, or more of the modified immune cells in the population are Nur77 + when the population of the modified immune cells is co- cultured with antigen-presenting cells pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 3 mM in the co-culture.
  • a binding protein has a Nur77 expression pEC50 (SEQ ID NO.:94:HLA, such as HL A- A* 0201) of 1.0, 1.1, 1.2, 1.3, 1.4, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, or more.
  • pEC50 SEQ ID NO.:94:HLA, such as HL A- A* 0201
  • a modified immune cell is capable of killing at least 11%, 12%, 13%, 14%, 15%, 20%, 25%, or more of the HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 30: 1.
  • the modified immune cell is capable of killing 10% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 10: 1.
  • the modified immune cell is capable of killing about 5% or more of HLA-A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 1 : 1.
  • killing can be measured using a 4hr co-culture assay, optionally using labeled chromium (e.g, 51 Cr), as described herein.
  • labeled chromium e.g, 51 Cr
  • a modified immune cell is capable of killing 21%, 22%, 23%, 24%, 25%, or more of the Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 30: 1. In further embodiments, a modified immune cell is capable of killing 10%, 15%, or more of the Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 10: 1. In further embodiments, a modified immune cell is capable of killing 10%, 15% or more of the Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 9:1, 8:1, 7:1, 6:1, or 5:1.
  • a modified immune cell has increased killing activity against HLA-A*0201 + MDA-MB-468 cells and/or against Panel cells in a 4-hour co culture, and/or has improved IFN-g production in a 4-hour co-culture with peptide- pulsed target cells, and/or further reduces proliferation of Panc-1 cancer cells (e.g, over 60, 75, 100, 125, 150, or more hours, as measured using an IncuCyte assay, at an 8:1 effectontarget cell ratio), as compared to a reference immune cell comprising a polynucleotide that encodes a T cell receptor comprising a TCRa chain having the amino acid sequence set forth in SEQ ID NO: 82 and a TCRP chain having the amino acid sequence set forth in SEQ ID NO: 83.
  • a modified immune cell of the present disclosure prevents or substantially prevents growth and/or proliferation of Pane- 1 cancer cells for over 50, 100, 150 hours, or more, wherein, optionally, the modified immune cell and the Panc-1 cancer cells are present at a 8:1 effectontarget cell ratio.
  • killing can be measured using a 4hr co-culture assay, optionally using labeled chromium (e.g, 51 Cr), as described herein.
  • labeled chromium e.g, 51 Cr
  • a "reference" immune cell is of a same immune cell type and is phenotypically identical or substantially identical to the subject modified immune cell, with the exception of the encoded binding protein.
  • a reference immune cell is a CD8+ human T cell, and can be, for example, from the same source or donor as the modified immune cell.
  • an encoded binding protein can be a TCR, a CAR, or a scTCR. In any of the aforementioned embodiments, an encoded binding protein is capable of binding to a WT-1 peptide (SEQ ID NO.:94):HLA complex on a cell surface independent of CD8 or in the absence of CD8.
  • a binding protein expressed by a modified immune cell can comprise a TCR, a single-chain TCR (scTCR), a chimeric antigen receptor (CAR), or any combination thereof.
  • any suitable immune cell may be modified to include a heterologous polynucleotide encoding a binding protein of this disclosure, including, for example, a T cell, a NK cell, a NK-T cell, a macrophage, a monocyte, or a dendritic cell.
  • a modified immune cell comprises a CD4 + T cell, a CD8 + T cell, or both.
  • a modified immune cell comprises a CD4-CD8- double negative T cell or a gd T cell.
  • the T cell is a naive T cell, a central memory T cell, an effector memory T cell, or any combination thereof.
  • any appropriate method can be used to transfect or transduce the cells, for example, the T cells, or to administer the polynucleotides or compositions of the present methods.
  • Known methods for delivering polynucleotides to host cells include, for example, use of cationic polymers, lipid-like molecules, and certain commercial products such as, for example, IN-VIVO-JET PEI.
  • Other methods include ex vivo transduction, injection, electroporation, DEAE-dextran, sonication loading, liposome- mediated transfection, receptor-mediated transduction, microprojectile bombardment, transposon-mediated transfer, and the like.
  • Still further methods of transfecting or transducing host cells employ vectors, described in further detail herein.
  • a host cell is gene-edited to comprise in its genome a polynucleotide that encodes a binding protein (or other protein or polypeptide) as provided herein.
  • a modified immune cell may modified to reduce or eliminate expression (e.g., by a chromosomal gene knockout as described herein) of one or more endogenous genes that encode a polypeptide involved in immune signaling or other related activities, and/or to comprise a heterologous polynucleotide as provided herein.
  • exemplary gene knockouts include those that encode PD-1, LAG-3, CTLA4, TIM3, an HLA molecule, a TCR molecule, or the like.
  • certain endogenously expressed immune cell proteins may be recognized as foreign by an allogeneic host receiving the modified immune cells, which may result in elimination of the modified immune cells (e.g, an HLA allele), or may downregulate the immune activity of the modified immune cells (e.g, PD-1, LAG-3, CTLA4), or may interfere with the binding activity of a heterologously expressed binding protein of the present disclosure (e.g, an endogenous TCR of a modified T cell that binds a non-WT-1 antigen and may interferes with the modified immune cell binding a cell that expresses WT-1 antigen), or may compete for expression with a heterologous binding protein.
  • a heterologously expressed binding protein of the present disclosure e.g, an endogenous TCR of a modified T cell that binds a non-WT-1 antigen and may interferes with the modified immune cell binding a cell that expresses WT-1 antigen
  • a modified immune cell is a donor cell (e.g., allogeneic) or an autologous cell.
  • a modified immune cell of this disclosure comprises a chromosomal gene knockout of one or more of a gene that encodes PD-1, LAG-3, CTLA4, TIM3, TIGIT, an HLA component (e.g, a gene that encodes an al macroglobulin, an a2 macroglobulin, an a3 macroglobulin, a b ⁇ microglobulin, or a b2 microglobulin), or a TCR component (e.g., a gene that encodes a TCR variable region or a TCR constant region) (see, e.g, Torikai et al., Nature Sci. Rep.
  • HLA component e.g, a gene that encodes an al macroglobulin, an a2 macroglobulin, an a3 macroglobulin, a b ⁇ microglobulin, or a b2 microglobulin
  • TCR component e.g., a gene that encodes a TCR variable region or a TCR constant region
  • chromosomal gene knockout refers to a genetic alteration or introduced inhibitory agent in a host cell that prevents (e.g, reduces, delays, suppresses, or abrogates) production, by the host cell, of a functionally active endogenous polypeptide product. Alterations resulting in a chromosomal gene knockout can include, for example, introduced nonsense mutations (including the formation of premature stop codons), missense mutations, gene deletion, and strand breaks, as well as the heterologous expression of inhibitory nucleic acid molecules that inhibit endogenous gene expression in the host cell.
  • a chromosomal gene knock-out or gene knock-in is made by chromosomal editing of a host cell.
  • Chromosomal editing can be performed using, for example, endonucleases.
  • endonucleases refers to an enzyme capable of catalyzing cleavage of a phosphodiester bond within a polynucleotide chain.
  • an endonuclease is capable of cleaving a targeted gene thereby inactivating or "knocking out" the targeted gene.
  • An endonuclease may be a naturally occurring, recombinant, genetically modified, or fusion endonuclease.
  • the nucleic acid strand breaks caused by the endonuclease are commonly repaired through the distinct mechanisms of homologous recombination or non-homologous end joining (NHEJ).
  • NHEJ non-homologous end joining
  • a donor nucleic acid molecule may be used for a donor gene "knock-in”, for target gene "knock-out”, and optionally to inactivate a target gene through a donor gene knock in or target gene knock out event.
  • NHEJ is an error- prone repair process that often results in changes to the DNA sequence at the site of the cleavage, e.g., a substitution, deletion, or addition of at least one nucleotide.
  • NHEJ may be used to "knock-out" a target gene.
  • Examples of endonucleases include zinc finger nucleases, TALE-nucleases, CRISPR-Cas nucleases, meganucleases, and megaTALs.
  • a "zinc finger nuclease” refers to a fusion protein comprising a zinc finger DNA-binding domain fused to a non-specific DNA cleavage domain, such as a Fokl endonuclease.
  • ZFN zinc finger nuclease
  • Each zinc finger motif of about 30 amino acids binds to about 3 base pairs of DNA, and amino acids at certain residues can be changed to alter triplet sequence specificity (see, e.g., Desjarlais etal., Proc. Natl. Acad. Sci.
  • ZFNs mediate genome editing by catalyzing the formation of a site-specific DNA double strand break (DSB) in the genome, and targeted integration of a transgene comprising flanking sequences homologous to the genome at the site of DSB is facilitated by homology directed repair.
  • DSB DNA double strand break
  • a DSB generated by a ZFN can result in knock out of target gene via repair by non-homologous end joining (NHEJ), which is an error-prone cellular repair pathway that results in the insertion or deletion of nucleotides at the cleavage site.
  • NHEJ non-homologous end joining
  • a gene knockout comprises an insertion, a deletion, a mutation or a combination thereof, made using a ZFN molecule.
  • TALEN transcription activator-like effector nuclease
  • a "TALE DNA binding domain” or “TALE” is composed of one or more TALE repeat domains/units, each generally having a highly conserved 33-35 amino acid sequence with divergent 12th and 13th amino acids.
  • the TALE repeat domains are involved in binding of the TALE to a target DNA sequence.
  • the divergent amino acid residues referred to as the Repeat Variable Diresidue (RVD), correlate with specific nucleotide recognition.
  • RVD Repeat Variable Diresidue
  • the natural (canonical) code for DNA recognition of these TALEs has been determined such that an HD (histine-aspartic acid) sequence at positions 12 and 13 of the TALE leads to the TALE binding to cytosine (C), NG (asparagine-glycine) binds to a T nucleotide, NI (asparagine-isoleucine) to A, NN (asparagine-asparagine) binds to a G or A nucleotide, and NG (asparagine-glycine) binds to a T nucleotide.
  • Non-canonical (atypical) RVDs are also known (see, e.g., U.S. Patent Publication No.
  • TALENs can be used to direct site-specific double-strand breaks (DSB) in the genome of T cells.
  • Non- homologous end joining (NHEJ) ligates DNA from both sides of a double-strand break in which there is little or no sequence overlap for annealing, thereby introducing errors that knock out gene expression.
  • homology directed repair can introduce a transgene at the site of DSB providing homologous flanking sequences are present in the transgene.
  • a gene knockout comprises an insertion, a deletion, a mutation or a combination thereof, and made using a TALEN molecule.
  • CRISPR/Cas nuclease system refers to a system that employs a CRISPR RNA (crRNA)-guided Cas nuclease to recognize target sites within a genome (known as protospacers) via base-pairing complementarity and then to cleave the DNA if a short, conserved protospacer associated motif (PAM) immediately follows 3’ of the complementary target sequence.
  • CRISPR/Cas systems are classified into three types (i.e., type I, type II, and type III) based on the sequence and structure of the Cas nucleases.
  • the crRNA-guided surveillance complexes in types I and III need multiple Cas subunits.
  • Type II system the most studied, comprises at least three components: an RNA-guided Cas9 nuclease, a crRNA, and a trans-acting crRNA (tracrRNA).
  • the tracrRNA comprises a duplex forming region.
  • a crRNA and a tracrRNA form a duplex that is capable of interacting with a Cas9 nuclease and guiding the Cas9/crRNA:tracrRNA complex to a specific site on the target DNA via Watson-Crick base-pairing between the spacer on the crRNA and the protospacer on the target DNA upstream from a PAM.
  • Cas9 nuclease cleaves a double-stranded break within a region defined by the crRNA spacer. Repair by NHEJ results in insertions and/or deletions which disrupt expression of the targeted locus.
  • a transgene with homologous flanking sequences can be introduced at the site of DSB via homology directed repair.
  • the crRNA and tracrRNA can be engineered into a single guide RNA (sgRNA or gRNA) (see, e.g., Jinek et al., Science 337:816-21, 2012).
  • a gene knockout comprises an insertion, a deletion, a mutation or a combination thereof, and made using a CRISPR/Cas nuclease system.
  • Exemplary gRNA sequences and methods of using the same to knock out endogenous genes that encode immune cell proteins include those described in Ren et al., Clin. Cancer Res. 23(9):2255-2266 (2017), the gRNAs, Cas9 DNAs, vectors, and gene knockout techniques of which are hereby incorporated by reference in their entirety.
  • Cas nucleases may be used, including but not limited to, Cas 12, Cas 13, and Cas 14 nucleases, and variants thereof.
  • Cas nucleases disclosed in WO 2019/178427 which is hereby incorporated by reference in its entirety (including the Cas nucleases, CRISPR-Cas systems, and related methods disclosed therein), may be utilized.
  • Exemplary meganucleases include I-Scel, I-Ceul, PI-PspI, RI-Sce, 1-SceIV, I- Csml, I-Panl, I-Scell, I-Ppol, I-SceIII, I-Crel, I-Tevl, I-TevII and I-TevIII, whose recognition sequences are known (see, e.g., U.S. Patent Nos. 5,420,032 and 6,833,252; Belfort et al., Nucleic Acids Res. 25: 3379-3388, 1997; Dujon etal., Gene 52:115-118, 1989; Perler et al ., Nucleic Acids Res.
  • naturally occurring meganucleases may be used to promote site-specific genome modification of a target selected from PD-1, LAG3,
  • TIM3, CTLA4, TIGIT an HLA-encoding gene, or a TCR component-encoding gene.
  • an engineered meganuclease having a novel binding specificity for a target gene is used for site-specific genome modification (see, e.g., Porteus et al., Nat. Biotechnol. 23:967-73, 2005; Sussman et al., J. Mol. Biol. 342: 31-41, 2004; Epinat et al., Nucleic Acids Res. 37:2952-62, 2003; Chevalier et al., Molec. Cell 70:895-905, 2002; Ashworth et al., Nature 441:656-659, 2006; Paques et al., Curr. Gene Ther. 7:49- 66, 2007; U.S.
  • a chromosomal gene knockout is generated using a homing endonuclease that has been modified with modular DNA binding domains of TALENs to make a fusion protein known as a megaTAL.
  • MegaTALs can be utilized to not only knock-out one or more target genes, but to also introduce (knock in) heterologous or exogenous polynucleotides when used in combination with an exogenous donor template encoding a polypeptide of interest.
  • a chromosomal gene knockout comprises an inhibitory nucleic acid molecule that is introduced into a host cell (e.g, an immune cell) comprising a heterologous polynucleotide encoding an antigen-specific receptor that specifically binds to a tumor associated antigen, wherein the inhibitory nucleic acid molecule encodes a target-specific inhibitor and wherein the encoded target-specific inhibitor inhibits endogenous gene expression (i.e., of PD-1, TIM3, LAG3, CTLA4, TIGIT, an HLA component, or a TCR component, or any combination thereof) in the host immune cell.
  • a host cell e.g, an immune cell
  • a heterologous polynucleotide encoding an antigen-specific receptor that specifically binds to a tumor associated antigen
  • the inhibitory nucleic acid molecule encodes a target-specific inhibitor and wherein the encoded target-specific inhibitor inhibits endogenous gene expression (i.e., of PD-1, TIM
  • Chromosomal gene knockout can be confirmed directly by DNA sequencing of the host immune cell following use of the knockout procedure or agent. Chromosomal gene knockouts can also be inferred from the absence of gene expression (e.g., the absence of an mRNA or polypeptide product encoded by the gene) following the knockout.
  • any of the foregoing gene-editing techniques can be used to introduce a polynucleotide of the present disclosure (e.g, encoding a binding protein and/or a CD8 co-receptor polypeptide) into a host cell genome.
  • a heterologous polynucleotide is introduced into a locus encoding an endogenous TCR component, HLA component, PD-1, LAG-3, CTLA4, TIM3, or TIGIT, or a safe harbor locus such as Rosa26, AAVS1 , CCR5, or the like.
  • a heterologous polynucleotide encoding a binding protein and/or encoding a CD8 co-receptor polypeptide is introduced into a host cell TRAC locus.
  • a chromosomal knockout of a host cell TRBC locus is introduced.
  • a host cell e.g, modified immune cell
  • the host cell comprises a chromosomal knockout of an endogenous TRBC locus.
  • compositions are provided herein that comprise a modified immune cell of the present disclosure (and/or a polynucleotide, vector, or binding protein) and a pharmaceutically acceptable carrier, diluent, or excipient.
  • a unit dose comprises (i) a composition comprising at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% modified CD4+ T cells, combined with (ii) a composition comprising at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% modified CD8+ T cells, in about a 1 : 1 ratio, wherein the unit dose contains a reduced amount or substantially no naive T cells (i.e., has less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 10%, less than about 5%, or less then about 1% the population of naive T cells present in
  • a unit dose comprises (i) a composition comprising at least about 50% modified CD4+ T cells, combined with (ii) a composition comprising at least about 50% modified CD8+ T cells, in about a 1 : 1 ratio, wherein the unit dose contains a reduced amount or substantially no naive T cells.
  • a unit dose comprises (i) a composition comprising at least about 60% modified CD4+ T cells, combined with (ii) a composition comprising at least about 60% modified CD8+
  • a unit dose comprises (i) a composition comprising at least about 70% modified CD4+ T cells, combined with (ii) a composition comprising at least about 70% modified CD8+ T cells, in about a 1 : 1 ratio, wherein the unit dose contains a reduced amount or substantially no naive T cells.
  • a unit dose comprises (i) a composition comprising at least about 80% modified CD4+ T cells, combined with (ii) a composition comprising at least about 80% modified CD8+ T cells, in about a 1 : 1 ratio, wherein the unit dose contains a reduced amount or substantially no naive T cells.
  • a unit dose comprises (i) a composition comprising at least about 85% modified CD4+ T cells, combined with (ii) a composition comprising at least about 85% modified CD8+ T cells, in about a 1 : 1 ratio, wherein the unit dose contains a reduced amount or substantially no naive T cells.
  • a unit dose comprises (i) a composition comprising at least about 90% modified CD4+ T cells, combined with (ii) a composition comprising at least about 90% modified CD8+ T cells, in about a 1 : 1 ratio, wherein the unit dose contains a reduced amount or substantially no naive T cells.
  • a unit dose of the present disclosure may comprise a modified immune cell as described herein (i.e., expressing a binding protein specific for a WT-1 antigen according to SEQ ID NO:94) and a modified immune cell expressing a binding protein specific for a different antigen (e.g., a different WT-1 antigen (e.g, comprising SEQ ID NO.: 100), or an antigen from a different protein or target, such as, for example, BCMA, CD3, CEACAM6, c-Met, EGFR, EGFRvIII, ErbB2, ErbB3, ErbB4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, FLT1, KDR, FLT4, CD44v6, CD151, CA125, CEA, CTLA-4, GITR, BTLA, TGFBR2, TGFBR1, IL6R, gpl30, Lewis A, Lewis Y, TN
  • a unit dose can comprise modified CD8 + T cells expressing a binding protein that specifically binds to a WT- 1:HLA complex and modified CD4 + T cells (and/or modified CD8+ T cells) expressing a binding protein (e.g., a CAR) that specifically binds to a CD 19 antigen.
  • a binding protein e.g., a CAR
  • a unit dose comprises equal, or approximately equal, numbers of engineered CD45RA CD3 + CD8 + and modified CD45RA- CD3 + CD4 + TM cells.
  • a composition comprises (i) a modified immune cell as disclosed herein and further comprises (ii) an immune cell comprising a polynucleotide that encodes a binding protein that comprises a TCR Va and a TCR ⁇ b and is capable of specifically binding to a VLDFAPPGA (SEQ ID NO.:100):HLA complex, wherein, optionally, the HLA comprises HLA-A*0201, and wherein, optionally, the modified immune cell of (i) and the immune cell of (ii) are each independently selected from a T cell, aNK cell, andNK-T cell.
  • the binding protein of the immune cell in (ii) comprises: (a) CDRla, CDR2a, CDR3a, CDR 1 b, E0112b, and E0113b amino acid sequences of SEQ ID NOs.: 101-103 and 105-107, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 104 and/or (2) the nb has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 108; (b) CDRla, CDR2a, CDR3a, CDR 1 b, CDR2b, and CDR3b amino acid sequences of SEQ ID NOs.: 109-110 and 113-115, respectively, and wherein, optionally, (1) the Va has at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • the nb has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 116; or (c) CDRla, CDR2a, CDR3a, CDRip, CDR2p, and CDR3p amino acid sequences of SEQ ID NOs.: 117-119 and 121- 123, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 120 and/or (2) the nb has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO. : 124.
  • the instant disclosure is directed to methods for treating a disease or disorder associated with WT-1 expression by administering to human subject in need thereof an effective amount of a binding protein, polynucleotide, vector, cell, or composition according to any the presently disclosed embodiments.
  • Treat” or “treatment” or “ameliorate” refers to medical management of a disease, disorder, or condition of a subject (e.g., a human or a non-human mammal, such as a primate, horse, cat, dog, goat, mouse, or rat).
  • Therapeutic or prophylactic/preventive benefit includes improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay of disease progression; remission; survival; prolonged survival; or any combination thereof.
  • a “therapeutically effective amount” or “effective amount”, as used herein, refers to an amount of modified immune cells sufficient to result in a therapeutic effect, including improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay of disease progression; remission; survival; or prolonged survival in a statistically significant manner.
  • “statistically significant” refers to a p value of 0.050 or less when calculated using the Students t-test and indicates that it is unlikely that a particular event or result being measured has arisen by chance.
  • Subjects that can be treated according to methods of the present disclosure are, in general, human and other primate subjects, such as monkeys and apes for veterinary medicine and/or research purposes. Mice or rats can also be used for research purposes.
  • the subject may be a human subject.
  • the subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects.
  • Cells according to the present disclosure may be administered in a manner appropriate to the disease, condition, or disorder to be treated as determined by persons skilled in the medical art.
  • a modified immune cell or unit dose as described herein is administered intravenously, intraperitoneally, intratumorally, into the bone marrow, into a lymph node, or into the cerebrospinal fluid so as to encounter target cells (e.g ., leukemia cells).
  • target cells e.g ., leukemia cells.
  • An appropriate dose, suitable duration, and frequency of administration of the compositions will be determined by such factors as a condition of the patient; size, type, and severity of the disease, condition, or disorder; the particular form of the active ingredient; and the method of administration.
  • a therapeutically effective amount refers to the effects of that ingredient or cell expressing that ingredient alone.
  • a therapeutically effective amount refers to the combined amounts of active ingredients or combined adjunctive active ingredient with a cell expressing an active ingredient that results in a therapeutic effect, whether administered serially or simultaneously.
  • a combination may also be a cell expressing more than one active ingredient.
  • adoptive immune therapy refers to administration of naturally occurring or genetically engineered, disease- or antigen-specific immune cells (e.g., T cells).
  • adoptive cellular immunotherapy may be autologous (immune cells are from the recipient), allogeneic (immune cells are from a donor of the same species) or syngeneic (immune cells are from a donor genetically identical to the recipient).
  • a condition associated with WT-1 expression includes any disorder or condition in which underactivity, overactivity or improper activity of a WT-1 cellular or molecular event is present, and typically results from unusually high (with statistical significance) levels of WT-1 expression in afflicted cells (e.g ., leukemic cells), relative to normal cells.
  • afflicted cells e.g ., leukemic cells
  • a subject having such a disorder or condition would benefit from treatment with a composition or method of the presently described embodiments.
  • Some conditions associated with WT-1 overexpression thus may include acute as well as chronic disorders and diseases, such as those pathological conditions that predispose the subject to a particular disorder.
  • Diseases and disorders associated with WT-1 expression include the presence of dysplastic, cancerous and/or transformed cells in the subject, including, for example neoplastic, tumor, non-contact inhibited or oncogenically transformed cells, or the like (e.g., solid cancers; hematologic cancers including lymphomas and leukemias, such as acute myeloid leukemia, chronic myeloid leukemia, etc.), which are known in the art and for which criteria for diagnosis and classification are established (e.g, Hanahan and Weinberg, 2011 Cell 144:646; Hanahan and Weinberg 2000 Cell 100:57; Cavallo et ah, 2011 Cane. Immunol. Immunother. 60:319; Kyrigideis et ah, 2010 J.
  • dysplastic, cancerous and/or transformed cells in the subject including, for example neoplastic, tumor, non-contact inhibited or oncogenically transformed cells, or the like (e.g., solid cancers; hematologic cancers including lymph
  • cancer cells may be cells of acute myeloid leukemia, B-cell lymphoblastic leukemia, T-cell lymphoblastic leukemia, or myeloma, including cancer stem cells that are capable of initiating and serially transplanting any of these types of cancer (see, e.g., see Park et al. 2009 Molec. Therap. 17:219).
  • virtually any type of cancer that is characterized by WT-1 overexpression may be treated through the use of compositions and methods disclosed herein, including hematological cancers (e.g, leukemia including acute myeloid leukemia (AML), T or B cell lymphomas, myeloma, and others).
  • cancer may refer to any accelerated proliferation of cells, including solid tumors, ascites tumors, blood or lymph or other malignancies; connective tissue malignancies; metastatic disease; minimal residual disease following transplantation of organs or stem cells; multi-drug resistant cancers, primary or secondary malignancies, angiogenesis related to malignancy, or other forms of cancer. Also contemplated within the presently disclosed embodiments are specific embodiments wherein only one of the above types of disease is included, or where specific conditions may be excluded regardless of whether or not they are characterized by WT-1 overexpression.
  • conditions associated with WT-1 overexpression include hyperproliferative disorders and proliferative disorders in a subject including tumors, neoplasms, cancer, malignancy, etc.
  • a hyperproliferative or proliferative disorder may also include an aberration or dysregulation of cell death processes, whether by necrosis or apoptosis.
  • Such aberration of cell death processes may be associated with a variety of conditions, including cancer (including primary, secondary malignancies as well as metastasis), or other conditions.
  • hematological malignancies include acute lymphoblastic leukemia (ALL), acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloid leukemia (AML, including refractory and relapsed AML, and including acute myeloblastic leukemia, acute promyelocitic leukemia, acute myelocytic leukemia, acute myelomonocytic leukemia (e.g ., with or without eosinophilia), acute monocytic leukemia, acute erythroid leukemia, and acute megakaryoblastic leukemia), chronic myelogenous leukemia (CML), chronic myelocytic leukemia, chronic eosinophilic leukemia (CEL), myelodysplastic syndrome (MDS), non-Hodgkin's lymphoma (NHL), or multiple lymphoblastic leukemia (ALL), acute lymphocytic leukemia, acute myelocytic leukemia
  • a solid cancer such as biliary cancer, bladder cancer, bone and soft tissue carcinoma, brain tumor, breast cancer, breast carcinoma, cervical cancer, colon cancer, colorectal adenocarcinoma, colorectal cancer, desmoid tumor, embryonal cancer, endometrial cancer, esophageal cancer, gastric cancer, gastric adenocarcinoma, glioblastoma multiforme, glioblastoma, melanoma, diffuse peritoneal mesothelioma, malignant pleural mesothelioma, glioma, astrocytoma, gynecological tumor, head and neck squamous cell carcinoma, hepatic cancer, hepatocellular carcinoma, lung cancer, non small-cell lung cancer, malignant melanoma, osteosarcoma, ovarian cancer (e.g ., epithelial ovarian cancer, ovarian cancer (e.g ., epithelial ova
  • compositions that comprise a binding protein, polynucleotide, vector, host cell, and/or modified immune cell (optionally in combination with an immune cell encoding a binding protein that is capable of binding to a SEQ ID NO.: 100:HLA complex) for use according to any of the methods described herein.
  • Pharmaceutical compositions may be administered in a manner appropriate to the disease or condition to be treated (or prevented) as determined by persons skilled in the medical art.
  • An appropriate dose and a suitable duration and frequency of administration of the compositions will be determined by such factors as the health condition of the patient, size of the patient (i.e., weight, mass, or body area), the type and severity of the patient's condition, the particular form of the active ingredient, and the method of administration.
  • an appropriate dose and treatment regimen provide the composition(s) in an amount sufficient to provide therapeutic and/or prophylactic benefit (such as described herein, including an improved clinical outcome, such as more frequent complete or partial remissions, or longer disease-free and/or overall survival, or a lessening of symptom severity).
  • An effective amount of a pharmaceutical composition refers to an amount sufficient, at dosages and for periods of time needed, to achieve the desired clinical results or beneficial treatment, as described herein.
  • An effective amount may be delivered in one or more administrations. If the administration is to a subject already known or confirmed to have a disease or disease-state, the term "therapeutic amount” may be used in reference to treatment, whereas “prophylactically effective amount” may be used to describe administrating an effective amount to a subject that is susceptible or at risk of developing a disease or disease-state (e.g., recurrence) as a preventative course.
  • a disease or disease-state e.g., recurrence
  • a method comprises administering a modified immune cell as provided herein to a subject who has received, is receiving, or will receive an immune cell comprising a polynucleotide that encodes a binding protein that comprises a TCR Va and a TCR nb and is capable of specifically binding to a VLDFAPPGA (SEQ ID NO.:100):HLA complex, wherein, optionally, the HLA comprises HLA- A*0201, and wherein, optionally, the modified immune cell and the immune cell are each independently selected from a T cell, a NK cell, and NK-T cell.
  • an immune cell comprising a polynucleotide that encodes a binding protein that comprises a TCR Va and a TCR nb and is capable of specifically binding to a VLDFAPPGA (SEQ ID NO.:100):HLA complex, wherein, optionally, the HLA comprises HLA- A*0201, and wherein, optionally, the modified immune cell and the immune cell are each independently selected from
  • the binding protein that is capable of specifically binding to the VLDFAPPGA (SEQ ID NO.:100):HLA complex comprises: (a) CDRla, CDR2a, CDR3a, CDRip, CDR2p, and CDR3p amino acid sequences of SEQ ID NOs.:101-103 and 105-107, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 104 and/or (2) the nb has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 108;
  • an appropriate dosage and treatment regimen provides the active molecules or cells in an amount sufficient to provide a benefit.
  • a response can be monitored by establishing an improved clinical outcome (e.g., more frequent remissions, complete or partial, or longer disease-free survival) in treated subjects as compared to non-treated subjects.
  • Increases in preexisting immune responses to a tumor protein generally correlate with an improved clinical outcome.
  • Such immune responses may generally be evaluated using standard proliferation, cytotoxicity or cytokine assays, which are routine in the art and may be performed using samples obtained from a subject before and after treatment.
  • a dose should be sufficient to prevent, delay the onset of, or diminish the severity of a disease associated with disease or disorder.
  • Prophylactic benefit of the compositions administered according to the methods described herein can be determined by performing pre-clinical (including in vitro and in vivo animal studies) and clinical studies and analyzing data obtained therefrom by appropriate statistical, biological, and clinical methods and techniques, all of which can readily be practiced by a person skilled in the art.
  • Certain methods of treatment or prevention contemplated herein include administering a host cell (which may be autologous, allogeneic or syngeneic) comprising a desired nucleic acid molecule as described herein that is stably integrated into the chromosome of the cell, or is present as an extrachromosomal nucleic acid molecule.
  • a host cell which may be autologous, allogeneic or syngeneic
  • a cellular composition may be generated ex vivo using autologous, allogeneic or syngeneic immune system cells (e.g T cells, antigen-presenting cells, natural killer cells) in order to administer a desired, WT-1 -targeted T-cell composition to a subject as an adoptive immunotherapy.
  • the immune cell is a CD4 + T cell, a CD8 + T cell, a CD4 CD8 double negative T cell, a gd T cell, a natural killer cell, a dendritic cell, or any combination thereof.
  • the immune cell is a naive T cell, a central memory T cell, an effector memory T cell, or any combination thereof.
  • the amount of cells in a composition or unit dose is at least one cell (for example, one modified CD8 + T cell subpopulation (e.g., optionally comprising memory and/or naive CD8 + T cells); one modified CD4 + T cell subpopulation (e.g, optionally comprising memory and/or naive CD4 + T cells)) or is more typically greater than 10 2 cells, for example, up to 10 4 , up to 10 5 , up to 10 6 , up to 10 7 , up to 10 8 , up to 10 9 , up to 10 10 , or up to 10 11 cells.
  • one modified CD8 + T cell subpopulation e.g., optionally comprising memory and/or naive CD8 + T cells
  • one modified CD4 + T cell subpopulation e.g. comprising memory and/or naive CD4 + T cells
  • the cells are administered in a range from about 10 4 to about 10 11 cells/m 2 , preferably in a range of about 10 5 to about 10 9 cells/m 2 .
  • an administered dose comprises up to about 3.3 x 10 5 cells/kg.
  • an administered dose comprises up to about 1 x 10 6 cells/kg.
  • an administered dose comprises up to about 3.3 x 10 6 cells/kg.
  • an administered dose comprises up to about 1 x 10 7 cells/kg.
  • a modified immune cell is administered to a subject at a dose comprising up to about 5 x 10 4 cells/kg, 5 x 10 5 cells/kg, 5 x 10 6 cells/kg, or up to about 5 x 10 7 cells/kg. In certain embodiments, a modified immune cell is administered to a subject at a dose comprising at least about 5 x 10 4 cells/kg, 5 x 10 5 cells/kg, 5 x 10 6 cells/kg, or up to about 5 x 10 7 cells/kg. The number of cells will depend upon the ultimate use for which the composition is intended as well the type of cells included therein.
  • cells modified to contain a binding protein will comprise a cell population containing at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of such cells.
  • cells are generally in a volume of a liter or less, 500 mis or less, 250 mis or less, or 100 mis or less.
  • the density of the desired cells is typically greater than 10 4 cells/ml and generally is greater than 10 7 cells/ml, generally 10 8 cells/ml or greater.
  • the cells may be administered as a single infusion or in multiple infusions over a range of time.
  • a clinically relevant number of immune cells can be apportioned into multiple infusions that cumulatively equal or exceed 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , or 10 11 cells.
  • a unit dose of the modified immune cells can be co administered with ( e.g ., simultaneously or contemporaneously with) hematopoietic stem cells from an allogeneic donor.
  • one or more of the modified immune cells comprised in the unit dose is autologous to the subject.
  • compositions described herein may be presented in unit- dose or multi-dose containers, such as sealed ampoules or vials. Such containers may be frozen to preserve the stability of the formulation until use.
  • a unit dose comprises a recombinant host cell as described herein at a dose of about 10 4 cells/m 2 to about 10 11 cells/m 2 .
  • a pharmaceutical composition that comprises a modified immune cell as disclosed herein further comprises a pharmaceutically acceptable carrier, diluent, or excipient.
  • pharmaceutically acceptable excipient or carrier or “physiologically acceptable excipient or carrier” refer to biologically compatible vehicles, e.g., physiological saline, which are described in greater detail herein, that are suitable for administration to a human or other non-human mammalian subject and generally recognized as safe or not causing a serious adverse event.
  • Suitable excipients include water, saline, dextrose, glycerol, or the like and combinations thereof.
  • compositions comprising fusion proteins or host cells as disclosed herein further comprise a suitable infusion media.
  • suitable infusion media can be any isotonic medium formulation, typically normal saline, Normosol R (Abbott) or Plasma-Lyte A (Baxter), 5% dextrose in water, Ringer's lactate can be utilized.
  • An infusion medium can be supplemented with human serum albumin or other human serum components.
  • the composition may also include sterile aqueous or oleaginous solution or suspension.
  • suitable non-toxic parenterally acceptable diluents or solvents include water, Ringer’s solution, isotonic salt solution, 1,3-butanediol, ethanol, propylene glycol or polythethylene glycols in mixtures with water.
  • Aqueous solutions or suspensions may further comprise one or more buffering agents, such as sodium acetate, sodium citrate, sodium borate or sodium tartrate.
  • any material used in preparing any dosage unit formulation should be pharmaceutically pure and substantially non-toxic in the amounts employed.
  • the active compounds may be incorporated into sustained-release preparation and formulations.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit may contain a predetermined quantity of recombinant cells or active compound calculated to produce the desired therapeutic effect in association with an appropriate pharmaceutical carrier.
  • administration of a composition or therapy refers to delivering the same to a subject, regardless of the route or mode of delivery. Administration may be effected continuously or intermittently, and parenterally. Administration may be for treating a subject already confirmed as having a recognized condition, disease or disease state, or for treating a subject susceptible to or at risk of developing such a condition, disease or disease state.
  • Co-administration with an adjunctive therapy may include simultaneous and/or sequential delivery of multiple agents in any order and on any dosing schedule (e.g ., modified immune cells with one or more cytokines; immunosuppressive therapy such as calcineurin inhibitors, corticosteroids, microtubule inhibitors, low dose of a mycophenolic acid prodrug, or any combination thereof).
  • a plurality of doses of a modified immune cell or binding protein as described herein is administered to the subject, which may be administered at intervals between administrations of about two to about four weeks.
  • a cytokine is administered sequentially, provided that the subject was administered the modified immune cell at least three or four times before cytokine administration.
  • the cytokine is administered subcutaneously (e.g., IL-2, IL-15, IL-21).
  • the subject being treated is further receiving immunosuppressive therapy, such as calcineurin inhibitors, corticosteroids, microtubule inhibitors, low dose of a mycophenolic acid prodrug, or any combination thereof.
  • Treatment or prevention methods of this disclosure may be administered to a subject as part of a treatment course or regimen, which may comprise additional treatments prior to, or after, administration of the instantly disclosed unit doses, cells, or compositions.
  • a subject receiving a unit dose of the modified immune cell is receiving or had previously received a hematopoietic cell transplant (HCT; including myeloablative and non-myeloablative HCT).
  • HCT hematopoietic cell transplant
  • the modified immune cell may be administered at least two to at least three months after the non-myeloablative hematopoietic cell transplant.
  • a modified immune cell of the present disclosure can be administered with or shortly after hematopoietic stem cells in a modified HCT therapy.
  • the HCT comprises a donor hematopoieitic cell comprising a chromosomal knockout of a gene that encodes an HLA component, a chromosomal knockout of a gene that encodes a TCR component, or both.
  • the subject receiving the modified immune cell or binding protein has previously received lymphodepleting chemotherapy.
  • the lymphodepleting chemotherapy comprises cyclophosphamide, fludarabine, anti -thymocyte globulin, or a combination thereof.
  • the subject has previously received therapy for AML, or is at-risk for developing or progressing AML.
  • Methods according to this disclosure may further include administering one or more additional agents to treat the disease or disorder in a combination therapy.
  • the method further comprises administering a modified immune cell or binding protein with (concurrently, simultaneously, or sequentially) an immune checkpoint inhibitor.
  • the method comprises administering a modified immune cell with an agonist of a stimulatory immune checkpoint agent.
  • a combination therapy comprises administering a modified immune cell with a secondary therapy, such as a chemotherapeutic agent, a radiation therapy, a surgery, an antibody, or any combination thereof.
  • immune suppression agent refers to one or more cells, proteins, molecules, compounds or complexes providing inhibitory signals to assist in controlling or suppressing an immune response.
  • immune suppression agents include those molecules that partially or totally block immune stimulation; decrease, prevent or delay immune activation; or increase, activate, or up regulate immune suppression.
  • immunosuppression agents to target include PD-1, PD-L1, PD- L2, LAG3, CTLA4, B7-H3, B7-H4, CD244/2B4, HVEM, BTLA, CD160, TIM3, GAL9, KIR, PVR1G (CD112R), PVRL2, adenosine, A2aR, immunosuppressive cytokines (e.g, IL-10, IL-4, IL-1RA, IL-35), IDO, arginase, VISTA, TIGIT, LAIR1, CEACAM-1, CEACAM-3, CEACAM-5, Treg cells, or any combination thereof.
  • cytokines e.g, IL-10, IL-4, IL-1RA, IL-35
  • IDO arginase
  • VISTA TIGIT
  • LAIR1 CEACAM-1
  • CEACAM-3 CEACAM-5
  • Treg cells or any combination thereof.
  • An immune suppression agent inhibitor may be a compound, an antibody, an antibody fragment or fusion polypeptide (e.g., Fc fusion, such as CTLA4-Fc or LAG3-Fc), an antisense molecule, a ribozyme or RNAi molecule, or a low molecular weight organic molecule.
  • a method may comprise a modified immune cell or binding protein with one or more inhibitor of any one of the following immune suppression components, singly or in any combination.
  • a modified immune cell or binding protein is used in combination with a PD-1 inhibitor, for example a PD- 1 -specific antibody or binding fragment thereof, such as pidilizumab, nivolumab, pembrolizumab, MEDI0680 (formerly AMP-514), AMP-224, BMS-936558 or any combination thereof.
  • a modified immune cell or binding protein of the present disclosure is used in combination with a PD-L1 specific antibody or binding fragment thereof, such as BMS-936559, durvalumab (MEDI4736), atezolizumab (RG7446), avelumab (MSB0010718C), MPDL3280A, or any combination thereof.
  • a modified immune cell or binding protein of the present disclosure is used in combination with a LAG3 inhibitor, such as LAG525, IMP321, IMP701, 9H12, BMS-986016, or any combination thereof.
  • a LAG3 inhibitor such as LAG525, IMP321, IMP701, 9H12, BMS-986016, or any combination thereof.
  • a modified immune cell or binding protein is used in combination with an inhibitor of CTLA4.
  • a modified immune cell or binding protein is used in combination with a CTLA4 specific antibody or binding fragment thereof, such as ipilimumab, tremelimumab, CTLA4-Ig fusion proteins (e.g., abatacept, belatacept), or any combination thereof.
  • a modified immune cell or binding protein is used in combination with a B7-H3 specific antibody or binding fragment thereof, such as enoblituzumab (MGA271), 376.96, or both.
  • a B7-H4 antibody binding fragment may be a scFv or fusion protein thereof, as described in, for example, Dangaj et al., Cancer Res. 73:4820, 2013, as well as those described in U.S. Patent No. 9,574,000 and PCT Patent Publication Nos. WO /201740724A1 and WO 2013/025779A1.
  • a modified immune cell or binding protein is used in combination with an inhibitor of CD244.
  • a modified immune cell or binding protein is used in combination with an inhibitor of BLTA, HVEM, CD 160, or any combination thereof.
  • Anti CD-160 antibodies are described in, for example, PCT Publication No. WO 2010/084158.
  • a modified immune cell or binding protein is used in combination with an inhibitor of TIM3.
  • a modified immune cell or binding protein is used in combination with an inhibitor of Gal9.
  • a modified immune cell or binding protein is used in combination with an inhibitor of adenosine signaling, such as a decoy adenosine receptor.
  • a modified immune cell or binding protein is used in combination with an inhibitor of A2aR.
  • a modified immune cell or binding protein is used in combination with an inhibitor of KIR, such as lirilumab (BMS-986015).
  • a modified immune cell is used in combination with an inhibitor of an inhibitory cytokine (typically, a cytokine other than TGFP) or Treg development or activity.
  • an inhibitory cytokine typically, a cytokine other than TGFP
  • Treg development or activity typically, a cytokine other than TGFP
  • a modified immune cell or binding protein is used in combination with an IDO inhibitor, such as levo-1 -methyl tryptophan, epacadostat (INCB024360; Liu et ah, Blood 115:3520-30, 2010), ebselen (Terentis et al. , Biochem. 49:591-600, 2010), indoximod, NLG919 (Mautino et al., American Association for Cancer Research 104th Annual Meeting 2013; Apr 6-10, 2013), 1 -methyl -tryptophan (l-MT)-tira-pazamine, or any combination thereof.
  • an IDO inhibitor such as levo-1 -methyl tryptophan, epacadostat (INCB024360; Liu et ah, Blood 115:3520-30, 2010), ebselen (Terentis et al. , Biochem. 49:591-600, 2010), indoximod, NLG919 (Mau
  • a modified immune cell or binding protein is used in combination with an arginase inhibitor, such as N(omega)-Nitro-L-arginine methyl ester (L-NAME), N-omega-hydroxy-nor-l-arginine (nor-NOHA), L-NOHA, 2(S)- amino-6-boronohexanoic acid (ABH), S-(2-boronoethyl)-L-cysteine (BEC), or any combination thereof.
  • an arginase inhibitor such as N(omega)-Nitro-L-arginine methyl ester (L-NAME), N-omega-hydroxy-nor-l-arginine (nor-NOHA), L-NOHA, 2(S)- amino-6-boronohexanoic acid (ABH), S-(2-boronoethyl)-L-cysteine (BEC), or any combination thereof.
  • a modified immune cell or binding protein is used in combination with an inhibitor of VISTA, such as CA-170 (Curis, Lexington, Mass.).
  • a modified immune cell is used in combination with an inhibitor of TIGIT such as, for example, COM902 (Compugen, Toronto, Ontario Canada), an inhibitor of CD155, such as, for example, COM701 (Compugen), or both.
  • a modified immune cell or binding protein is used in combination with an inhibitor of PVRIG, PVRL2, or both.
  • Anti-PVRIG antibodies are described in, for example, PCT Publication No. WO 2016/134333.
  • Anti-PVRL2 antibodies are described in, for example, PCT Publication No. WO 2017/021526.
  • an modified immune cell or binding protein is used in combination with a LAIR1 inhibitor.
  • a modified immune cell or binding protein is used in combination with an inhibitor of CEACAM-1, CEAC AM-3, CEAC AM-5, or any combination thereof.
  • a modified immune cell or binding protein is used in combination with an agent that increases the activity (i.e., is an agonist) of a stimulatory immune checkpoint molecule.
  • an modified immune cell or binding protein can be used in combination with a CD137 (4-1BB) agonist (such as, for example, urelumab), a CD 134 (OX-40) agonist (such as, for example, MEDI6469, MEDI6383, or MEDI0562), lenalidomide, pomalidomide, a CD27 agonist (such as, for example, CDX-1127), a CD28 agonist (such as, for example, TGN1412, CD80, or CD86), a CD40 agonist (such as, for example, CP-870,893, rhuCD40L, or SGN-40), a CD122 agonist (such as, for example, IL-2) an agonist of GITR (such as, for example, humanized monoclonal antibodies described in PCT Patent Publication No
  • a method may comprise administering a modified immune cell or binding protein with one or more agonist of a stimulatory immune checkpoint molecule, including any of the foregoing, singly or in any combination.
  • a combination therapy comprises a modified immune cell or binding protein and a secondary therapy comprising one or more of: an antibody or antigen binding-fragment thereof that is specific for a cancer antigen expressed by the non-inflamed solid tumor, a radiation treatment, a surgery, a chemotherapeutic agent, a cytokine, RNAi, or any combination thereof.
  • a combination therapy method comprises administering a modified immune cell or binding protein and further administering a radiation treatment or a surgery.
  • Radiation therapy is well-known in the art and includes X-ray therapies, such as gamma-irradiation, and radiopharmaceutical therapies.
  • Surgeries and surgical techniques appropriate to treating a given cancer in a subject are well-known to those of ordinary skill in the art.
  • a combination therapy method comprises administering a modified immune cell or binding protein and further administering a chemotherapeutic agent.
  • a chemotherapeutic agent includes, but is not limited to, an inhibitor of chromatin function, a topoisomerase inhibitor, a microtubule inhibiting drug, a DNA damaging agent, an antimetabolite (such as folate antagonists, pyrimidine analogs, purine analogs, and sugar-modified analogs), a DNA synthesis inhibitor, a DNA interactive agent (such as an intercalating agent), and a DNA repair inhibitor.
  • Illustrative chemotherapeutic agents include, without limitation, the following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2- chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracyclines, bleomycin, busul
  • Cytokines may be used to manipulate host immune response towards anticancer activity. See, e.g., Floras & Tarhini, Semin. Oncol. 42(4):539-548, 2015. Cytokines useful for promoting immune anticancer or antitumor response include, for example, IFN-a, IL-2, IL-3, IL-4, IL-10, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-21, IL-24, and GM-CSF, singly or in any combination with a modified immune cell or binding protein of this disclosure. In still further aspects, methods are provided for manufacturing a composition of the present disclosure.
  • the methods comprise combining (i) an aliquot of a host cell transduced with a vector of the present disclosure with (ii) a pharmaceutically acceptable carrier.
  • vectors of the present disclosure are used to transfect/transduce a host cell (e.g., a T cell) for use in adoptive transfer therapy (e.g., targeting a cancer antigen).
  • the methods further comprise, prior to the aliquotting, culturing the transduced host cell and selecting the transduced cell as having incorporated (i.e., expressing) the vector.
  • the methods comprise, following the culturing and selection and prior to the aliquotting, expanding the transduced host cell.
  • the manufactured composition or unit dose may be frozen for later use. Any appropriate host cell can be used for manufacturing a composition or unit dose according to the instant methods, including, for example, a hematopoietic stem cell, a T cell, a primary T cell, a T cell line, a NK cell, or a NK-T cell.
  • the methods comprise a host cell which is a CD8+ T cell, a CD4+ T cell, or both.
  • the present disclosure also includes the following exemplary embodiments.
  • Embodiment 1 A modified immune cell, comprising a heterologous polynucleotide that encodes a binding protein, wherein the encoded binding protein comprises: (a) a T cell receptor (TCR) a chain variable (Va) domain comprising the CDR3 amino acid sequence (CDR3a) according to any one of SEQ ID NOs.:28, 19, 22, or 25, or a variant thereof, and a TCR b-chain variable (nb) domain; or (b)a TCR nb domain comprising the CDR3 amino acid sequence (CDR3b) according to any one of SEQ ID NOs.:40, 31, 34, or 37, or a variant thereof, and a TCR Va domain; or (c) a TCR Va domain of (a), and a TCR nb domain of (b), wherein the encoded binding protein is capable of binding to a RMFPNAPYL (SEQ ID NO.:94):human leukocyte antigen (HLA), wherein, optionally, the HLA comprises
  • Embodiment 2 The modified immune cell of embodiment 1, wherein the encoded binding protein is capable of binding to the RMFPNAPYL (SEQ ID NO.:94):HLA complex with an IFNy production pECso of 4.0 or higher, or 4.5 or higher.
  • Embodiment 3 The modified immune cell of embodiment 1 or 2, wherein the encoded binding protein is capable of binding to the RMFPNAPYL (SEQ ID NO.:94): HLA complex with an IFNy production pECso of 5.0 or higher.
  • Embodiment 4 The modified immune cell of any one of embodiments 1-
  • the encoded binding protein is capable of binding to the RMFPNAPYL (SEQ ID NO.:94): HLA complex with an IFNy production pECso of 5.5 or higher.
  • Embodiment 5 The modified immune cell of any one of embodiments 1-
  • the encoded binding protein is capable of binding to the RMFPNAPYL (SEQ ID NO.:94): HLA complex with an IFNy production pECso of 6.0 or higher.
  • Embodiment 6 The modified immune cell of any one of embodiments 1-
  • the encoded binding protein is capable of binding to the RMFPNAPYL (SEQ ID NO.:94): HLA complex with an IFNy production pECso of 6.5 or higher.
  • Embodiment 7 The modified immune cell of any one of embodiments 1-
  • HLA comprises HLA-A*201.
  • Embodiment 8 The modified immune cell of any one of embodiments 1-
  • modified immune cells in a population produce IFN-g when the population of the modified immune cells is co-cultured for 4 hours with antigen-presenting cells (e.g ., HLA-A*0201+) pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 4 mM, 10 5 pM, or 10 6 pM in the co-culture, wherein the antigen- presenting cells optionally comprise T2 cells.
  • antigen-presenting cells e.g ., HLA-A*0201+
  • Embodiment 9 The modified immune cell of any one of embodiments 1-
  • Embodiment 10 The modified immune cell of embodiment 9, wherein 15% or more of the modified immune cells in the population are Nur77 + when the population of the modified immune cells is co-cultured (e.g, for about 24 hours) with antigen-presenting cells pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 2 mM in the co-culture.
  • a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 2 mM in the co-culture.
  • Embodiment 11 The modified immune cell of embodiment 9 or 10, wherein 20% or more of the modified immune cells in the population are Nur77 + when the population of the modified immune cells is co-cultured ( e.g ., for about 24 hours) with antigen-presenting cells pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.: 94) at a peptide concentration of 10 2 mM in the co-culture.
  • a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.: 94) at a peptide concentration of 10 2 mM in the co-culture.
  • Embodiment 12 The modified immune cell of any one of embodiments 9-
  • Embodiment 13 The modified immune cell of any one of embodiments 9-
  • Embodiment 14 The modified immune cell of any one of embodiments 1-
  • Embodiment 15 The modified immune cell of embodiment 14, wherein 15% or more of the modified immune cells in the population are Nur77 + when the population of the modified immune cells is co-cultured (e.g, for about 24 hours) with antigen-presenting cells pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 3 mM in the co-culture.
  • a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO.:94) at a peptide concentration of 10 3 mM in the co-culture.
  • Embodiment 16 The modified immune cell of embodiment 14 or 15, wherein 20% or more of the modified immune cells in the population are Nur77 + when the population of the modified immune cells is co-cultured ( e.g ., for about 24 hours) with antigen-presenting cells pulsed with a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO: 94) at a peptide concentration of about 10 3 mM in the co-culture.
  • a peptide comprising or consisting of the amino acid sequence RMFPNAPYL (SEQ ID NO: 94) at a peptide concentration of about 10 3 mM in the co-culture.
  • Embodiment 17 The modified immune cell of any one of embodiments 1- 16, wherein the modified immune cell is capable of killing 11% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 30: 1.
  • Embodiment 18 The modified immune cell of embodiment 17, wherein the modified immune cell is capable of killing 12% or more of HLA-A*0201 + MDA- MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 30: 1.
  • Embodiment 19 The modified immune cell of embodiment 17 or 18, wherein the modified immune cell is capable of killing 14% or more of HLA-A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB- 468 cells are present in the sample at a ratio of 30: 1.
  • Embodiment 20 The modified immune cell of any one of embodiments 17-19, wherein the modified immune cell is capable of killing 15% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 30: 1.
  • Embodiment 21 The modified immune cell of any one of embodiments 17-20, wherein the modified immune cell is capable of killing 20% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 30: 1.
  • Embodiment 22 The modified immune cell of any one of embodiments 17-21, wherein the modified immune cell is capable of killing 25% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 30: 1.
  • Embodiment 23 The modified immune cell of any one of embodiments 1-
  • the modified immune cell is capable of killing 10% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 10: 1.
  • Embodiment 24 The modified immune cell of any one of embodiments 1-
  • the modified immune cell is capable of killing about 5% or more of HLA- A*0201 + MDA-MB-468 cells in a sample when the modified immune cell and the MDA-MB-468 cells are present in the sample at a ratio of 1 : 1.
  • Embodiment 25 The modified immune cell of any one of embodiments 1-
  • the modified immune cell is capable of killing 21% or more of Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 30:1.
  • Embodiment 26 The modified immune cell of embodiment 25, wherein the modified immune cell is capable of killing 22% or more of Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 30: 1.
  • Embodiment 27 The modified immune cell of embodiment 25 or 26, wherein the modified immune cell is capable of killing 23% or more of Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 30:1.
  • Embodiment 28 The modified immune cell of any one of embodiments 25-27, wherein the modified immune cell is capable of killing 24% or more of Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 30:1.
  • Embodiment 29 The modified immune cell of any one of embodiments 25-28, wherein the modified immune cell is capable of killing 25% or more of Panel cells in a sample when the modified immune cell and the Panel cells are present at a ratio of 30:1.
  • Embodiment 30 The modified immune cell of any one of embodiments 1- 29, wherein the modified immune cell has increased killing activity against ELLA- A*0201 + MDA-MB-468 cells and/or against Panel cells in a 4-hour co-culture as compared to a reference immune cell comprising a polynucleotide that encodes a T cell receptor comprising a TCRa chain having the amino acid sequence set forth in SEQ ID NO.: 82 and a TCRP chain having the amino acid sequence set forth in SEQ ID NO.: 83.
  • Embodiment 31 The modified immune cell of any one of embodiments 1-
  • the encoded binding protein is capable of binding to a WT-1 peptide:HLA complex on a cell surface independent of CD8 or in the absence of CD8.
  • Embodiment 32 The modified immune cell of any one of embodiments 1-
  • the encoded nb domain comprises or consists of an amino acid sequence having at least 90% identity to the amino acid sequence of any one of SEQ ID NOs.:16, 5, 6, 7, 8, 13, 14, or 15; and/or (ii) the encoded Va domain comprises or consists of an amino acid sequence having at least 90% identity to the amino acid sequence of any one of SEQ ID NOs.:12, 1, 2, 3, 4, 9, 10, or 11.
  • Embodiment 33 The modified immune cell of any one of embodiments 1-
  • the encoded nb domain comprises or consists of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs.: 16, 5, 6, 7, 8, 13, 14, or 15, and/or the encoded Va domain comprises or consists of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs.: 12, 1, 2, 3, 4, 9, 10, or 11, provided that: (i)at least three or four of the CDRs have no mutations; (ii) the CDRs that do have mutations have only up to two amino acid substitutions, up to a contiguous five amino acid deletion, or a combination thereof; and (iii) the encoded binding protein retains its ability to bind to a RMFPNAPYL (SEQ ID NO.:94):HLA complex, optionally with an interferon-gamma (IFNy) production pEC50 of 4.0, 4.5, 5.0. 5.1, 5.2., 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1,
  • Embodiment 34 The modified immune cell of any one of embodiments 1-
  • the encoded O ⁇ E3b comprises or consists of the amino acid sequence set forth in SEQ ID NO.:40, and the encoded CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO.:28;
  • the encoded O ⁇ E3b comprises or consists of the amino acid sequence set forth in SEQ ID NO: 31, and the encoded CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 19;
  • the encoded O ⁇ E3b comprises or consists of the amino acid sequence set forth in SEQ ID NO: 34, and the encoded CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 22;
  • the encoded CDR3P comprises or consists of the amino acid sequence set forth in SEQ ID NO: 37, and the encoded CDR3a comprises or consists of the amino acid sequence set forth in SEQ ID NO: 25.
  • Embodiment 35 The modified immune cell of any one of embodiments 1-
  • the encoded nb domain comprises the CDRip amino acid sequence of any one of SEQ ID NOs.:38, 29, 32, or 35 and/or the CDR2P amino acid sequence of any one of SEQ ID NOs.: 39, 30, 33, or 36; and/or (ii) the encoded Va domain comprises the CDRla amino acid sequence of any one of SEQ ID NOs.:26, 17, 20, or
  • Embodiment 36 The modified immune cell of any one of embodiments 1-
  • the encoded TCR Va and nb domains comprise CDRla, CDR2a, CDR3a, CDR ⁇ , CDR ⁇ , and CDR3b amino acid sequences of: (i) SEQ ID NOs.:26-28 and 38-40, respectively; (ii) SEQ ID NOs.:23, 27, 28, and 38-40, respectively; (iii) SEQ ID NOs.: 17-19 and 29-31, respectively; (iv) SEQ ID NOs.: 20-22 and 32-34, respectively; or (v) SEQ ID NOs.: 23-25 and 35-37, respectively.
  • Embodiment 37 The modified immune cell of any one of embodiments 1-
  • the encoded TCR nb domain comprises: (i) an amino acid sequence according to a TRBJ02-03 gene segment; and/or (ii)an amino acid sequence according to a TRBV06-05 gene segment, an amino acid sequence according to a TRBV07-09 gene segment, or an amino acid sequence according to a TRBV20-01 gene segment.
  • Embodiment 38 The modified immune cell of any one of embodiments 1-
  • the encoded TCR Va domain comprises: (i) an amino acid sequence according to a TRAJ43 gene segment; and/or (ii) an amino acid sequence according to a TRAV20-02 gene segment; an amino acid sequence according to a TRAV38DV08 gene segment; or an amino acid sequence according to a TRAV38-01 gene segment.
  • Embodiment 39 The modified immune cell of embodiment 38, wherein:
  • the encoded TCR nb domain comprises an amino acid sequence according to a TRBJ02-03 gene segment; and (ii) the encoded TCR Va domain comprises an amino acid sequence according to a TRAJ43 gene segment.
  • Embodiment 40 The modified immune cell of embodiment 38, wherein: (i) the encoded TCR nb domain comprises an amino acid sequence according to a TRBV06-05 gene segment; and (ii) the encoded TCR Va domain comprises an amino acid sequence according to a TRAV20 gene segment.
  • Embodiment 41 The modified immune cell of embodiment 38, wherein: (i) the encoded TCR nb domain comprises an amino acid sequence according to a TRBV07-09 gene segment; and (ii) the encoded TCR Va domain comprises an amino acid sequence according to a TRAV38DV08 gene segment.
  • Embodiment 42 The modified immune cell of embodiment 38, wherein: (i) the encoded TCR nb domain comprises an amino acid sequence according to a TRBV20-01 gene segment; and (ii) the encoded TCR Va domain comprises an amino acid sequence according to a TRAV38-01 gene segment.
  • Embodiment 43 The modified immune cell of any one of embodiments 1-
  • the encoded nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 16 or 8 and the encoded Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 12 or 4;
  • the encoded nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 13 or 5, and the encoded Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.:9 or 1;
  • the encoded nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 14 or 6, and the encoded Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 10 or 2; or
  • the encoded nb domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 15 or 7, and the encoded Va domain comprises or consists of the amino acid sequence set forth in SEQ ID NO.: 11 or 3.
  • Embodiment 44 The modified immune cell of any one of embodiments 1-
  • the encoded binding protein further comprises: (i) a TCR a chain constant domain (Ca), or a fragment thereof; and/or (ii) a TCR b chain constant domain (C/b), or a fragment thereof.
  • Embodiment 45 The modified immune cell of embodiment 44, wherein the encoded Ca comprises or consists of an amino acid sequence having at least 90% identity to any one of SEQ ID NOs.:41-44.
  • Embodiment 46 The modified immune cell of embodiment 44 or 45, wherein the encoded Ob comprises or consists of an amino acid sequence having at least 90% identity to SEQ ID NO.:45.
  • Embodiment 47 The modified immune cell of any one of embodiments 44-46, wherein the encoded binding protein comprises: (i) a TCR b chain having at least 90% identity to, comprising, or consisting of the amino acid sequence set forth in SEQ ID NO.:61 or 57, and a TCR a chain having at least 90% identity to, comprising, or consisting of the amino acid sequence set forth in SEQ ID NO.:53 or 49; (ii) a TCR b chain having at least 90% identity to, comprising, or consisting of the amino acid sequence set forth in SEQ ID NO:.58 or 54, and a TCR a chain having at least 90% identity to, comprising, or consisting of the amino acid sequence set forth in SEQ ID NO:.50 or 46; (iii) a TCR b chain having at least 90% identity to, comprising, or consisting of the amino acid sequence set forth in SEQ ID NO.:59 or 55, and a TCR a chain having at least 90% identity to, comprising, or consisting
  • Embodiment 48 The modified immune cell of any one of embodiments 1-
  • the encoded binding protein is a TCR, a chimeric antigen receptor (CAR), or a single-chain TCR (scTCR).
  • Embodiment 49 The modified immune cell of any one of embodiments 1-
  • the immune cell is a human immune system cell.
  • Embodiment 50 The modified immune cell of any one of embodiments 1-
  • the immune cell is a T cell, optionally a CD4 + T cell, a CD8 + T cell, a CD4 CD8 double negative T cell, or a gd T cell, a natural killer cell, a NK-T cell, a dendritic cell, or any combination thereof.
  • Embodiment 51 The modified immune cell of embodiment 50, wherein the T cell is a naive T cell, a central memory T cell, an effector memory T cell, a stem cell memory T cell, or any combination thereof.
  • Embodiment 52 The modified immune cell of any one of embodiments 1-
  • polynucleotide encoding the binding protein is codon-optimized for expression in the immune cell.
  • Embodiment 53 The modified immune cell of any one of embodiments 1-
  • polynucleotide encoding the binding protein comprises a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in any one of SEQ ID NOs.:62-77.
  • Embodiment 54 The modified immune cell of embodiment 53, wherein the polynucleotide encoding the binding protein comprises: (i) a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO.:77, and a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO.:69; (ii) a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO.:74, and a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO.:66; (iii) a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in SEQ ID NO.:75, and a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in
  • Embodiment 55 The modified immune cell of any one of embodiments 1- 54, wherein the polynucleotide encoding a binding protein further comprises a polynucleotide encoding a self-cleaving peptide disposed between the nb-encoding polynucleotide and the Va-encoding polynucleotide.
  • Embodiment 56 The modified immune cell of embodiment 55, wherein the encoded self-cleaving peptide comprises or consists of an amino acid sequence having at least 90% identity to the amino acid sequence set forth in any one of SEQ ID NOs.:84-88.
  • Embodiment 57 The modified immune cell of embodiment 55 or 56, wherein the polynucleotide encoding a self-cleaving peptide comprises or consists of a polynucleotide sequence having at least 75% identity to the polynucleotide sequence set forth in any one of SEQ ID NOs.: 89-93.
  • Embodiment 59 The modified immune cell any one of embodiments 55- 58, wherein the polynucleotide encoding a binding protein comprises a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in any one of SEQ ID NOs.:78-81.
  • Embodiment 60 The modified immune cell of embodiment 53, wherein the polynucleotide encoding a binding protein comprises a polynucleotide comprising or consisting of the polynucleotide sequence set forth in any one of SEQ ID NOs.:78- 81.
  • Embodiment 61 The modified immune cell of any one of embodiments 1- 60, further comprising: (i) a heterologous polynucleotide encoding a polypeptide that comprises an extracellular portion of a CD8 co-receptor a chain, wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor a chain; (ii) a heterologous polynucleotide encoding a polypeptide that comprises an extracellular portion of a CD8 co-receptor b chain, wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor b chain; or (iii) the polynucleotide of (i) and the polynucleotide of (ii), wherein, optionally, the host cell comprises a CD4+ T cell.
  • Embodiment 62 The host cell of embodiment 61, comprising:
  • the heterologous polynucleotide encoding a polypeptide comprising an extracellular portion of a CD8 co-receptor a chain wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor a chain;
  • the heterologous polynucleotide encoding a polypeptide comprising an extracellular portion of a CD8 co-receptor b chain, wherein, optionally, the encoded polypeptide is or comprises a CD8 co-receptor b chain; and
  • Embodiment 63 The modified immune cell of any one of embodiments 1- 62, wherein the immune cell comprises a chromosomal gene knockout of a PD-1 gene; a LAG3 gene; a TIM3 gene; a CTLA4 gene; an HLA component gene; a TCR component gene; or any combination thereof.
  • Embodiment 64 The modified immune cell of embodiment 63, wherein the chromosomal gene knockout comprises a knockout of an HLA component gene selected from an al macroglobulin gene; an a2 macroglobulin gene; an a3 macroglobulin gene; a b ⁇ microglobulin gene; or a b2 microglobulin gene; or any combination thereof.
  • an HLA component gene selected from an al macroglobulin gene; an a2 macroglobulin gene; an a3 macroglobulin gene; a b ⁇ microglobulin gene; or a b2 microglobulin gene; or any combination thereof.
  • Embodiment 65 The modified immune cell of embodiment 63 or 64, wherein the chromosomal gene knockout comprises a knockout of a TCR component gene selected from a TCR a variable region gene; a TCR b variable region gene; a TCR constant region gene; or any combination thereof.
  • Embodiment 66 An isolated polynucleotide encoding a binding protein, wherein the encoded binding protein comprises a TCR Va domain and a TCR nb domain and is capable of binding to a RMFPNAPYL (SEQ ID NO.:94):HLA complex, wherein: (i) the encoded Va domain comprises the CDR3 amino acid sequence set forth in any one of SEQ ID NOs.:28, 19, 22, or 25; (ii) the encoded nb domain comprises the CDR3 amino acid sequence set forth in any one of SEQ ID NOs.:40, 31, 34, or 37; (iii) the encoded Va domain comprises the CDR1 amino acid sequence set forth in any one of SEQ ID NOs.:26, 17, 20, or 23; (iv) the encoded nb domain comprises the CDR1 amino acid sequence set forth in any one of SEQ ID NOs.:38, 32, or 35; (v) the encoded Va domain comprises the CDR2 amino acid sequence set forth in any one of SEQ
  • the encoded TCR Va is comprised in a TCRa chain, wherein the TCRa chain comprises or consists of an amino acid sequence having at least 90% identity to the amino acid sequence set forth in any one of SEQ ID NOs.:53 and 46-52;
  • the encoded TCR nb is comprised in a TCRb chain, wherein the TCRb chain an amino acid sequence comprising, consisting of, or having at least 90% identity to the amino acid sequence set forth in any one of SEQ ID NOs.:61 and 54-60; or (xi) any combination of (i)-(x).
  • Embodiment 67 The isolated polynucleotide of embodiment 66, wherein the polynucleotide is codon-optimized for expression in a host cell, wherein, optionally, the host cell is a human T cell, NK cell, or NK-T cell.
  • Embodiment 68 The isolated polynucleotide of embodiment 66 or 67, wherein the polynucleotide comprises a polynucleotide having at least 75% identity to the polynucleotide sequence set forth in any one of SEQ ID NOs: 62-81.
  • Embodiment 69 A vector, comprising the polynucleotide of any one of embodiments 66-68.
  • Embodiment 70 The vector of embodiment 69, wherein the vector is a lentiviral vector or a retroviral vector.
  • Embodiment 71 A host cell, comprising the polynucleotide of any one of embodiments 66-68 and capable of expressing the encoded binding protein.
  • Embodiment 72 A composition, comprising: (i) the modified immune cell of any one of embodiments 1-65; (ii) the polynucleotide of any one of embodiments 66- 68; (iii) the vector of embodiment 69 or 70; and/or (iv) the host cell of embodiment 71; and a pharmaceutically acceptable carrier, excipient, or diluent.
  • Embodiment 73 The composition of embodiment 72, comprising:
  • the modified immune cell of any one of embodiments 1-65 and (ii) an immune cell comprising a polynucleotide that encodes a binding protein that comprises a TCR Va and a TCR nb and is capable of specifically binding to a VLDFAPPGA (SEQ ID NO.:100):HLA complex, wherein, optionally, the HLA comprises HLA-A*0201, and wherein, optionally, the modified immune cell of (i) and the immune cell of (ii) are each independently selected from a T cell, a NK cell, and NK-T cell.
  • Embodiment 74 The composition of embodiment 73, wherein the binding protein of the immune cell in (ii) comprises: (a) CDRla, CDR2a, CDR3a, CDR1 b, O ⁇ K2b, and O ⁇ K3b amino acid sequences of SEQ ID NOs.: 101-103 and 105-107, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.
  • the Ub has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO : 108; (b) CDRla, CDR2a, CDR3a, CDRlp, CDR2p, and CDR3p amino acid sequences of SEQ ID NOs.: 109-110 and 113-115, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 112 and/or (2) the nb has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.:l 16; or (c) CDRla, CDR2a, CDR3a, CDR1 b, O ⁇ IT2b, and CDR3b amino acid sequences of SEQ ID NOs.: 117-119 and 121-123, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ
  • Embodiment 75 A method for treating a subject having a disease or disorder associated with WT-1 expression, comprising administering to the subject an effective amount of: (i) the modified immune cell of any one of embodiments 1-65; (ii) the polynucleotide of any one of embodiments 66-68; (iii) the vector of embodiment 69 or 70; (iv) the host cell of embodiment 71; and/or (v) the composition of any one of embodiments 72-74.
  • Embodiment 76 The method of embodiment 75, comprising administering the modified immune cell of any one of embodiments 1-65 to a subject who has received, is receiving, or will receive an immune cell comprising a polynucleotide that encodes a binding protein that comprises a TCR Va and a TCR nb and is capable of specifically binding to a VLDFAPPGA (SEQ ID NO.: 100):HLA complex, wherein, optionally, the HLA comprises HLA-A*0201, and wherein, optionally, the modified immune cell and the immune cell are each independently selected from a T cell, a NK cell, and NK-T cell.
  • an immune cell comprising a polynucleotide that encodes a binding protein that comprises a TCR Va and a TCR nb and is capable of specifically binding to a VLDFAPPGA (SEQ ID NO.: 100):HLA complex, wherein, optionally, the HLA comprises HLA-A*0201, and wherein, optionally, the
  • Embodiment 77 The method of embodiment 76, wherein the binding protein that is capable of specifically binding to the VLDFAPPGA (SEQ ID NO.:100):HLA complex comprises: (a) CDRla, CDR2a, CDR3a, CDR1 b, O ⁇ IT2b, and CDR3b amino acid sequences of SEQ ID NOs.: 101-103 and 105-107, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 104 and/or (2) the nb has at least 90% identity to, comprises, or consists of the amino acid sequence set forth in SEQ ID NO.: 108; (b) CDRla, CDR2a, CDR3a, CDRlp, CDR2p, and CDR3p amino acid sequences of SEQ ID NOs.: 109-110 and 113-115, respectively, and wherein, optionally, (1) the Va has at least 90% identity to, comprises, or
  • Embodiment 78 The method of any one of embodiments 75-77, wherein the disease or disorder is a hematological malignancy or a solid cancer.
  • Embodiment 79 The method of embodiment 78, wherein the hematological malignancy is selected from acute lymphoblastic leukemia (ALL), acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloid leukemia (AML, including refractory and relapsed AML, and including acute myeloblastic leukemia, acute promyelocitic leukemia, acute myelocytic leukemia, acute myelomonocytic leukemia (e.g ., with or without eosinophilia), acute monocytic leukemia, acute erythroid leukemia, and acute megakaryoblastic leukemia), chronic myelogenous leukemia (CML), chronic myelocytic leukemia, chronic eosinophilic leukemia (CEL), myelodysplastic syndrome (MDS), non-Hodgkin's lymphoma (NHL), or multiple myeloma (MM, including ALL
  • Embodiment 80 The method of embodiment 78, wherein the solid cancer is selected from biliary cancer, bladder cancer, bone and soft tissue carcinoma, brain tumor, breast cancer, breast carcinoma, cervical cancer, colon cancer, colorectal adenocarcinoma, colorectal cancer, desmoid tumor, embryonal cancer, endometrial cancer, esophageal cancer, gastric cancer, gastric adenocarcinoma, glioblastoma multiforme, glioblastoma, melanoma, diffuse peritoneal mesothelioma, malignant pleural mesothelioma, glioma, astrocytoma, gynecological tumor, head and neck squamous cell carcinoma, hepatic cancer, hepatocellular carcinoma, lung cancer, non small-cell lung cancer, malignant melanoma, osteosarcoma, ovarian cancer (e.g ., epithelial ovarian cancer, ovarian
  • Embodiment 81 The method according to any one of embodiments 75-80, wherein the modified immune cell is modified ex vivo to comprise the heterologous polynucleotide.
  • Embodiment 82 The method according to any one of embodiments 75-81, wherein the modified immune cell is allogeneic, syngeneic, or autologous to the subject.
  • Embodiment 83 The method according to any one of embodiments 75-82, wherein the modified immune cell is a hematopoietic progenitor cell or a human immune system cell.
  • Embodiment 84 The method according to embodiment 83, wherein the immune system cell is a CD4 + T cell, a CD8 + T cell, a CD4 CD8 double negative T cell, a gd T cell, a natural killer cell, a dendritic cell, or any combination thereof.
  • Embodiment 85 The method according to embodiment 84, wherein the T cell is a naive T cell, a central memory T cell, an effector memory T cell, or any combination thereof.
  • Embodiment 86 The method according to any one of embodiments 75-85, wherein the method comprises administering a plurality of doses of the modified immune cell to the subject.
  • Embodiment 87 The method according to embodiment 86, wherein the plurality of doses are administered at intervals between administrations of about two to about four weeks.
  • Embodiment 88 The method according to any one of embodiments 75-87, wherein the modified immune cell is administered to the subject at a dose of about 10 4 cells/kg to about 10 11 cells/kg.
  • Embodiment 89 The method according to any one of embodiments 75-88, wherein the method further comprises administering a cytokine to the subject.
  • Embodiment 90 The method according to embodiment 89, wherein the cytokine is IL-2, IL-15, IL-21 or any combination thereof.
  • Embodiment 91 The method according to embodiment 90, wherein the cytokine is IL-2 and is administered concurrently or sequentially with the modified immune cell.
  • Embodiment 92 The method according to embodiment 91, wherein the cytokine is administered sequentially, provided that the subject was administered the modified immune cell at least three or four times before cytokine administration.
  • Embodiment 93 The method according to any one of embodiments 89-92, wherein the cytokine is IL-2 and is administered subcutaneously.
  • Embodiment 94 The method according to any one of embodiments 75-93, wherein the subject is further receiving immunosuppressive therapy.
  • Embodiment 95 The method according to embodiment 94, wherein the immunosuppressive therapy is selected from calcineurin inhibitors, corticosteroids, microtubule inhibitors, low dose of a mycophenolic acid prodrug, or any combination thereof.
  • the immunosuppressive therapy is selected from calcineurin inhibitors, corticosteroids, microtubule inhibitors, low dose of a mycophenolic acid prodrug, or any combination thereof.
  • Embodiment 96 The method according to any one of embodiments 75-95, wherein the subject has received a non-myeloablative or a myeloablative hematopoietic cell transplant.
  • Embodiment 97 The method according to embodiment 96, wherein the subject is administered the modified immune cell at least three months after the non- myeloablative hematopoietic cell transplant.
  • Embodiment 98 The method according to embodiment 97, wherein the subject is administered the modified immune cell at least two months after the myeloablative hematopoietic cell transplant.
  • Embodiment 99 The method of any one of embodiments 75-98, wherein the subject has previously received therapy for AML.
  • Embodiment 100 A composition, comprising: (i) the modified immune cell of any one of embodiments 1-65; (ii) the polynucleotide of any one of embodiments 66- 68; (iii) the vector of embodiment 69 or 70; and/or (iv) the host cell of embodiment 71, for use in the treatment of a disease or disorder associated with WT-1 expression.
  • Embodiment 101 A composition, comprising: (i) the modified immune cell of any one of embodiments 1-65; (ii) the polynucleotide of any one of embodiments 66- 68; (iii) the vector of embodiment 69 or 70; and/or (iv) the host cell of embodiment 71, for use in the manufacture of a medicament for the treatment of a disease or disorder associated with WT-1 expression.
  • Embodiment 102 The composition for use according to embodiment 100 or 101, wherein the disease or disorder is a hematological malignancy or a solid cancer.
  • Embodiment 103 The composition for use according to embodiment 102, wherein the hematological malignancy is selected from acute lymphoblastic leukemia (ALL), acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloid leukemia (AML, including refractory and relapsed AML, and including acute myeloblastic leukemia, acute promyelocitic leukemia, acute myelocytic leukemia, acute myelomonocytic leukemia (e.g ., with or without eosinophilia), acute monocytic leukemia, acute erythroid leukemia, and acute megakaryoblastic leukemia), chronic myelogenous leukemia (CML), chronic myelocytic leukemia, chronic eosinophilic leukemia (CEL), myelodysplastic syndrome (MDS), non-Hodgkin's lymphoma (NHL), or multiple myeloma (ALL
  • Embodiment 104 The composition for use according to embodiment 102, wherein the solid cancer is selected from biliary cancer, bladder cancer, bone and soft tissue carcinoma, brain tumor, breast cancer, breast carcinoma, cervical cancer, colon cancer, colorectal adenocarcinoma, colorectal cancer, desmoid tumor, embryonal cancer, endometrial cancer, esophageal cancer, gastric cancer, gastric adenocarcinoma, glioblastoma multiforme, glioblastoma, melanoma, diffuse peritoneal mesothelioma, malignant pleural mesothelioma, glioma, astrocytoma, gynecological tumor, head and neck squamous cell carcinoma, hepatic cancer, hepatocellular carcinoma, lung cancer, non small-cell lung cancer, malignant melanoma, osteosarcoma, ovarian cancer (e.g., epithelial ovarian cancer,
  • a binding protein comprising a T cell receptor (TCR) a chain variable (Va) domain and a TCR b chain variable (nb) domain
  • the Va domain comprises: (i) the CDR3 amino acid sequence (CDR3a) according to any one of SEQ ID NOs.:28, 19, 22, or 25, or 28, or a variant thereof; (ii) the CDR1 amino acid sequence (CDRla) of any one of SEQ ID NOs.:26, 17, 20, or 23; (iii) the CDR2 amino acid sequence (CDR2a) of any one of SEQ ID NOs.: 27, 18, 21, or 24; (iv) an amino acid sequence having at least 90% identity to the amino acid sequence set forth in any one of SEQ ID NOs: 1-4 or 9-12; or (v) any combination of (i)-( iv); and the nb domain comprises: (vi) the CDR3 amino acid sequence (O ⁇ E3b) according to any one of SEQ ID NOs: 40, 31,
  • Embodiment 106 The binding protein of embodiment 105, further comprising: (1) a TCR a chain constant domain (Ca), or a fragment thereof; and/or (2) a TCR b chain constant domain (Eb), or a fragment thereof.
  • a TCR a chain constant domain Ca
  • Eb TCR b chain constant domain
  • Embodiment 107 The binding protein of embodiment 106, wherein the Ca comprises or consists of the amino acid sequence of any one of SEQ ID NOs.:41-44.
  • Embodiment 108 The binding protein of embodiment 106 or 107, wherein the Eb comprises or consists of the amino acid sequence of SEQ ID NO.:45.
  • Embodiment 109 An isolated polynucleotide encoding the binding protein of any one of embodiments 105-108.
  • Embodiment 110 The polynucleotide of embodiment 109, which is codon- optimized for expression in a host cell.
  • Embodiment 111 A modified immune cell, comprising the polynucleotide of any one of embodiments 109-110, wherein the polynucleotide is heterologous to the immune cell.
  • SEQ ID NO:l (#4 a chain variable domain with leader sequence)
  • SEQ ID NO:2 (#6 a chain variable domain with leader sequence)
  • SEQ ID NO:3 (#7 a chain variable domain with leader sequence)
  • SEQ ID NO:4 (#10 a chain variable domain with leader sequence)
  • SEQ ID NO:5 (#4 b chain variable domain with leader sequence)
  • SEQ ID NO:6 (#6 b chain variable domain with leader sequence)
  • SEQ ID NO:7 (#7 b chain variable domain with leader sequence)
  • SEQ ID NO:8 (#10 b chain variable domain with leader sequence)
  • SEQ ID NO: 10 (#6 a chain variable domain, leader sequence removed)
  • SEQ ID NO: 11 (#7 a chain variable domain, leader sequence removed)
  • SEQ ID NO: 12 (#10 a chain variable domain, leader sequence removed)
  • SEQ ID NO: 16 (#10 b chain variable domain, leader sequence removed)
  • SEQ ID NO:46 (#4 a chain with leader sequence)
  • SEQ ID NO:48 (#7 a chain with leader sequence) MACPGFLWALVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYY LF WYKQPP SRQMIL VIRQEAYKQQNATENRF S VNF QKAAKSF SLKISD SQLGD A AMYFC AS SPGTYKYIF GTGTRLKVL ANIQNPDP AVY QLRD SKS SDKS VCLFTDF D S QTN V S Q SKD SD VYITDKC VLDMRSMDFK SN S A V AW SNK SDF AC AN AFNN S IIPEDTFFP SPE S S CD VKL VEK SFETDTNLNF QNL S VIGFRILLLK V AGFNLLMTL RLWSS
  • SEQ ID NO:49 (#10 a chain with leader sequence)
  • SEQ ID NO:54 (#4 b chain with leader sequence) MGCRLLCCAVLCLLGAVPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAM YWYKQK AKKPPELMF VY S YEKLSINES VP SRF SPECPN S SLLNLHLHALQPED S ALYLCASSQGTSGADTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQK ATL V CL AT GF YPDHVEL S W W VN GKE VHS GVCTDPQPLKEQP ALND SR Y CL S S RLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD CGFTSES YQQGVLS ATILYEILLGKATLYAVLVS ALVLMAMVKRKDSRG
  • SEQ ID NO:57 (#10 b chain with leader sequence)
  • SEQ ID NO:68 (#7 a gene fragment, codon-optimized)
  • SEQ ID NO:74 (#4 b gene fragment, codon-optimized) ATGGGCTGTAGACTGTTGTGTTGTGCTGTGCTGTGTCTGTTGGGAGCTGTGC CTATCGATACAGAGGTGACCCAGACCCCTAAACATCTGGTTATGGGCATGA CC AAC AAGAAGAGCCTGAAGT GCGAGC AGC AC AT GGGCC AT AGGGCC ATG T ATT GGT AT A AGC AG A AGGC C A AG A A AC C T C C T G AGC T GAT GTT C GT GT AC AGCTACGAGAAGCTGAGCATCAACGAGAGCGTGCCCAGCAGATTTTCTCCT GAGTGCCCTAATTCTAGCCTGCTGAATCTGCACCTGC ATGCTCTGC AGCCTG AGGATTCTGCTCTGTACCTGTGCTTCTTCTCAGGGCACATCTGGAGCTGA TACACAGTACTTCGGACCTGGCACAAGACTGACAGTGCTGGAAGACCTGAA GAACGTGTTCCCCCCAGAGGTGGCCGTGTTCGAG
  • SEQ ID NO: 82 (Reference TCR a chain) MTSIRAVFIFLWLQLDLVNGENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPW YKQELGKRPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFC A ATED Y QLIW GAGTKLIIKPDIQNPDP A V Y QLRD SK S SDK S VCLF TDFD S QTN V S Q SKD SD V YITDKT VLDMRSMDFK SN S A V AW SNK SDF AC ANAFNN SIIPEDTFF PSPES SCDVKLVEKSFETDTNLNF QNLS VIGFRILLLKVAGFNLLMTLRLW S S S
  • SEQ ID NO:84 (Porcine teschovirus-1 2A (P2A-1) peptide)
  • SEQ ID NO:86 Thosea asigna virus 2A (T2A) peptide
  • SEQ ID NO:88 (Foot-and-mouth disease virus 2A (F2A) peptide)
  • SEQ ID NO:89 (Porcine teschovirus-1 2A (P2A-1) peptide - nt sequence)
  • SEQ ID NO:90 (Porcine teschovirus-22A (P2A-2) peptide - nt sequence)
  • SEQ ID NO:91 Thosea asigna virus 2A (T2A) peptide - nt sequence) GGAAGCGGAGAGGGC AGAGGAAGTCTGCTAAC ATGCGGTGACGTCGAGGA GAATCCTGGACCT
  • SEQ ID NO:92 Equine rhinitis A virus (ERAV) 2A (E2A) peptide - nt sequence
  • VNP SEQ ID NO.: 105 (TCR 10.1 CDRip)
  • SEQ ID NO.: 108 (TCR 10.1 VP) GAGVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYE AQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSLTGSYEQYFGP GTRLTVTE
  • SEQ ID NO.: 112 (TCR 13.1 Va) DQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKD KNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASGIGDYKLSFGAGTTVT VRAN
  • CD8 + T cells from four donors were cultured with autologous dendritic cells (DCs) pulsed with the WT-1 peptide RMFPNAPYL (SEQ ID NO:94) (Ho, Greenberg et al, 2006).
  • the T cell lines were combined, stained with CD8-independent (CD8i) WT-1 peptide:HLA tetramer and sorted for high tetramer staining cells.
  • CD8i CD8-independent WT-1 peptide:HLA tetramer
  • a total of 40 polyclonal T cell lines with high tetramer staining were identified.
  • the sorted T cell samples and a fraction of the total unsorted sample were both analyzed by TCR repertoire analysis (Adaptive Biotechnologies) to quantitate each TCR clonotype.
  • TCRa/TCRP-deficient J76 Jurkat T cells were transduced to express the candidate TCRs.
  • the affinity of each candidate for WT-1 was assessed by measuring the relative WT-1 peptide:HLA tetramer staining as compared to CD3 expression, which is a marker of total transgenic TCR surface expression.
  • TCR-transduced Jurkat cells expressing the Nur 77-tomato activation marker were assessed for activation in the presence of peptide.
  • Data are shown in Figure 3A.
  • CD8+ T cells isolated from donor PMBCs were transduced to express one of eight TCRs selected for further study. After one week, the transduced cells were sorted for WT-1 peptide:HLA tetramer staining and CD8 expression (Figure 4A). Tetramer + CD8 + T cells were expanded and assayed for IFNy production. The expanded antigen- specific cells were cultured for four hours with T2 target cells pulsed with titrated concentrations of WT-1 peptide, and IFNy production was determined by flow cytometry (Figure 4B). The percentage of IFNy-producing cells was fit to dose- response curves by non-linear regression to calculate the peptide EC so for each TCR ( Figure 4C).
  • T cells expressing the two TCRs with the lowest EC so values were compared to T cells expressing the reference WT-1 specific TCR for the ability to induce tumor cell lysis.
  • Tumor cell line MDA-MB-468 which was transduced to express HLA-A2, and the naturally HLA_A2 + tumor cell line Panc-1 were loaded with 51 Cr.
  • TCR-transduced T cell-mediated killing was calculated by measuring Cr release in response to decreasing doses of effector T cells relative to tumor cell targets ( Figures 5A and 5B).
  • T cells expressing exemplary TCR DL10 were further investigated for IFN-g production ( Figure 6) and the ability to reduce growth of tumor cell line cells (Figure 7).
  • IFN-g production primary CD8+ T cells were transduced with a reference TCR or with TCRDLIO and cultured with the peptide-pulsed T2 target cells as indicated in Figure 6. After 4 hours, IFNy production was assessed by intracellular flow cytometry and percent IFNy positivity was fit to a dose response curve by nonlinear regression in Graphpad Prism.
  • primary CD8+ T cells were transduced with a reference TCR (comprising a TCRa chain having the amino acid sequence set forth in SEQ ID NO: 82 and a TCRP chain having the amino acid sequence set forth in SEQ ID NO: 83) or with TCRDLIO and cultured in triplicate with the HLA-A2+ WT1+ pancreatic tumor cell line Panc-1 (transduced to express a red fluorescence protein) at a ratio of 8: 1 in an IncuCyte assay, and cell proliferation/survival was monitored over 7 days. Error bars indicate standard error of the mean.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Toxicology (AREA)
  • Virology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Dermatology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2020/047071 2019-08-20 2020-08-19 T-cell immunotherapy specific for wt-1 Ceased WO2021034976A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CN202080071763.9A CN114555790B (zh) 2019-08-20 2020-08-19 Wt-1特异性t细胞免疫疗法
EP20771665.5A EP4017872A1 (en) 2019-08-20 2020-08-19 T-cell immunotherapy specific for wt-1
US17/636,314 US20220409661A1 (en) 2019-08-20 2020-08-19 T-cell immunotherapy specific for wt-1
AU2020334064A AU2020334064A1 (en) 2019-08-20 2020-08-19 T-cell immunotherapy specific for WT-1
KR1020227009102A KR20220050176A (ko) 2019-08-20 2020-08-19 Wt-1에 특이적인 t-세포 면역요법
JP2022510984A JP7737978B2 (ja) 2019-08-20 2020-08-19 Wt-1に特異的なt細胞免疫療法
CA3147717A CA3147717A1 (en) 2019-08-20 2020-08-19 T-cell immunotherapy specific for wt-1
IL290609A IL290609A (en) 2019-08-20 2022-02-14 wt-1-specific t-cell immunotherapy

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962889519P 2019-08-20 2019-08-20
US62/889,519 2019-08-20

Publications (1)

Publication Number Publication Date
WO2021034976A1 true WO2021034976A1 (en) 2021-02-25

Family

ID=72473955

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/047071 Ceased WO2021034976A1 (en) 2019-08-20 2020-08-19 T-cell immunotherapy specific for wt-1

Country Status (9)

Country Link
US (1) US20220409661A1 (cg-RX-API-DMAC7.html)
EP (1) EP4017872A1 (cg-RX-API-DMAC7.html)
JP (1) JP7737978B2 (cg-RX-API-DMAC7.html)
KR (1) KR20220050176A (cg-RX-API-DMAC7.html)
CN (1) CN114555790B (cg-RX-API-DMAC7.html)
AU (1) AU2020334064A1 (cg-RX-API-DMAC7.html)
CA (1) CA3147717A1 (cg-RX-API-DMAC7.html)
IL (1) IL290609A (cg-RX-API-DMAC7.html)
WO (1) WO2021034976A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025238364A1 (en) * 2024-05-16 2025-11-20 Oxford University Innovation Limited T cell receptors specific for hla-e restricted wt1 peptide and uses thereof
WO2025245169A1 (en) 2024-05-21 2025-11-27 Fred Hutchinson Cancer Center Immunotherapy cells equipped with a collagen-targeting payload

Citations (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5420032A (en) 1991-12-23 1995-05-30 Universitge Laval Homing endonuclease which originates from chlamydomonas eugametos and recognizes and cleaves a 15, 17 or 19 degenerate double stranded nucleotide sequence
WO1997009433A1 (en) 1995-09-06 1997-03-13 Icos Corporation Cell-cycle checkpoint genes
US20040002092A1 (en) 2002-03-15 2004-01-01 Sylvain Arnould Hybrid and single chain meganucleases and use thereof
US20040087025A1 (en) 1995-06-07 2004-05-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6833252B1 (en) 1992-05-05 2004-12-21 Institut Pasteur Nucleotide sequence encoding the enzyme I-SecI and the uses thereof
WO2005056595A2 (en) * 2003-12-06 2005-06-23 Imperial Innovations Limited T cell receptor specific for wilms tumor antigen
US20060153826A1 (en) 2003-01-28 2006-07-13 Sylvain Arnould Use of meganucleases for inducing homologous recombination ex vivo and in toto in vertebrate somatic tissues and application thereof
US20070117128A1 (en) 2005-10-18 2007-05-24 Smith James J Rationally-designed meganucleases with altered sequence specificity and DNA-binding affinity
US7342092B2 (en) 2002-09-12 2008-03-11 International Institute Of Cancer Immunology, Inc. Cancer antigen peptide formulations
US7608685B1 (en) 1998-07-31 2009-10-27 International Institute Of Cancer Immunology, Inc. Tumor antigen based on products of the tumor suppressor gene WT1
US7622119B2 (en) 2004-03-31 2009-11-24 International Institute Of Cancer Immunology, Inc. Cancer antigen peptides derived from WT1
WO2010084158A1 (en) 2009-01-21 2010-07-29 Monoclonal Antibodies Therapeutics Anti-cd 160 monoclonal antibodies and uses thereof
US20110189141A1 (en) 2009-05-19 2011-08-04 Max-Delbrück-Centrum für Molekulare Medizin Multiple target t cell receptor
US20110243972A1 (en) 2005-01-13 2011-10-06 Johns Hopkins University Prostate stem cell antigen vaccines and uses thereof
US20110301073A1 (en) 2010-05-17 2011-12-08 Sangamo Biosciences, Inc. Novel DNA-binding proteins and uses thereof
US8119772B2 (en) 2006-09-29 2012-02-21 California Institute Of Technology MART-1 T cell receptors
WO2013025779A1 (en) 2011-08-15 2013-02-21 Amplimmune, Inc. Anti-b7-h4 antibodies and their uses
US20140068797A1 (en) 2012-05-25 2014-03-06 University Of Vienna Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US20140186843A1 (en) 2012-12-12 2014-07-03 Massachusetts Institute Of Technology Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
WO2015071474A2 (en) 2013-11-18 2015-05-21 Crispr Therapeutics Ag Crispr-cas system materials and methods
WO2015077615A1 (en) * 2013-11-22 2015-05-28 The Board Of Trustees Of The University Of Illinois Engineered high-affinity human t cell receptors
WO2016022400A1 (en) * 2014-08-04 2016-02-11 Fred Hutchinson Cancer Research Center T cell immunotherapy specific for wt-1
WO2016040724A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-b7-h4 antibodies and immunoconjugates
WO2016054638A1 (en) 2014-10-03 2016-04-07 Dana-Farber Cancer Institute, Inc. Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof
WO2016134333A1 (en) 2015-02-19 2016-08-25 Compugen Ltd. Anti-pvrig antibodies and methods of use
WO2017021526A1 (en) 2015-08-05 2017-02-09 Amgen Research (Munich) Gmbh Immune-checkpoint inhibitors for use in the treatment of blood-borne cancers
US9574000B2 (en) 2012-12-19 2017-02-21 Medimmune, Llc Anti-human B7-H4 antibodies and their uses
WO2018058002A1 (en) 2016-09-23 2018-03-29 Fred Hutchinson Cancer Research Center Tcrs specific for minor histocompatibility (h) antigen ha-1 and uses thereof
US20190085081A1 (en) * 2016-03-15 2019-03-21 Cancer Research Technology Limited Chimeric antigen receptor
WO2019178427A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11390921B2 (en) * 2014-04-01 2022-07-19 Adaptive Biotechnologies Corporation Determining WT-1 specific T cells and WT-1 specific T cell receptors (TCRs)

Patent Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5468614A (en) 1990-01-24 1995-11-21 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5420032A (en) 1991-12-23 1995-05-30 Universitge Laval Homing endonuclease which originates from chlamydomonas eugametos and recognizes and cleaves a 15, 17 or 19 degenerate double stranded nucleotide sequence
US6833252B1 (en) 1992-05-05 2004-12-21 Institut Pasteur Nucleotide sequence encoding the enzyme I-SecI and the uses thereof
US20040087025A1 (en) 1995-06-07 2004-05-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
WO1997009433A1 (en) 1995-09-06 1997-03-13 Icos Corporation Cell-cycle checkpoint genes
US7608685B1 (en) 1998-07-31 2009-10-27 International Institute Of Cancer Immunology, Inc. Tumor antigen based on products of the tumor suppressor gene WT1
US20060078552A1 (en) 2002-03-15 2006-04-13 Sylvain Arnould Hybrid and single chain meganucleases and use thereof
US20040002092A1 (en) 2002-03-15 2004-01-01 Sylvain Arnould Hybrid and single chain meganucleases and use thereof
US7342092B2 (en) 2002-09-12 2008-03-11 International Institute Of Cancer Immunology, Inc. Cancer antigen peptide formulations
US20060153826A1 (en) 2003-01-28 2006-07-13 Sylvain Arnould Use of meganucleases for inducing homologous recombination ex vivo and in toto in vertebrate somatic tissues and application thereof
US20060206949A1 (en) 2003-01-28 2006-09-14 Sylvain Arnould Custom-made meganuclease and use thereof
WO2005056595A2 (en) * 2003-12-06 2005-06-23 Imperial Innovations Limited T cell receptor specific for wilms tumor antigen
US7622119B2 (en) 2004-03-31 2009-11-24 International Institute Of Cancer Immunology, Inc. Cancer antigen peptides derived from WT1
US20110243972A1 (en) 2005-01-13 2011-10-06 Johns Hopkins University Prostate stem cell antigen vaccines and uses thereof
US20070117128A1 (en) 2005-10-18 2007-05-24 Smith James J Rationally-designed meganucleases with altered sequence specificity and DNA-binding affinity
US8119772B2 (en) 2006-09-29 2012-02-21 California Institute Of Technology MART-1 T cell receptors
WO2010084158A1 (en) 2009-01-21 2010-07-29 Monoclonal Antibodies Therapeutics Anti-cd 160 monoclonal antibodies and uses thereof
US20110189141A1 (en) 2009-05-19 2011-08-04 Max-Delbrück-Centrum für Molekulare Medizin Multiple target t cell receptor
US20110301073A1 (en) 2010-05-17 2011-12-08 Sangamo Biosciences, Inc. Novel DNA-binding proteins and uses thereof
WO2013025779A1 (en) 2011-08-15 2013-02-21 Amplimmune, Inc. Anti-b7-h4 antibodies and their uses
US20140068797A1 (en) 2012-05-25 2014-03-06 University Of Vienna Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US20140186843A1 (en) 2012-12-12 2014-07-03 Massachusetts Institute Of Technology Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof
US9574000B2 (en) 2012-12-19 2017-02-21 Medimmune, Llc Anti-human B7-H4 antibodies and their uses
WO2015071474A2 (en) 2013-11-18 2015-05-21 Crispr Therapeutics Ag Crispr-cas system materials and methods
WO2015077615A1 (en) * 2013-11-22 2015-05-28 The Board Of Trustees Of The University Of Illinois Engineered high-affinity human t cell receptors
WO2016022400A1 (en) * 2014-08-04 2016-02-11 Fred Hutchinson Cancer Research Center T cell immunotherapy specific for wt-1
WO2016040724A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-b7-h4 antibodies and immunoconjugates
WO2016054638A1 (en) 2014-10-03 2016-04-07 Dana-Farber Cancer Institute, Inc. Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof
WO2016134333A1 (en) 2015-02-19 2016-08-25 Compugen Ltd. Anti-pvrig antibodies and methods of use
WO2017021526A1 (en) 2015-08-05 2017-02-09 Amgen Research (Munich) Gmbh Immune-checkpoint inhibitors for use in the treatment of blood-borne cancers
US20190085081A1 (en) * 2016-03-15 2019-03-21 Cancer Research Technology Limited Chimeric antigen receptor
WO2018058002A1 (en) 2016-09-23 2018-03-29 Fred Hutchinson Cancer Research Center Tcrs specific for minor histocompatibility (h) antigen ha-1 and uses thereof
WO2019178427A1 (en) 2018-03-14 2019-09-19 Arbor Biotechnologies, Inc. Novel crispr dna targeting enzymes and systems

Non-Patent Citations (113)

* Cited by examiner, † Cited by third party
Title
"Embryonic Stem Cell Protocols: Volume I: Isolation and Characterization (Methods in Molecular Biology", vol. II, 2006, article "Embryonic Stem Cell Protocols"
"Immunochemical Methods In Cell And Molecular Biology", 1987, COLD SPRING HARBOR LABORATORY
"Methods in Molecular Biology", 2008, article "Neural Stem Cells: Methods and Protocols"
"Selected Methods in Cellular Immunology", 1979, FREEMAN PUBLISHING
AHSOURIWEISS, J IMMUNOL, vol. 198, no. 2, 2017, pages 657 - 668
ALTSCHUL ET AL.: "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402, XP002905950, DOI: 10.1093/nar/25.17.3389
ANAND: "Techniques for the Analysis of Complex Genomes", 1992, ACADEMIC PRESS
ARGAST ET AL., J. MOL. BIOL., vol. 280, 1998, pages 345 - 353
ASHWORTH ET AL., NATURE, vol. 441, 2006, pages 656 - 659
AUSUBEL, F. M.: "Current Protocols in Molecular Biology", July 2008, JOHN WILEY & SONS, INC.
BELFORT ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3379 - 3388
BETTS ET AL., J. IMMUNOL., vol. 172, 2004, pages 6407
BIOINFORMATICS, vol. 15, 2016, pages 298 - 300
CAVALLO ET AL., CANE. IMMUNOL. IMMUNOTHER., vol. 60, 2011, pages 319
CAWTHON ET AL., J. IMMUNOL., vol. 167, 2001, pages 2577
CHAPUIS AUDE G ET AL: "T cell receptor gene therapy targeting WT1 prevents acute myeloid leukemia relapse post-transplant", NATURE MEDICINE, NATURE PUB. CO, NEW YORK, vol. 25, no. 7, 24 June 2019 (2019-06-24), pages 1064 - 1072, XP036829214, ISSN: 1078-8956, [retrieved on 20190624], DOI: 10.1038/S41591-019-0472-9 *
CHEVALIER ET AL., MOLEC. CELL, vol. 10, 2002, pages 895 - 905
CHOTHIA ET AL., EMBO J., vol. 7, 1988, pages 3745
COFFIN, J. M. ET AL.: "In Fundamental Virology", 1996, LIPPINCOTT-RAVEN PUBLISHERS, article "Retroviridae: The viruses and their replication"
COHEN ET AL., CANCER RES., vol. 67, no. 8, 2007, pages 3898 - 3903
COLE ET AL., IMMUNOLOGY, vol. 137, no. 2, 2012, pages 139
COLEGAO, CELL. MOL. IMMUNOL., vol. 1, 2004, pages 81 - 88
CROWTHER ET AL., NATURE IMMUNOL., vol. 21, 2020, pages 175 - 185
CURRENT PROTOCOLS IN IMMUNOLOGY
DANGAJ ET AL., CANCER RES., vol. 73, 2013, pages 4820
DESJARLAIS ET AL., PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 2256 - 2260
DI STASI ET AL., N. ENGL. J. MED., vol. 365, 2011, pages 1673 - 1683
DOSSETT ET AL., MOL. THER., vol. 17, 2009, pages 742
DUJON ET AL., GENE, vol. 82, 1989, pages 115 - 118
ENGELS ET AL., HUM. GENE THER., vol. 14, 2003, pages 1155
EPINAT ET AL., NUCLEIC ACIDS RES., vol. 31, 2003, pages 2952 - 62
FEHSE ET AL., MOL. THER., vol. 1, 2000, pages 448 - 456
FLOROSTARHINI, SEMIN. ONCOL., vol. 42, no. 4, 2015, pages 539 - 548
FRECHA ET AL., MOL. THER., vol. 18, 2010, pages 1748
GAIGER ET AL., CLIN. CANCER RES., vol. 7, no. 3, 2001, pages 761
GAOJAKOBSEN, IMMUNOL. TODAY, vol. 21, 2000, pages 630 - 636
GIMBLE ET AL., J. MOL. BIOL., vol. 263, 1996, pages 163 - 180
GLOVER: "Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology", vol. I & II, 1985, WILEY-INTERSCIENCE
GREENREED, SCIENCE, vol. 281, 1998, pages 1309
GUTHRIEFINK: "Guide to Yeast Genetics and Molecular Biology", 1991, ACADEMIC PRESS
HANAHANWEINBERG, CELL, vol. 100, 2000, pages 57
HANAHANWEINBERG, CELL, vol. 144, 2011, pages 646
HARRISKRANZ, TRENDS PHARMACOL. SCI., vol. 37, no. 3, 2016, pages 220
JANITZ: "Next-Generation Genome Sequencing", 2008, WILEY-VCH, article "Mesenchymal Stem Cells: Methods and Protocols"
JASIN, TRENDS GENET., vol. 12, 1996, pages 224 - 228
JINEK ET AL., SCIENCE, vol. 337, 2012, pages 816 - 21
JOLLY, D J.: "Emerging Viral Vectors", 1999, COLD SPRING HARBOR LAB, article "The Development of Human Gene Therapy", pages: 209 - 40
JORES ET AL., PROC. NAT'L ACAD. SCI. U.S.A., vol. 87, 1990, pages 9138
KENNEDY ET AL., IMMUNOL. REV., vol. 222, 2008, pages 129
KIEBACK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 105, 2008, pages 623 - 628
KRISKY ET AL., GENE THER., vol. 5, 1998, pages 1517
KUBALL ET AL., BLOOD, vol. 109, 2007, pages 2331
KYRIGIDEIS ET AL., J. CARCINOG., vol. 9, 2010, pages 3
LANGENKAMP ET AL., J. IMMUNOL., vol. 32, 2002, pages 2046
LEEN ET AL., ANN. REV. IMMUNOL., vol. 25, 2007, pages 243
LEFKOVITS, IMMUNOLOGY METHODS MANUAL: THE COMPREHENSIVE SOURCEBOOK OF TECHNIQUES, 1998
LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55
LEHNINGER: "Biochemistry", 1975, WORTH PUBLISHERS, INC., pages: 71 - 77
LEWIN: "Genes IV", 1990, OXFORD UNIVERSITY PRESS, pages: 8
LIEBL, W.EHRMANN, M.LUDWIG, W.SCHLEIFER, K. H.: "International Journal of Systematic Bacteriology", vol. 41, 1991, US DEPT. HEALTH AND HUMAN SERVICES, article "The DIG System Users Guide for Filter Hybridization", pages: 255 - 260
LIU ET AL., BLOOD, vol. 115, 2010, pages 3520 - 30
MAUTINO ET AL., AMERICAN ASSOCIATION FOR CANCER RESEARCH 104TH ANNUAL MEETING 2013, 6 April 2013 (2013-04-06)
MAVILIO ET AL., BLOOD, vol. 83, 1994, pages 1988 - 1997
NAKANISHI ET AL., NATURE, vol. 462, no. 7272, 2009, pages 510
OGAWA ET AL., BLOOD, vol. 707, 2003, pages 1698
PAQUES ET AL., CURR. GENE THER., vol. 7, 2007, pages 49 - 66
PARK ET AL., MOLEC. THERAP., vol. 17, 2009, pages 219
PERBAL: "A Practical Guide to Molecular Cloning", 1984
PERLER ET AL., NUCLEIC ACIDS RES., vol. 22, 1994, pages 1125 - 1127
PHILIP ET AL., BLOOD, vol. 124, 2014, pages 1277 - 1287
PORTEUS ET AL., NAT. BIOTECHNOL., vol. 23, 2005, pages 967 - 73
REN ET AL., CLIN. CANCER RES., vol. 23, no. 9, 2017, pages 2255 - 2266
RICHMANKRANZ, BIOMOL. ENG., vol. 24, 2007, pages 361
ROBINS ET AL., BLOOD, vol. 114, 2009, pages 4099
ROBINS ET AL., J. IMM. METH., 2011
ROBINS ET AL., SCI. TRANSLAT. MED., vol. 2, 2010, pages 47ra64
ROITT: "Essential Immunology", 1988, BLACKWELL SCIENTIFIC PUBLICATIONS
SADELAIN ET AL., CANCER DISCOV., vol. 3, no. 4, 2013, pages 388
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS, article "Hematopoietic Stem Cell Protocols"
SCATCHARD ET AL., ANN. N.Y. ACAD. SCI., vol. 51, 1949, pages 660
SCHMITT ET AL., HUM. GEN., vol. 20, 2009, pages 1240
SCHMITT ET AL., HUM. GENE THER., vol. 20, 2009, pages 1240
SCHMITT ET AL., NAT. BIOTECHNOL., vol. 35, 2017, pages 1188
SCHOLTEN ET AL., CLIN. IMMUNOL., vol. 119, 2006, pages 135
SEELIGER ET AL., MABS, vol. 7, no. 3, 2015, pages 505 - 515
STONE ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 63, no. 11, 2014, pages 1163
STONEKRANZ, FRONT. IMMUNOL., vol. 4, 2013, pages 244
STRAATHOF ET AL., BLOOD, vol. 105, 2005, pages 4247 - 4254
SUSSMAN ET AL., J. MOL. BIOL., vol. 342, 2004, pages 31 - 41
TERENTIS ET AL., BIOCHEM., vol. 49, 2010, pages 591 - 600
THOMAS M SCHMITT ET AL: "Generation of higher affinity T cell receptors by antigen-driven differentiation of progenitor T cells in vitro", NATURE BIOTECHNOLOGY, vol. 35, no. 12, 6 November 2017 (2017-11-06), us, pages 1188 - 1195, XP055526131, ISSN: 1087-0156, DOI: 10.1038/nbt.4004 *
THOMAS M SCHMITT ET AL: "Supplementary Data to: Generation of higher affinity T cell receptors by antigen-driven differentiation of progenitor T cells in vitro", NATURE BIOTECHNOLOGY, vol. 35, no. 12, 6 November 2017 (2017-11-06), us, pages 1188 - 1195, XP055751556, ISSN: 1087-0156, DOI: 10.1038/nbt.4004 *
TILL ET AL., BLOOD, vol. 112, 2008, pages 2261
TORIKAI ET AL., BLOOD, vol. 119, no. 24, 2012, pages 5697
TORIKAI ET AL., BLOOD, vol. 122, no. 8, 2013, pages 1341
TORIKAI ET AL., NATURE SCI. REP., vol. 6, 2016, pages 21757
UDYAVAR ET AL., J. IMMUNOL., vol. 182, 2009, pages 4439
VERHOEYEN ET AL., METHODS MOL. BIOL., vol. 506, 2009, pages 97
VIOLALANZAVECCHIA, SCIENCE, vol. 273, 1996, pages 104
WALCHLI ET AL., PLOS ONE, vol. 6, 2011, pages 327930
WALSENG ET AL., PLOS ONE, 2015
WALSENG ET AL., SCIENTIFIC REPORTS, vol. 7, 2017, pages 10713
WANG ET AL., BLOOD, vol. 118, 2011, pages 1255 - 1263
WANG ET AL., HUM. GENE THER., vol. 18, 2007, pages 712
WARREN ET AL., GENOME RES., vol. 21, 2011, pages 790
WEIR: "Handbook Of Experimental Immunology", vol. I-IV, 1986, BLACKWELL SCIENTIFIC
WILSON, SCIENCE, vol. 295, 2002, pages 2103
WOLFE ET AL., J. MOL. BIOL., vol. 285, 1999, pages 1917 - 1934
WOLFF ET AL., CANCER RES., vol. 53, 1993, pages 2560
XIE ET AL., PLOS ONE, vol. 9, 2014, pages e100448
ZHAO ET AL., J. IMMUNOL., vol. 174, no. 4415, 2005
ZHAO ET AL., J. IMMUNOL., vol. 179, 2007, pages 5845
ZHOUBRENNER, EXP. HEMATOL.

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025238364A1 (en) * 2024-05-16 2025-11-20 Oxford University Innovation Limited T cell receptors specific for hla-e restricted wt1 peptide and uses thereof
WO2025245169A1 (en) 2024-05-21 2025-11-27 Fred Hutchinson Cancer Center Immunotherapy cells equipped with a collagen-targeting payload

Also Published As

Publication number Publication date
AU2020334064A1 (en) 2022-03-03
KR20220050176A (ko) 2022-04-22
US20220409661A1 (en) 2022-12-29
IL290609A (en) 2022-04-01
CN114555790A (zh) 2022-05-27
CA3147717A1 (en) 2021-02-25
JP7737978B2 (ja) 2025-09-11
JP2022547809A (ja) 2022-11-16
CN114555790B (zh) 2025-02-25
EP4017872A1 (en) 2022-06-29

Similar Documents

Publication Publication Date Title
US20250114433A1 (en) Binding proteins specific for ras neoantigens and uses thereof
AU2018234830B2 (en) High affinity MAGE-A1-specific TCRs and uses thereof
US12448430B2 (en) High avidity WT1 T cell receptors and uses thereof
AU2023276467A1 (en) Binding proteins and engineered cells specific for neoantigens and uses thereof
US20250018036A1 (en) Immunotherapy targeting sox2 antigens
WO2019109047A1 (en) Binding proteins specific for 5t4 and uses thereof
US12595290B2 (en) T cell receptors specific for mesothelin and their use in immunotherapy
JP7737978B2 (ja) Wt-1に特異的なt細胞免疫療法
US20250177531A1 (en) Binding proteins specific for ras neoantigens and uses thereof
WO2022066973A1 (en) Immunotherapy targeting pbk or oip5 antigens
WO2024163371A1 (en) Binding proteins specific for mutant p53 and uses thereof
HK40073285A (en) T-cell immunotherapy specific for wt-1
WO2026059935A1 (en) Immunotherapy targeting modified kras g12v antigen
EA048447B1 (ru) Высокоавидные т-клеточные рецепторы к wt1 и их применения
HK40097595A (zh) 靶向sox2抗原的免疫治疗

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20771665

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3147717

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022510984

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020334064

Country of ref document: AU

Date of ref document: 20200819

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20227009102

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020771665

Country of ref document: EP

Effective date: 20220321

WWG Wipo information: grant in national office

Ref document number: 202080071763.9

Country of ref document: CN

WWW Wipo information: withdrawn in national office

Ref document number: 202290216

Country of ref document: EA

WWW Wipo information: withdrawn in national office

Ref document number: 2020771665

Country of ref document: EP