WO2020180736A2 - Production of cannabinoids using genetically engineered photosynthetic microorganisms - Google Patents

Production of cannabinoids using genetically engineered photosynthetic microorganisms Download PDF

Info

Publication number
WO2020180736A2
WO2020180736A2 PCT/US2020/020512 US2020020512W WO2020180736A2 WO 2020180736 A2 WO2020180736 A2 WO 2020180736A2 US 2020020512 W US2020020512 W US 2020020512W WO 2020180736 A2 WO2020180736 A2 WO 2020180736A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
microorganism
nucleotides
polynucleotide encoding
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/020512
Other languages
French (fr)
Other versions
WO2020180736A9 (en
WO2020180736A3 (en
Inventor
Anastasios Melis
Nico BETTERLE
Diego Alberto HIDALGO MARTINEZ
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California Berkeley
University of California San Diego UCSD
Original Assignee
University of California Berkeley
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California Berkeley, University of California San Diego UCSD filed Critical University of California Berkeley
Priority to US17/435,695 priority Critical patent/US20220243236A1/en
Publication of WO2020180736A2 publication Critical patent/WO2020180736A2/en
Publication of WO2020180736A3 publication Critical patent/WO2020180736A3/en
Publication of WO2020180736A9 publication Critical patent/WO2020180736A9/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P17/00Preparation of heterocyclic carbon compounds with only O, N, S, Se or Te as ring hetero atoms
    • C12P17/02Oxygen as only ring hetero atoms
    • C12P17/06Oxygen as only ring hetero atoms containing a six-membered hetero ring, e.g. fluorescein
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/20Bacteria; Culture media therefor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/52Genes encoding for enzymes or proenzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • C12N9/1029Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1085Transferases (2.) transferring alkyl or aryl groups other than methyl groups (2.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/88Lyases (4.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/90Isomerases (5.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93Ligases (6)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/40Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids
    • C12P7/42Hydroxy-carboxylic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y121/00Oxidoreductases acting on X-H and Y-H to form an X-Y bond (1.21)
    • C12Y121/03Oxidoreductases acting on X-H and Y-H to form an X-Y bond (1.21) with oxygen as acceptor (1.21.3)
    • C12Y121/03007Tetrahydrocannabinolic acid synthase (1.21.3.7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y121/00Oxidoreductases acting on X-H and Y-H to form an X-Y bond (1.21)
    • C12Y121/03Oxidoreductases acting on X-H and Y-H to form an X-Y bond (1.21) with oxygen as acceptor (1.21.3)
    • C12Y121/03008Cannabidiolic acid synthase (1.21.3.8)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y203/00Acyltransferases (2.3)
    • C12Y203/01Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
    • C12Y203/012063,5,7-Trioxododecanoyl-CoA synthase (2.3.1.206)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y205/00Transferases transferring alkyl or aryl groups, other than methyl groups (2.5)
    • C12Y205/01Transferases transferring alkyl or aryl groups, other than methyl groups (2.5) transferring alkyl or aryl groups, other than methyl groups (2.5.1)
    • C12Y205/01001Dimethylallyltranstransferase (2.5.1.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y205/00Transferases transferring alkyl or aryl groups, other than methyl groups (2.5)
    • C12Y205/01Transferases transferring alkyl or aryl groups, other than methyl groups (2.5) transferring alkyl or aryl groups, other than methyl groups (2.5.1)
    • C12Y205/01029Geranylgeranyl diphosphate synthase (2.5.1.29)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y404/00Carbon-sulfur lyases (4.4)
    • C12Y404/01Carbon-sulfur lyases (4.4.1)
    • C12Y404/01026Olivetolic acid cyclase (4.4.1.26)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y602/00Ligases forming carbon-sulfur bonds (6.2)
    • C12Y602/01Acid-Thiol Ligases (6.2.1)
    • C12Y602/01001Acetate-CoA ligase (6.2.1.1)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/101Plasmid DNA for bacteria

Definitions

  • Cannabis sativa products [0002 j Interest in and use of Cannabis sativa products has expanded recently. The specific interaction of cannabinoids with the human endocaonabinoid system makes these compounds attractive products to be used for therapeutic purposes and for the treatment of a number of medical condi tions. However, understanding of the physicochemical properties and stability of these compounds is limited, production yield is low, and moreover, there is a variable range and mix of products produced by different Cannabis satim cirttivars and other plants. This variability is -further exacerbated by variable growth conditions.
  • Agricultural production of cannabinoids is subject to additional challenges such as plant Susceptibilit to climate and disease, variable yield and product composition due to prevailing cultivation and climatic conditions, the; need for extraction of cannabinoids by chemical processing and, by necessity , the, harvesting of a mix of products that need to be purified and certified for biopharmaeeutieal use,
  • Gannahinoids are terpenophenolic compounds, generated upon the reaction of a 10- catbon isoprenoid intermediate with a modified fatty acid metabolism precursor as par of the secondary metabolism of QmmMs ative and other plants (Carvalho eta!, (2017) FEME feast Res 17). More than 100 different chemical species belonging to this class of compounds have been identified (Carvalho et at. (2017), FEME Yeast Res 17(4); Zirpel et at (2017), JBiotectm 259, 204-212).
  • MEP MethykTythritol 4-phosphate
  • GPP geranyl diphosphate / (GPP) intermediates
  • isoprenoid pathway enzymes for the biosynthesis of a great variety of endogenously needed terpenoid-type molecules like carotenoids, toeopherols, phytol, sterols, hormones, and many others (see, FIG, 1)
  • MEP MethykTythritol 4-phosphate
  • G3F glyeeraidehyde-3-pb08phate
  • DXP is then converted into methylerythritol phosphate (MEP), which is subsequently modified to term hydrox:y-2-meihy]-2-butenyl-4-diphospbate (MMBPP), IIMBPP is the substrate required for die formation of isopenteny! diphosphate (IPP) and dinrethykllyi: diphosphate (DMAPP), which are the universal terpenoid precursors.
  • MMBPP methylerythritol phosphate
  • IIMBPP is the substrate required for die formation of isopenteny! diphosphate (IPP) and dinrethykllyi: diphosphate (DMAPP), which are the universal terpenoid precursors.
  • Cyanobacteria also contain ail IPP isbmerase (ipi in FIG. 1) which catalyzes the inter- conversion of IPP and DMAPP.
  • the MEP pathway consumes r edueihg equivalents and cellular energy in tlie form. of NADFli, reduced ferredox in, DTP. and ATP, ultimately derived from photosynthesis.
  • NADFli reduced ferredox in, DTP. and ATP
  • the 5-carbon (5-C) isoniciie molecules dimethylallyl diphosphate (DMAPP) and isopenteny! diphosphate OFF) are the universal precursors of all isopretoids (Agranoff et aL (1960); Lichtentha!er (2010)) ⁇ comprising units of 5-carbon configurations, Two distinct and separate: biosynthetic pathways evolved independentl in nature to generate these universal DMAPP and IPP precursors (Agranoff eta!. (I 60), J. Biol C hem , 236, 326A ⁇ 32; Lichtenthaler (2001) Phot ynih, Res 9.2, 163-179; Lichtenthaler (2010), Chem.
  • GPP geranyl diphosphate
  • GPP geranyl diphosphate synthase
  • the dedicated pathwa for the cellular synthesis of cannahinoids commences wif exanoic acid, a 6-earbon intermediate in the fatty acid biosynthetic pathway.
  • Action by acyl activating enzyme 1 (AEE1) converts the hexaooid acid: to its coenzyme A (Hexanoyl-CoA) form (Stout et al (2012), Plant 171 -353-55; Carvalho et al.
  • CBDAS canhabidiolie acid synthase
  • the latter are chemical isomers of the CfiDA, having the same C H G* chemical formula.
  • Deearboxyiated and biologically active (psyehoactive) forms of the D9- THCA and CBCA cannabimrids (ATTMC and CBC, respectively) typically occur b a nom enzymatic process that may happen during heating or exposure to sunlight (de Meijer ei a! . (200$), Genetics 163,335-346).
  • the present invention provides improved methods and compositions for producing cannabinoids in photosynthetic microorganisms, allowing the production of highly pure cannabinoids that can be used in numerou biotechnological, pharmaceutic, and cosmetics applications.
  • the current invention provides new methods -for generating purified ean binoids, e.g., catinabidiolie acid, in photosypthette microorganisms, e.g > cyanobacteria and microalgae.
  • eanoabidiolic acid (CBDA) and other cannabmoids produced using the present methods are derived via photosynthesis from sunlight, carbon dioxide, and water,
  • the invention takes advantage of improvements in tile engineering of photosvTithetic microorganisms, e.g,, cyanobacteria, which, upon suitable genetic modification, ean be used to produce large quantities of highly pure eannabinoids such as earmabidiolie acid.
  • the invention provides methods and compositions for generating an hanesting eannabidiolic acid and other cannabmoids from genetically modified cyanobacteria o other p oiosyntheiic microorganisms,
  • Such genetically modified mietOorganisms can be used commercially in an enclosed mass culture system, e. ., a photobioreaetor, to provide a source of highly pure and valuable compounds for use in various industries, such as the medical, pharmaeeniical, andcosmetics industries,
  • the present disclosure provides a method for -producing cannabmoids in a photosynthetic microorganism, the method comprising (i) introducin into the microorganism: a polynucleotide encoding a GPPS polypeptide; an one or more polynucleotides encoding AAB.1 V OLS, OAG, GBGAS polypeptides mi an oxidocyelase selected from the group consisting of CHDAS, THCAS, and CBCAS; wherein the polynucleotide encoding the GPPS polypeptide is operably linked to a first promoter, and the one or more polynucleotides encoding the AAEl, OLS, OAG, GBGAS polypeptides and the oxidocyelase are operably linked to one or more additional p omoters; and (it) culturing the microorganism under conditions in which the GPPS, AAEL GLS, GAG,
  • the photosymthetie microorganism modified in accordance with the disclosure is cyanobacteria
  • the GPPS polypeptide is a fusion protein encoded by a polynucleotide encoding GPPS fused to the 3 ! end of a leader nucleic: acid sequence encoding a protein that is expressed *!! cyanobacteria at a level of at least 1% of the total cellular protein.
  • the GPPS polypeptide is an nptl ⁇ GPPS fusion protein, in some embodiments ⁇ , the GPPS polypeptide comprises an ami.no acid sequence that is at least 90% Or 95% identical to SEQ ID NQ:2, In some embodim nts, the GPPS polypeptide comprises the amino acidsequeoce of SEQ ID NO'2. In some embodiments, the polynucleotide encoding the GPPS polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NDil . In some embodiments, the poiyaucleotide encoding the GPPS polypeptide Comprises the nucleotide sequence of SEQ ID O:L
  • the AAEl polypeptide used in accordance with the disclosure comprises an amino acid sequence that is at least 99% or 95% identical to SEQ: ID N €3:4, In some embodiments, the AAEl polypeptide comprises the amino acid sequence of SEQ ID MO:4.
  • the polynucleotide encoding the AAEl polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 636-2798 of SEQ ID NG:3, In some embodiments, the polynucleotide encoding die AAEl polypeptide comprises nucleotides 636-2798 of SEQ ID %Q;3, in some embodiments, the OLS polypeptide rtsed in accordance with the disclosure comprises an amino acid sequence that is at least 90% or 95%identical to SEQ ID NO:5, hr some embodiments, the OLS polypeptide comprises the amino acid sequence of SEQ ID NQ;5.
  • the polynucleotide encoding the OLS polypeptide comprises a nuekotide sequence that is at least 99% or 95% identical to nucleotides 2819-3973 of SEQ ID NO;3, in some embodiments, the polynucleotide encoding the OLS polypeptide comprises nucleotides 2819-3973 of SEQ ID NO:3. fiOi 5 ⁇
  • the GAG polypeptide used in accordance with the disclosure comprises an amino acid sequence that is at least 903 ⁇ 4s or 95% identical to SEQ ID NG:6.
  • the GAC polypeptide comprises the amino acid sequence of SEQ ID NO:6.
  • the polynucleotide encoding the OAC polypeptide comprises a nucleotide Sequence that is at least 070 or 95% identical to hue teoti es 3994-4299 of SEQ ID Q:3, In some embodiments, the polynucleotide encoding the OAC polypeptide comprises nucleotides 3994-4299 of SEQ ID NO : 3, In some embodiments, the CBGAS polypeptide used in accordance with the disclosure comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO: 7.
  • the CBGAS polypeptide comprises the amino acid sequence of SEQ ID O:7, In some embodiments : , th polynucleotide encoding the CBGAS polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 4320-5507 of SEQ ID NO:3. in some embodiments, the polynucleotide encoding the GBG AS polypeptide comprises nucleotides 4320-5507 of SEQ ID O:3.
  • the oxidocyclase used in accordance with the disclosure is CBDAS
  • the CBDAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:S
  • the oxidocyclase is CB DAS
  • the CBDAS comprises the amino acid sequence of SEQ ID NO:8.
  • the polynucleotide encoding the CBDAS comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 3528-7162 of SEQ ID NQi3, in some embodiments, the polynucleotide encoding the CBDAS comprises nucleotides 5528-7162 of SEQ ID NO: 3.
  • the oxidocyclase used in accordance with the disclosure is TldCAS
  • the THCAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NCilfl
  • the oxidocyclase is TIICAS
  • an thcTIlCAS comprises the amino acid sequence of SEQ ID N0: 10.
  • the polynucleotide encoding the THCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO:9.
  • the polynucleotide encoding the TI-iC AS comprises the nucleotide sequence of SEQ ID NO:9.
  • the oxidocyclase use in accordance with die disclosure is CBCAS
  • the CBGAS comprises an amino acid sequence that is at least 9(3% or 95% identical to SEQ ID NO:.12.
  • the oxidocyclase is CBCAS
  • the CBCAS comprises the amino acid sequence of SEQ ID NO: 12.
  • the polynucleotide encoding the CBCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO: 1 1 .
  • the polynucleotide encoding the CBC S comprises the nucleotide sequence of SEQ ID NO: II .
  • two or more of the polynucleotides unending the AAEl, QLS, QAC, CBGAS polypeptides and the o idoeyelase are present w-ithiu a single operon, In some embodiments : , all of the polynucleotides encoding the AAEl , QLS » OAC, CBGAS polype tide and the oxidocyclase are present within a single operon. In some embodiments, the operon is at least 90% or 95% identical to $EQ ID NQ;3, SEQ ID NO:13, or SEQ ID 0:I4 in some embodiments, the operon comprises SEQ ID NQ:3, SEQ ID NO: 13, or SEQ ID NO: 14.
  • the first and/or additional promoters used in accordance with the disclosure are selected from the group consisting of a cpc promoter, a psbA2 promoter, a glgAl pro oter s a TPtrc promoter, and a T7 promoter.
  • one or more of the polynucleotides encoding the GPPS, AAEI, OPS, OAC, CBGAS polypeptides and the oxidocyelsse are codo optimized for the photosynthetie microorganism.
  • the microorganis modifie in accordance with the disclosure is fro a genus selected from the group consisting of Syme iocystis, Sy choceec , Atkraspim, Nestoc, and Anah m *
  • a codin g sequences for the GPPS, AAEI, QLS, O AC, CBGAS polypeptides and the oxidoeyelase are preceded by a ggaattaggaggttasttaa ribosome binding site (RBS).
  • the method further comprises a ste (c) comprising isolatin cannabinoids .fe the microorganism or: from the culture medium.
  • the cannabinoids are isolated from the surface of the liquid culture as floater molecules in some embodiments, the eatraabinoids are extracted from the interior of the mi croorganism in some embodiments, the cannabinoids am extracted from a disintegrated cell suspension prodiieed by isolating the microorganism and disintegrating It by forcing it through a French press, subjecting it to sonieatkra, or treating it with glass beads.
  • the disintegrated cell suspension is supplemented with H 2 SO and 30% (w:v) Nad at a volume- to- volume ratio of (cell suspension / H 2 SQ 4 NaCl ⁇ 3 / 0.12/ 0.5).
  • the cannabinoids are extracted from hie I-ESCb and NaCbtreated disurtegrate cell suspension upon incubation with an organic solvent,
  • the organic soiyent is hexane ⁇ or heptane.
  • the Organic soiyent is ethyl acetate, acetone, methanol, ethanol, or propanol.
  • the microorganism is freeze-dried.
  • the cannabinoids are extracted from th ffeezodrie microorganism with an organic Solvent.
  • the organic solvent is methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, or heptane.
  • the organic solvent is dried by solvent evaporation, leaving the eatnahiftoids In pure form.
  • the presen disclosure provides a photosynthetie microorganis produced using any of the methods described herein.
  • the present disclosure provides a photosynfheiic microorganism comprising: (i) a polynucleotide encoding a GPPS polypeptide: and (ii) one or more polynucleotides encoding AAE1, OLS, OAC, CBGAS polypeptides and an oxidocyclase selected from the group consisting of CBD AS, Ti l CA S, and CBCAS; wherein the polynucleotide encoding the GPPS polypeptide is operahly linked to a first promoter, and wherein the one or more polynucleotides encoding the AAE I , OLS, OAC, CBGAS polypeptides and the oxidocyelas tire operably linked to one or more additional promoters.
  • tje photosyaTthetie microorganism is cyanobacteria.
  • the GPPS polypeptide is a fusion rotein eneoded by a polynucleotide encoding GPPS fused to the 3’ end of a leader nucleic acid sequence encoding a protein that is expressed in cyanobacteria at a level of at least 1% of the total cellular protein.
  • the GPPS polypeptide is an uptPGPPS fusion protein.
  • the GPPS polypeptide comprises an amino acid sequence that is at least 90% or 95% identieal to SEQ ID G:2, In some embodiments, the GPPS polypeptid comprises the amino acid sequence of SEQ ID NO:2. In some embodiments, the polynucleotide encoding the GPPS polypeptide comprises a nucleotide sequence that is at least 90% or 1)5% identical to SEQ ID NO:I. in some embodiments, the polynucleotide encoding the GPPS polypeptide comprises the nucleotide sequence of SEQ ID NO: 1.
  • the AAEI polypeptide comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:4. In some embodiments ⁇ the AAEI polypeptide comprises the amino acid sequence of SEQID NCEd. in some embodiments, the polynucleotide encoding die AAEI polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 6M 2798 of SEQ ID O:3.
  • the polynucleotide encoding the AAEI polypeptide comprises nucleotides 636-2798 of SEQ ID NO:3, in some embodiments, the GLS polypeptide comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:5.
  • the OLS polypeptide comprises the amino acid sequence of SEQ ID O:S
  • the polynucleotide encoding the OLS polypeptide co prises a nucleotide sequence that is at least 90 or 95% identical to nucleotides 2819-3973 of SEQ ID NO: 3
  • the polynucleotide encoding the OLS polypeptide comprises nucleotides 2819-3973 of SEQ ID NO:3.
  • the OAC polypeptide comprises an ammo acid sequence that is at least 90% or 95% identical io SEQ ID NQ:6, in some embodiments, the OAC polypeptide comprises the amino acid sequence of SEQ ID N 0:6. In some embodiments, the polynucleotide encoding the OAC polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 3994 4299 of SEQ ID NO:3, In some embodiments, the polynucleotide encoding the OAC polypeptide comprises nucleotides 3994-4299 of SEQ ID NO:3.
  • the CBGAS polypeptide comprises an amino acid sequence that is at least 9034 or 9534 identical to SEQ ID O;7. In some embodiments, the CBGAS polypeptide comprises file amino acid sequence of SEQ ID NO:7. In some embodiments, the polynucleotide encoding the CBGAS polypeptide comprises pucleotide sequence that is at least 90% or 95% identical to nucleotides 4320-5507 of SEQ ID NO: 3.in some embodiments, the polynucleotide encoding the CBGAS polypeptide: comprises nucleotides 4320-5507 of SEQ ID NO:3.
  • the oxidocyclase is GBDAS, and the CBDAS comprises a amino acid sequence that is at least 90% or 95% identical to SEQ ID NO 8.
  • the oxidocyclase is CBDAS, and the CBDAS comprises the amino acid sequence of SEQ ID NO: 8.
  • the polynucleotide encoding the CBDAS comprises a nucleotide sequence that Is at least 90% or 95% identical to nucleotides 5528-7162 of SEQ ID NQ;3.
  • the polynucleotide encoding the CBDAS comprises nucleotides 5528-7162 of SEQ ID NO; 3:
  • the oxidocyclase is THCAS, and the THCAS comprises an amino acid sequence that Is at least 90% or 95% identical to SEQ ID NO: 10,
  • the oxidocyclase is THCAS, and the THCAS comprises the amino acid sequence of SEQ IP Q:!0.
  • the polynucleotide encoding flic THCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NG:9, in some embodiments, the polynucleotide encoding the THCAS comprises the nucleotide sequence of SEQ ID N( ) :9,
  • the oxidocyelase is CBGAS
  • the CBGAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NQ:12.
  • the oxidocyclase is CBGAS
  • the CBGAS comprises the amino add Sequence of SEQ ID NO: 12.
  • the polynucleotide: encoding the CBC AS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO: I I .
  • the polynucleotide encoding the CBGAS comprises the nucleotide sequence ofSEQ ID NO: 1.1 ,
  • two or more of the polynucleotides encoding the A AE1 , OES, OAC, CBGAS polypeptides and the oxidocyclase are present within a single operon. In some embodiments, all of the poIymicleot es encoding the AAEI , OI,S, OAC, CBGAS polypeptides and the oxidocyclase are present within a single operon.
  • the operon is at least 90% or 95% identical to SEQ ID NO:3, SEQ ID NQ:I3, or SEQ ID NO: 14,
  • tire operon comprises SEQ ID N0:3, SEQ ID NOP 2, or SEQ IQ NO:14
  • the first and pr additional promoters are selected from the group consisting of a epe promoter, a psbA2 promoter, a gigAl promoter, a Ptre promoter, and a T7 promoter.
  • one or more of the polynucleotides encoding the GBPS, AABL OLS, QAC j CBGAS polypeptides and the axidoeyclase are codon optimised for thephotosynthetie microorganism, in some embodiments, die microorganis is from a genus selected from the group consisting of Syn chacysUs, Symd coccus, Athmspim, Nostaty and: Anabaerm.
  • one of more of the coding sequences for the GBPS, AAEl, OLS, QAC, CBGAS polypeptides and the oxidocyelase are preceded by a ggaattaggaggttaattaa ribosome binding she (RBS),
  • RBS ggaattaggaggttaattaa ribosome binding she
  • the present disclosure provides 3 polynucleotide encoding a GBPS, AABL OLS, OAC, CBGAS, CBDAS, TIICAS polypeptide and/or CBGAS polypeptide, wherein the polynucleotide is codon optimized for cyanobacteria or other photosynthetie microorganism i some embodiments, the polynucleotide is at least 90% of 95% identical to a sequence selected from the group consisting of SEQ ID NO;!, SEQ ID NO 3 » SEQ ID NO;9, SEQ ID NO:ll , SEQ ID NO: 13, SEQ ID NO: 14, nucleotides 636*279$ of SEQ ID NO:3, nucleotides 2819-3973 of SEQ ID NO:3 s nncieot)des 3994-4299 of SEQ ID NQ:3, nucleotides 4320-5507 of SEQ ID NQ:3, and nucleotides 5528-71
  • the polynucleotide comprises a sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NQ:3, SEQ ID NQ:9, SEQ ID NO: 1 1 , SEQ ID NO: 13, SEQ ID NO: 14, nucleotides 636-2798 of SEQ ID NG:3, nucleotides 2819-3973 of SEQ ID NO:3, nucleotides 39944299 of SEQ ID NO:3, nucleotides 4320-5507 of SEQ ID NO:3, and nucleotides 5528- 7162 of SEQ ID NOG,
  • the present disclosure provides an expression cassette comprising any of the herein-described polynucleotides.
  • the present disclosure provides a host cell comprising any of the herein-described polynucleotides or expression cassettes.
  • the present disclosure provides a cell culture comprising an of the herein- described microorganisms or host cells,
  • the present disclosure provides a method for producing cannahinoids, the method comprising culturing any of the heroin-described p otosynthetie microorganisms or host cell under conditions in which the CiPPS, AAEl , OLS, OAC, CBGAS polypeptides and the aoxidocydase are expressed and wherein eannabinoid biosynthesis takes place.
  • the metho further comprises a step (c) Comprising isolating cannabinoids fro the microorganism or from the culture medium.
  • the eannahinoids are isolated j&pra the surface of the liquid culture as floater molecules.
  • the cannabinoids are extracted froni the interior of the microorganism.
  • the cannabinoids are extracte from a disintegrated cell suspension produced by isolating the microorganism and disintegrating it by forcing it through a French press, subjecting it to so icatian, or treating it with glass beads in some embodiments, the disintegrated ceil suspension is supplemented with HiSCh and 30% (w:v) NaCl at a volume- to-volume ratio of ⁇ cell suspension / i-pSCk / NaCl 3 / 0.12 / CIS), in some embodiments, the cannabinoids are extracted from the HaSCh and NaCl-treated disintegrated cell suspension upon incubation with an organic solvent, in some embodiments, the organic solvent is hexane or heptane, in some embodiments, the orpnie solvent, is ethyl acetate, acetone, methanol, ethanol, or propanol.
  • the microorganism is freeze-dried, in some embodiments, the eannahinoids are extracted from the freeze-dried microorganism with an organic solvent in some embodiments, the organic solvent is methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, or heptane in some embodiments, the organic solvent is dried by solvent evaporation, leaving the cannafoinosds in pure form,
  • FIG. 1 Terpenoid biosynthesis via the endogenous MEP ⁇ meihylefythritoF4- phosphate) pathway in photosynfhefic microorganisms, e.g. Sy chacystvs sp.
  • G3P gl>3 ⁇ 4eraldehydc 3-pbospliate: Dxs, deoxyxyiulose 5-phosphate synthase; Dxr, deoxyxylulose 5-phosphate reductoisomefase; ispP, diphosphocytidylyl methyierythritol synthase; IspE, diphosphocytidySyl methyleiyihrito!
  • kinase ispF, methyl erythiito.l-2 : ,4- cyeiodiphosphate synthase; IspG, hydrcjxynrefhydbutenyl diphosphate synthase; IspH, hydroxymethylhuteuyl diphosphate reductase; Ipi, 1PP isomemse,
  • FIG. 2 Terpetmid biosynthesis via the heterologous M V A (mevalonic acid) pathway in phot syuihetic microorganisms, e.g. Synechocysti sp.
  • MG 3, Biosynthesis of geranyi diphosphate (GPP) by the action of the enzyme geranyl diphosphate synthase (GPPS).
  • GPP is the first precursor to mono-, sesqui-, di-, hi-, tetra-terpenoids and all their derivatives- 10036]
  • FIG * 4 Protein expression analysis of Symedtacysiis wild type (WT) arid transformant strains. Total cell proteins were resolved by 5DS-PAQE, transferred to nitrocellulose and probed with specific a-GPPSS polyclonal antibodies. Individual native anti heterologous proteins of interest are indicated on the right side of the blot .
  • EIG. 5 The eannabinoid biosynthesis pathway in pbotosynthetie microorganisms, e,g, SymckoCystis sp. Abbreviations used: AAET Acyl Activating Enzyme 1; OLS, Glivetol synthase; OAC, Olivetolie acid Cyclase; CBGAS, Carmabigerofic acid synthase; CBDAS, Cannabidiolic acid synthase,
  • FIG, 6 Gas chromatograph detection with a flame ionization detector (GC-FID) of floater extracts fro m Someehocjsstis wil type (WT) untreated an cultures treated with cannabidioi (CBP) (Upper panel) GC-FID analysis of heptane, extracts front a Synechoeysfy wild type untreated culture.
  • GC-FID flame ionization detector
  • Floater extracts from wild type cultures displayed a flat profile, without any discernible peaks, ⁇ Lower panel
  • GC-F1D analysis of floater extracts front a Syuechixysth culture incubated in the presence of cannabidioi was the m3 ⁇ 4or product detected, showing a retention time of 9.2 min under these experimental conditions.
  • Smaller amounts of an additional compound, with retention times of 10.3 min were also detected as secondary product of the process (5ee, e.g., Dussy FE et at. (2005), Isolation of D9-THCA-A from hemp and analytical aspects concerning the determination of D9-THC In cannabis products.
  • Spectrophotoili tric detection of caanab !iolic acid and cannabidiol inheptane solution (Upper panel) Absorbance spectrum of eaiinabidkdic add (CBDA) showing UV maxima at 225 and 270 a from which the concentration of CJBDA can be calculated, (Lower panel) Absorbance spectrum of cannabidiol (CBD) showing UV peak at 214 am and a shoulder at 233 tim from which the concentration of CBD can be calculated.
  • CBDA and CBD at the above-mentione wavelengths permits delineation of the concentratio of the two eannabinoids in a mix solution.
  • FIGS. 8.4-8B Linear addition of Symchocystk CBDA transforming constritets.
  • FIG. SA Map of the upper (construct U#i; 5,300 at) find lower (construct ! 2; 4,640 nt) Syftefhocysiis codon-optimized eannabidiolic acid biosynthetic path way encoding genes.
  • IM harbored the LLEI, QLS, OAC f am!
  • zeocin (2mR) resistance genes I,#2 harbored the OLS) (MC. CSGAS, €8DA$* and chloramphenicol ⁇ cmR encoding genes.
  • Symckocystis was transformed linearly ⁇ sequentially) first with construct L# l and, upon reaching homoplas y, with L 2, FIG, SB; Genomic DNA PCS analysis testing for the insertion of the CBDA-relatccl genes in Syneehecyst ⁇ ranstprajants.
  • FIGS, 9A-9B Linear addition of Symch yatis CBDA transforming constructs.
  • FIG. 9A Map of the upper (construct L#l ; 3300 nt) and lower: (construct I 2; 464(3 nt) Sy ciiOcystis eodon-optimlzed caonabidiolic acid (CBDA) biosynthetic pathway-encoding genes, L#1 harbored the AAEL OLS, CMC, and zeociu resistance cassette genes, I harbored the OLS, QAC, C GAS, CBDAS, and cmR eneoding genes.
  • CBDA caonabidiolic acid
  • FIG. 9B Genomic DNA PCR analysis testing for the correct insertion of individual CBDA biosynthesis-relate genes in Synechocystis transformants.
  • PCR «sing WT genomic DNA did not generate a PCR product, as expected, (Lower left panel) Primers ⁇ cpc-usjw-> and 0ACr 1> generated 4,320 bp products both in the L#1 transformant and in three different transformants comprising the L#1 and L#2 constructs, PCR using WT genomic DNA did not generate a PCR product, as expected, (Lower right panel) Primers ⁇ cpc ⁇ mfor> and ⁇ 0£S rev» generated 3,542 bp product both in the L#1 transformant and in three different transformants comprising the L#1 and IJ2 constructs. PCR using WT genomic DNA did not generate a PCR product, as expected. These results strengthened the notion of correct insertion of the entire heterologous CBDA biosynthetic pathway genes inBytie hocpsii ,
  • FIGS. 10A-40B Linear addition of Sjm&skvcysiis CBDA transforming constructs.
  • FIG, 10A (upper): Map of CBDA biosynthetic pathway encoding genes installed as an open)» in the genomie DNA of Syfuschd ys s, Transgenic operon replaced the native cpc operon, under the control of the c promoter.
  • FIG. 10 A (lower); Ma of the heterologous mevalonic acid pathway-encoding genes installed in ihc Syneehocystis gigA i locus, expressed under the control of the Lko promoter, FIG.
  • FIG. IJC Screening by PCR analysis of the second set of colonies transformed with CBDA construct Pffl. For verification of cawretet insertion, ⁇ cpc-t sfi r> m& ⁇ AEi rev> primers were used. Again, colonies 8, 9, 17 and 20 showed the right size products. The results showed that colonies 8, 9, 17 and 20 are successful GBDA construct P#1 transformants.
  • FIG. l2At Map of the CBDA construct Ml (6,674 nt) in the pc operon locus harboring the ALEI, OIS, 0 ⁇ 4C, atoB, cmR genes and CBDA construct P#2 (6,573 nt) in the /wMJ gene loeUS-of Sy ephocystis harboring the npiPGPPS fusion, CBGAS, CBIMS, and swii encoding genes.
  • FIG. 13 SDS-PAGE (left panel) and Western blot analysis (right panel) of wild type and three GBDA biosynthetic pathway transformants, as described in FIG. 12. Lane WT- wild type. Lanes 4, 5, 6: Same as lanes 4, 5, and 6 in FIG. 12. Wild type and transformant cells were grown tinder the same experimental conditions. Lanes were loaded with 0,3 pg cellular chlorophyll, The Coomassie stain in the SDS-PAGE panel showed die distinct presence of the ptl ⁇ GPPS fusion plus CBDAS proteins, both migrating in foe vicinity of 62 kD, and the presence of the CBGAS protein migrating to about 45 kD.
  • FIG. 14 Cyanobaeterial eannabinoid analysis by GC-MS.
  • FIG, 14A standards; FIG. I4B ⁇ cell extracts,
  • FIG. 10 10047 ⁇ FIG. IS. Codon-optimized DNA sequences in operon configuration of the catmabinoi biosynthesis pathway shown in FIG. S, leading to the synthesis of cannahidio!ie acid.
  • the present invention provides methods and composi tions tor producing highly pure, easily isolatable eannabirroids in photosynthetic microorganisms feat can be used for pharmaceutical, cosmeties-related, and other applications.
  • the present method provide numerous advantages for the production of eannabinoids, including that the eanoahinoids can be produce eonstitutively fro the natural photosynthesi of the ceils, with no need to supplement growth media wife antibiotics of organic nutrients, and that the produced cannabinoids can be readily harvested from th growth medium, Further, in some embodiments, the heterologous polynucleotides encoding the enzymes for the production of cannabinoids in the cells are integrated into the genome of the microorganisms, thereb avoiding potential difficulties resulting fro the use of high-copy plasmids.
  • cyanobacteria and other photosynthetie microorganisms contain abundan t thylakoid membranes of photosynthesis, whi ch makes them particularly suitable for the expression and function of the transmembrane CBCiAS enzyme,
  • fiMMii S Tlie genetically modified photosynthetic microorgaiiisnis of the invention can be use commercially in an enclosed mass culture system to provide a source of cannabinoids which can be developed as biophamiaceuticals in: the manifold therapeutic applications of cannabinoids currently employed, of contemplate by the synthetic chemistr and pharmaceutical industries.
  • cannabidiol CBD oil
  • auon-psychoactive substaiiee is currently being explored far a number of indications including for the treatment of paitn inflammatory diseases, epilepsy, anxiety disorders, substance abuse disorders, schizophrenia, cancer, and others.
  • any reference to“about X” specificall indicates at least the values X, 0.SX, 0.81X, 0.82X, 0.83X, 0.84X, 0.85X, 0.86X, 0;8?X, 0.88X, 0.89X, 0; X, 0.91X, 0.92X.
  • nucleic acid or“polynucleotide” refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides: that have similar binding properties as the reference: nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides/ Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (&g, t degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
  • DNA deoxyribonucleic acids
  • RNA ribonucleic acids
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyraosme residues (Saizer et al., ffyekte y M 3 ⁇ 4?s. 19:5081 (1991); Uhtsnka et al, J. Biol. Chem, 260:2605-2608 (1985):; and Rossolioi ei a! , Mol. Cell Probes 8:9X98 (1994)).
  • the ter “gene” refers to the segment of DNA involved in producing a polypeptide chain. It may include regions preceding and following the coding region (leader and trailer) as well as intervening -sequences (intrOns) betwee individual coding segments (exons).
  • a " romoter” is defined as an array of nucleic acid control sequences that: direct transeription of a nucleie acid.
  • a promoter includes necessary' nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase ⁇ I type promoter, a TATA element, A promoter also optionally includes distal enhancer or repressor elements. Which can be located as much as se veral thousand base pairs from the start site of transcription.
  • the promoter can be a heterologous promoter, or an endogenous promoter, e.g , when a coding sequence is integrated into the genome and its expression is then driven by an adjacen t promoter already present in the genome.
  • An“expressi n cassete” is a nucleic acid construct generated recomhinantly or synthetically, with a series of specified nucleic acid dements that permit transcription of a particular polynucleotide sequence in a host eell.
  • An expression cassette may be part of a plasmid, viral genome, or mieleie acid fragment, in some e bodiments, an expression cassette includes a polynucleotide to be transcribed, operably linked to a promoter.
  • the promoter can be a heterologous promoter, in the context of promoters operably linked to a polynucleotide, a “heterologous promoter” refers to a promoter that would not be so operably linked to the same polynucleotide as found in a product of nature (e.g. in a wild-type organism), in some embodiments, the expression cassette comprises a coding sequence whose expression is designed to be driven by an endogenous pron er subsequent to integration into the genome,
  • first polynucleotide or polypeptide i s "hefottldgoits" to an organism or & second polynucleotide or polypeptide sequence if the first polynucleotide or polypeptide originates from a foreign species compared to the organism or secon polynucleotide or polypepdde, or, if from the same species, is modified from its original for ,
  • a promoter is said to be operably linked to a heterologous coding sequence, it means that the coding sequence is derived from one species whereas the promoter sequence is derived fro atiother, different species; or, if both are derived from the same species, th coding sequence is not naturally associated with the promoter (e.g, is a genetically engineered coding sequence).
  • Polypeptide/’“peptide/' and“protein” are use interchangeably herein to refer to a polymer of amino acid residues.
  • Alt three terms apply to amino acid polymers in which one or ore amino acid residue is an artificial chemical mimetic of a corresponding naturally oeeuiring amino add, as well as to natorally occurring amino acid polymers and non-natti U occurring amino acid polymers.
  • the terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
  • “Conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences,“conservatively modified variants” refers to those nucleic acids that encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode ny' given protein. For instance, the codons GCA,
  • GCC, GCG and GCU all encode the amino acid alanine.
  • the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • Such nucleic acid variations are“silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein that encodes a polypeptide also describes every' possible silent variation of the nucleic acid.
  • each codon in a nucleic acid except AUG, which Is ordinarily the .
  • each silent variation of a nucleic acid that encodes a polypeptide is implicit: in each described sequence, fOhhff
  • substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a“conservatively modified varianfi’ where the alteration results in the substitution of an amino acid with a chemically similar ammo acid.
  • Conservative substitution tables providing func tionally simila amino acids are well known in the art Such -conservatively modified variants are in addition to and do not exclude polymorphic variants, interspeeies homolqgs, and alleles, in some cases, conservatively modified variants can have art increased stability, assembly, or activity,
  • the terms“identical” or percen “identity,” in the context of describing two or more polynucleotide oraminp acid sequences, refer to two or more sequences or specified subsequences that are the same. Two sequences that are "‘substantially identical* have at least 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90% 91%, 92%, 93, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithm or by manual alignment and visual inspection where a specific region is not designated.
  • this definition also refers to the complement of a test sequence.
  • amino acid sequences * in some eases, the identity exists over a region that is at least about 56 amino acid in length, or more preferably over a region that is 75- 100 amino acids in length in some emodimenis, percent identity is determined over the M!-length of the amino acid or nucleic acid sequence,
  • sequence comparison typically one sequence acts: as a reference sequence, to which test sequences am compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to fee nrierenee sequence, based on the: program parameters.
  • program parameters For sequence comparison of nucleic acids and proteins, the BLAST 2.0 algorithm and the default parameters discussed below are used,
  • 8(5S A“comparison window”, as used herein, includes reference to a segment of any one of the number of eontiguesus positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a .reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Extension of the ord hits in each direction are halted when: tire cumulative alignment score foils off by the quantity X fro its maximum achieved value; the cumulative score goes to zero or below , due to the accumulation of one or more negative -scoring residue alignments; or the en of either sequence is reached.
  • the BLAST algorithm parameters; W, T, and X determine the sensitivity and speed of t e alignment.
  • the BLASIK program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of I f), M-l , N--2, and a comparison of both strands,
  • W word size
  • E expectation
  • M-l word size
  • N--2 a word size of 2
  • E expectation
  • BLOSUM62 scoring matrix see Henikoff ⁇ fe Henikofy Pmc. Nat t. Amd. SeL USA 89: 10915 (1989)).
  • the BLAST algorithm also performs a statistical analysis of the similarity , between two sequences (see, &g,, Karlin & Altschul, Proc. Natl. Aca Sci, USA 90:;5873 S787 (1 93) ⁇ .
  • One measure of similarity provided by the BL AST algorithm is the smallest sum probability (F(N)k which provides ah indication of the probability by which; a match between two nucleotide or amino aci sequences would occur by chance.
  • F(N)k the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability ⁇ ® a comparison of the test nucleic acid to the reference nucleic acid is less than about 0,2, more preferably less than about 0,0 L and most preferably less than about 0.001.
  • cyanobacteria are modified as described herein to produce cannabinoids.
  • Illustrative cyanobacteria include, e.g via S nechocystis sp., such as strain Synechocystis PC 6803 ; mi& Synechaco ctis sp , e.g., the thermophilic Synechac ccu !fvroses; the .mesop ic I pechocoecus eiongatus and S neckococcus 6301, and the euryhaline Symchoceccus 7002, Mtlt eilular, kiclud g filamentous cyanobacteria, may also be engineered to express the heterologous GPPS and eannabinoid biosynthesis operOn genes in accordance with this invention, including, Gtoeoaxpsa, as
  • Algae e g. ⁇ green microalgae
  • Green microalgae are single cell oxygenic photosyothetie eukaryotic organisms that produce chlorophyll a and chlorophyll b.
  • green microalgae such as Ckkmydomoms reiuhardtii, which is classified as Voiyocales, Ciilamydomonadaceae, Sce desm ohliquus, NaamcMpmpsis, ChlomlL ⁇ .
  • Botryocoecm hmunii Bairyococms sudeiims, DmaMelia Salma, ffaemataeoccus pluviads, Chiofella fused, and Mareta vulgaris are modified a described herein to produce cannahinoids,
  • photosyaithefic microorganisms such as diatoms are modified.
  • diatoms that can be modified to produce cannabinoids in accordance with this disclosure include Pheodaciylum fricprnutim CyliadtOi em Jmifbrmis Cychteila gatima; Nanwchloivpsis oc tlica; and Thakissiosim pseudomma. 4.
  • polynucleotides lOOTi I In the presen t disclosure, pohmudeondes encoding a GPPS enzyme and encoding the enzymes of the eannahinokt biosynthesis pathways e g AAB1, OLS, OAC, CBGAS, and one or more of CHDAS, THCAS, and CBCAS, are introduced into the photosynthetie microorganism, e.gv. cyanobacteria. :
  • GPPS- in particular is overexpressed to ensure a high level of GPP production in the cells.
  • one or more of the proteins may he expressed as a fusion construct, in preferred embodiments, the GPPS enzyme is expressed as a fusion construct, tog. * by fusing the poly ucleotide encoding the GPPS polypeptide ith the V end of a leader nucleic acid sequence encoding a protein that is expressed in cyanobacteria at a level of at least 1 % of the total cellular protein.
  • SEQ ID NO:l discloses the DMA sequence of the nptl GPPS fusion construct, comprising the GPPS gene from Picea abies (Norway spruce ⁇ fused to the npil gene encoding the kanamycin resistance protein, codon optimized for high- level Npt!*GPP protein expression and GPP pool size increase in the cyanobacteriumSynitchmy&tis (Betterle and Metis 2018).
  • SEQ ID NO:2 discloses the amino add sequence of this Nptl:*GPP fusion construct, the expression levels of which approach those of the abundan t RfccL, the large subunit of Ruhisco in the modified cyanobacteria (FIG. 4).
  • Nptl and other fusion proteins to obtain high transgene yields in cyanobacteria an other photosynthetic microorganisms is described ; e.g, * in US Patent Application No, 2018/0171342 and in Application PGT/US2017034754, the entire disclosures of both of which are incorporated herein by reference, f0974
  • Other polynucleotides that may be employed in fusion construct include, e,g,, chloramphe ea!
  • aectyltransferase palynnclcotides; which confer chloramphenicol resistance, or polynucleotides encoding a protein that confers streptomycin, ampiciUin, or tetracycline resistance, or resistatiee to another antibiotic.
  • the leader sequence encodes less than the full-length of the protein, but typicall comprises a region that encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least %, or greater, of the length of the protein in some embodiments, a polynucleotide variant of a naturallyoccurring antibiotic resistance gene is employed.
  • a variant polynucleotide typically encodes a protein that has at least 80% identity, or at least 85% or greater, identity to the protein encoded by the wiid-type gene, e.g,, antibiotic resistance gene, in some embodiments : , the polynucleotide encodes a protein that has 90%. identity, or at least 95% identity, or greater, to the: wild-type antibiotic resistance protein.
  • Such variant polynucleotides employed as leader sequences can also be codon-optimized for expression in cyanobacteria.
  • the percent identi ty' is typically determined ith reference to the length of the polynucleotide that is employed in the construct, i,e,, the percent identity may be over the full length of a polynucleo tide that encodes the leader polypeptide sequence, of may be over a smaller length, erg., in embodiments where the polysmcleotide encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least 95%, or greater, of the length of the protein,
  • a protein encoded by a valiant polynucleotide sequence need not retain a biological ftinciion, although codons that are present in a variant polynucleotide are typically selected such that the protein structure relative to the wild-type protein structure is not substantially altered by the changed codon, e.g. > a codon that encodes aft amino acid that has fee same charge, polarity, and/or is similar in size to the native amino acid.
  • the leader sequence encodes a naturally occurring cyanobacteria or other microorganisnial protein that is expressed at a high level ⁇ e,g., more than 1% of the total cellular protein) in natix3 ⁇ 4 cyanobacteria or the other microorganism of interest, i.e., the protein is endogenous to cyanobacteria or another microorganism of interest.
  • proteins include cpeB, cpeA, cpeA, cpeB, apcA, apcB, rboL, rbcS, psbA, rpl, and rps.
  • the leader sequence encodes less than the full-length of the protein, but it typically comprises a region that encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least 95%, or greater, of the length of the protein.
  • an endogenous microorganismal e.g., eyanobacterial, polynucleotide sequence for constructing an expression construct in accordance with the invention: provides a sequence that need not he codon-optimized, as the sequence is already expresse at high levels in the microorganism, e.g., cyanobacteria, although codon optimization is nevertheless possible
  • cyanobacterial or other microorganismal polynucleotides that encode epcB, epcA, cpeA, epefi, apcA, apeB, rbcL, rbcS, psbA, rpl, or rps are available, e,g,, at the WW website geneme.mierobedbjp/eyanobase.
  • polynucleotide sequence that encodes the leader protein need not he !M identical to a native cyanobacteria or other mieroorganisniai polynucleotide sequenee,
  • a polynucleotide variant that has at: least 70% identity, at least 75% identi ty, at least 80% identity, or at least 85% identity, or greater to a native microorganismal, e.g > , cyanobacterial polynucleotide sequence, c.g, > a native cpeB, epcA, cpeA, cpeB, rbcL, rbcS, psbA, rpl, or rps polynucleotide sequence, is used, again maintaining codon optimization for cyanobacteria o fee microorganism of interest in some embodiments, a polynucleotide variant that has least 90% identity, or at least 9.5% identity, or greater, to a native microorganismal, e,g., cyanobacterial, polynucleotide sequence, e.g., a native cpeB, cpcA, cpeA,
  • the construct i.e., the percent identity may be oyer the full length of a polyirucieotide that encodes the leader polypeptide sequence, or may be over a smaller length, e.g., in embodiments where the polynucleotide encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least 95%, or greater, of the length of the protein.
  • a codon that varies from the wild-type polynucleotide is typically selecte suc that the protein structure of the native eyanobaeterial or other niicroorganismal sequence is not substantially altered by the changed eodon, e.g,, a codon that encodes an amino acid that has the same charge, polarity, and/or is similar in size to the native amino acid is selected.
  • a protein that is expressed at high levels in, the photosynthetie microorganism, e.g., cyanobacteria, is not native to the organism in which the fusion construct in accordance with the invention is expressed, f or example, polynucleotides from bacteria or other organisms that are expressed at high levels in cyanobacteria or other photosynthetie microorganisms may be used as leader sequences, in such embodiments, the polynucleotides from other organisms are codon optiniized for expression in the photosyatheiie microorganism, e.g,, cyanobacteria.
  • eodon optimization Is performed such that codons used with an average frequency of less titan 12% by, e.g., S nedkocystk are replaced by more frequently used codons.
  • Rare codons can be defined, e.g,, by using a codon usage table derived from the sequenced genome of the host cyanobacteriai cell.
  • a protein e g,, GFPS, that is“expressed at high levels” in photosynthetie microorganisms, e,g., cyanobacteria, refers to a protein that accumulates to at least 1% of total cellular protein as described herein.
  • leader proteins When fused at the N -terminus of a protein of interest to be expressed in cyanobacteria of othermicroorganisms, are also referred to herein as“leader proteins”,“leader peptides”, or“leader sequences”,
  • leader proteins A nucleic acid encoding a leader protein is typically referred to herein as a“leader polynucleotide” or '“leader nucleie acid equence” or leader nucleotide sequence”
  • suitable leader proteins can be identified by evaluating the level of expression of a Candidate leader protein in: the photosynthetie. microorganism of interest, e.g. , cyanobacteria.
  • a leader polypeptide that does not occur in the wil type microorganism e.g., cyanobacteria
  • a protein may be selected for use as a leader polypeptide if the protein accumulates to a level of at least 1%, typically at least 2% ; , at least 3%, at least 4%, at least 5%, or at least 10%, or greater, of the total protein expressed in the cyanobacteria when th polyr cleotide encoding the leader polypeptide is introduced into cyanobacteria
  • a GPPS fro Abies gremdis is used, e g,, as show in SEQ ID NC):2.
  • any GPPS enzyme from any species that is capable of catalyzing the synthesis of GPP in the ceils can be used, e.g,, that is capable of catalyzing the productio of GPP from XPP and/or DM APP in the microorganisms,
  • the photosymlietic mieroorgahisms are modified to overexpress the GPP synthase (GPPS) gene, e.g. , by use of a codon-optimized Ahim gr ndis GPP synthase gene fused with the nptfhanamycin resistance DNA cassette (SEQ ID NO: 3 ), i order to overexpress the GPP synthase enzyme in the cell ⁇ SEQ ID NQ:2),
  • GPPS GPP synthase
  • Polynucleotides that are functional variants, conservatively modified variants, and/or that are substantially identical to SEQ ID NO;l s e.g., polynucleotides having 50%, 60%, 70%, 75%, 80%, 85%, 00%, 95%.
  • SEQ ID NO:l one can be used, o a p0lyuueleotide that encodes a protein having substantialidentity, e.g., 50 l ?4, 6:0%/70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identity to SEQ ID Q;2, can be used, in particular when their presence in the cell leads to the generation of sufficient GPP for cannabiuoid synthesis in some embodiments, a polynucleotide haying at least 95% identity to SEQ ID NO:l is used.
  • a polynucleotide dial encodes a protein baying at least 95% identity to SEQ ID NO: 2 is used.
  • the GPPS are codon optimized for the, cyanobacteria or other photosynthetic .-microorganism used in the method
  • Genes encoding enzymes of the can foinoid biosynthetic pathway are known and any such enzymes can be employed in the present methods, from any Species, so long as they ean be functionally expressed in the photosynthetic microorganisms, e.g , cyanobacteria, to effect the biosynthesis of the cannabinoids in the cells, A list of the genes needed to drive the cannabinoid biosynthetic pathway is show» in FIG. 5.
  • THCAS an CBCAS oxidative eyciization of the monoterpene moiety of CBQA for the biosynthesis of Afotetrahydtoeatinahinoiie acid.
  • D9- THCA oxidative eyciization of the monoterpene moiety of CBQA for the biosynthesis of Afotetrahydtoeatinahinoiie acid.
  • D9- THCA eannabiebromenic acid
  • CBCA eannabiebromenic acid
  • genes are included for AAEL QLS, QAC, and CBGAS, as well as for CBDAS, THCAS, or CBCAS, depending on whether CBDA, .49-THC.4, or CBCA, respectively, is desired it will be appreciated, however, that other combinations of genes are possible as well, for example GPPS, AAEl, QLS, OAC, and CBGAS if CBCrA is desired, or GPPS, AAEl, OLS, OAC, as well as CBGAS, THCAS, and CBCA, if a combination of CIBDA, A9-THCA, and CBCA is desired.
  • Tile coding sequences for the: indi vidual genes in the cannabinoid biosynthesis pathway are indicated in SEQ ID Q:3, Le, : , nucleotides 636-2798 for AAEl , nucleotides 2819 ⁇ 3973 for OLS, nucleotides 3994- 4299 for OAC, nucleotides 4320 5507 for CBGAS, and nucleotides 5528-7162 for CBDAS, These sequences, or variants thereof as described herein, can be used individually or in any combination, e.g., within the same openm, to bring about cannabinoid synthesis in the phoiosyuthetic microorganisms, e.g., cyanobacteria.
  • a codon-optimized polynucleotide sequence in operon configuration of the cannabinoid biosynthesis pathway is used, leading to the synthesis of cannabidioiic acid.
  • a polynucleotide is shown as SEQ ID NO: 3, and includes coding sequences for AAEl , OLS, OAC, CBGAS, and CBDAS, whose polypeptide sequences are shown as SEQ ID NO :4, SEQ ID O:5, SEQ !D NO:6, SEQ ID NO:?, an SEQ ID NO: 8, respectively.
  • a polynucleotide that has at least 95% identity to SEQ ID NO: 3 is used.
  • a polynucleotide that encodes a protein having at least 95% identity to SEQ ID NO;: 4, 5, 6, 7, or 8: is used.
  • a poHmncleotide comprising the sequence shown as SEQ ID NO:9 can be used, or a polynucleotide that is substantially identical to SEQ ID NO:9, e.g., at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identical to SEQ ID TSiC>: , or that encodes a polypeptide comprising the amino acid sequence shown a S!Q ID NG;iG can be used, or that encodes a functional variant polypeptide that is substantially identical to SEQ ID NO: 10, e.g,, at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 10, In some embodiments, a polynucleotide that has at least 95% identity to SEQ ID NO: 9 is used.
  • a polynucleotide that encodes a protein having at least 9:5% Identity to SEQ ID NO: 16 is used hi a particular embodiment when A9-DICA synthesis is desired, all of the biosynthesis genes arc present within a single operon, e,g though as shown in SEQ ID NO: 13, or using a polynucleotide having at least 56%, 60%, 70%, 73%, 80%, 85%, 90%, 95 , 96%, 97%, 98%, 99%, or more identity to SEQ ID NO:13. in some embodiments, a polynucleotide having at least 95% identity to SEQ ID NO: 13 is used.
  • a polynucleotide comprising the sequence shown as SEQ ID NOT l can be used, or a polynucleotide that is substantially identical to SEQ ID NOT T c.g , at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identical to SEQ ID NO: 11, or that encodes a polypeptide comprising the amino acid sequence shown as SEQ ID NO: 12, or that encodes a functional variant polypeptide that is substantially identical to SEQ ID NO: 12, e,g ideological, at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more Identical to SEQ ID NO: 12 to some embodiments, a polynucleotide having at least 95% identity to SEQ IP NO; 1 1 is used.
  • a polynucleotide that encodes a protein having at least 95% identity to SEQ ID NO: 12 is used, hi a particular embodimeftt, when CBCA synthesis is desired, all of the biosynthesis genes are present within a single operon, e,g though as shown in SEQ ID NO 14, or using a polynucleotide having at Ieast59%, 60%, 70%, 75%, 8034, 85%, 90%, 95%, 96%, 97%, 98'%, 99%, or more identity to SEQ ID NO: 14 to some embodiments, a polynucleotide having at least 959» identity to SEQ ID NO: 14 is used.
  • the genes encoding the enzymes within: the biosynthesis pathway, ie,, AAE1 , OLS, OAC, and CBGAS, as well as CBDAS, THCAS, and/o CBCAS, can be together present within a single operon (c.g,, as in SEQ ID NO:3 in the case of CB1T4S synthesis, in SEQ ID NO:! 3 in the case of .49-THCA synthesis, or in SEQ ID NO: 14 in the case of CBCA synthesis) or present separately, or in any combination of individual genes and genes in an operon (e.g,, AAE 1 , OLS, QAC, and CBGAS within an operon, and CBDAS separately).
  • a single operon e.g, as in SEQ ID NO:3 in the case of CB1T4S synthesis, in SEQ ID NO:! 3 in the case of .49-THCA synthesis, or in SEQ ID NO: 14 in the case of CBCA synthesis
  • CiPPS can also be included in the operon.
  • the operon can include any combination of 2, 3, 4, 5, 6, 7 or 8 genes selected from GBPS, AAEl , OLS, OAC, CBGAS, CBDAS, THCAS, and CBCAS, and arranged in any order.
  • one or more of the genes wi thin the cannahinoid biosynthesi pathway, and/or the GPlPS gene, individually or as present within one or more operons can be integrated into the genome of the host cell, e.g,, via homologous recombination, in one embodiment, all of the transgenes used in the invention, i.e., GPPS, AAE1 , OLS, OAC, CBGAS, and either CBDAS, THCAS, or CBCAS, are integrated into the host cell genome, in certain embodiments, however, one or more of the genes are present on; an autonomously replicating vector.
  • a ggaattaggaggttaattaa ribosome binding site is positioned in front of fee ATG start codon of one or more of the GPPS and/or cannahinoid biosynthesis pathway genes, in fee photosynthetic microorganisms. This is designed to enhance the level of translatio of all fee genes encoded by the operon or construct.
  • the n ucleic acids of the ggaattaggagghaattaa RBS are a codon-modified variant having at least 80% identity, typically at least 85% identity or 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the ggaattaggaggttaaiia RBS mseleotid.es, in some embodiments* the nucleic acids have at least 95% identity to the ggaattaggaggttaattaa RBS nucleotides.
  • the coding sequences can be codo optimfeed for expression in the cyanobacteria or other nncroorganisms.
  • codon optimization is performed such that codons used with an average frequency of less titan, e.g,, 12% in a species such as Synechocystis (or whichever species is being used to perform themethods) are replaced by more frequently used codons.
  • Rare codons can he defined, e.g./by usinga codon usage table derived from the sequenced genome of the host cyanobacteria! cell or other microorganism.
  • the polynucleotides encoding the GPPS enzyme and/or tee eannabmojd biosynthesis operon are operabiy linked to one or more promoters capable of bringing about the expression of the GPPS and/or cannabinoid biosynthesis ehzymes in the cell at levels sufficient for the biosynthesis of cannab pids
  • tire heterologous polynucleotide eneodteg the GPPS and/or the cannabinoid biosynthesis operon is operabiy linked to an endogenous promoter, e.g., the psbA2 promoter, e.g., by replacing the endogenous gene, e.g., the Sm chocyMis pshA 2 gene, with tire codon-optimized GPPS-eiicoding gene or the cannabinoid biosynteesis Qperori vda double homologous recombination,
  • the GPPB-eneoding polynucleotide andfor the cannabinoid biosynthesis operon are integrated into the genome and clones identified in which GPPS and/or the enzymes of the eannabmoid biosynthesis pathway are produced at sufficiently high levels to obtain eamiabinoid biosynthesis in tee cell, and the polynucleotides encoding the promoter or promoters responsible for the expression, identified by analyzing: the 5’ sequences of the genomic clone or clones corresponding to the GPPS gene or the operon. Nucleotide sequences characteristic of promoters can also be used to identify the promoter.
  • tee G PS-eneoding polynucleotide andfor the cannabinoid biosynthesis operon are operabiy linked to a heterologous promoter capable of driving expression in the pell, e.g., they are linked to a promoter within a vector before being introduced into the cell, and are then integrated together into the genome of the celf or are maintained together on an autonomously replicating vector.
  • 13 ⁇ 4e promoters used can he either constitutive or inducible.
  • a promoter used for driving the expression of the GPPS or operon is a constitutive promoter.
  • constitutive strong promoters for use in cyanobacteria or other photosynthesis microorganisms include, tor example, the psfi l gene or the basal promoter of the psb£>2 gene, or the rbcLS promoter, which is constitutive under standard growth conditions.
  • Other promoters that are active in cyanobacteria and other photosynthetic microorganisms are also known. These include the strong cpc operpo promoter, the epe operon and ape operon promoters, which control expression of phyeohilisome constituents.
  • promoters of the pshAI, psbA2, an psM genes in cyanobacteria may also be used, as noted below.
  • Other promoters that are operative in plants e.g., promoters derived from plant viruses, such as the GaMV35S promoters, or bacterial viruses, such as the T7, or bacterial prompters, such as the PTrc, can also he employed in cyanobacteria or other photosynthetie microorganisms.
  • promoters active in the cyanobacterium Amtbaena sp e.g., promoters active in the cyanobacterium Amtbaena sp.
  • a pro oter is used to direct expression of the inserte nucleic acids under the influence of changing environmental conditions.
  • environmental conditions that may affect transcription by inducible promoters include anaerobic conditions, elevated temperamre. or the presence of light. Promoters that are inducible upon exposure to chemical reagents are also used to express the inserted nucleic acids.
  • Other useful inducible regulatory elements include copper-inducible regulatory elements (Met ef al, Proc. Natl Acad. Set. USA 90:4567-4571 (1993); Furst et a!,. Cel!
  • An inducible: regulatory element also can be, for example, a nitrate-mdueible promoter, derived from the spinach nitrite reductase gene ⁇ Back etal., Plant Mol Biol 17:9 (1991)), or alight- nducible promoter, such a that associated with the small subunit of RuBP carboxylase or the LHCP gene fa ilies (Peinhaum et el, Mot Gen, Genet. 226:449 (1991); Lam aiid Chua, Science 248:471 (1990)),
  • the promoter is from a gene associated with photosynthesis i the species to be transformed or another species.
  • a promoter from one species may be used to direct expression of a protein in transformed cyanobacteria or other photosynthetie microorganisms.
  • Suitable promoters may be isolated fk>m or synthesized based o . a known sequences from other photosyntlietie organisms,
  • the methods comprise introducing expression cassettes that comprise nucleic acid single genes or operons encoding the genes of the camiabinoid biosynthetic pathwa (FIG, 5) into the photosynthetie microorganism, e,g cauliflower cyanobacteria * wherein the operon is linked to a epc promoter, or other suitable promoter; and culturin the microorganism, e.g., cyanobacteria under conditions in hich the single gene or nucleic acids encoding the cannabinoid biosynthesis operon are expressed.
  • expression cassettes are introduced into flie xfrdPgene locus, eneoding the Dl/32 kD reactio center protein of photosystem-II, in which ease the 2 promoter is the native cyanobacteria promoter.
  • expression cassettes are introduced into the g!gAl gene locus, encoding the glycogen synthase 1 enzyme, in which ease the g!gAl promoter is the native cyanobacteria prompter:
  • the polynucleotides encoding the GFPS enzyme, e,g., a GPPS fusion protein, and encoding the members of the cannabihoid biosynthesis pathway are introduced into the ceils using a vector.
  • markers are known, for example markers encoding antibiotic resistance, such as resistance to chloramphenicol, kanamyciu, spectinomycio, etythromycin, G418 » bleomycin, hygromycin, and the like.
  • Cell transformation methods and selectable markers for cyanobacteria and other photosynthetie mictoorgairisrfts are well known in the art (Wirth, MQI. Gen . Genet ⁇ . 2l6 ⁇ 1): 175-7,1989; Koksharova, AppL Micr hiol, Sioteehn 58(2); 123-37, 2002; Thelwell et aL Froc. Natl Aead. Set LISA .
  • an expression construct is generated to allow the heterologous expression of the npff*GPPS and/or the eaunabinoid biosynthesis operon genes in$yiwcfw $tis through the re lacement of the Syneckocystis psbA2 gene wit the codon- optimized nptI*GPPS or cannabinoid biosynthesis ope on genes via double homologous recombinaiion.
  • the expression: construct comprises a codon-optimixed nptl*GPP$ or the eannabmoid biosynthesis operon genes gene operabfy linked to an endogenous cyanobacteria promoter, in some aspects, the: promoter is the p$hA2 promoter,
  • vector includes sequences for homologous recombination to insert the fusion construct at a desired site in a photosynthetic microorganismak e.g., cyanobaetetial, genome, .g. * such that expression of the polynucleotide encoding the fusion construct is driven by a promoter that is endogenous to the organism.
  • Vectors to perform homologous recombination include sequences required for homologous recombination, suc as flanking sequences foat share homology with the target site for promoting homologous recombination,
  • the, photosynthetie microorganism e.g,, cyanobacteria
  • an expression vector comprising fhe npil GPP$ or the cannabinoid biosynthesis operon genes and an antibiotic resistance gene
  • Transfermants are cultured i selective media containing a antibiotie to which an tmtraiisformed host cell is sensitive.
  • Cyanobacteria for example, normally have up to 1 (50 copies of identical circular DNA chromosomes in each cell.
  • cyanobacteria! or other mieroorgaiiismai transformants are cultured under continuous selective pressure conditions (presence of antibiotic over many generations) to achieve DNA homoplasmy in the transformed host; organism.
  • continuous selective pressure conditions presence of antibiotic over many generations
  • Homoplasmy can be determined, e.g., by monitoring the genomic DNA composition in the cells to test for the presence or absence of wild-type copies of the cyanobacierial or other microorganismal DNA,
  • “Achieving honioplasmy” refers to a quantitative replacement of most, s,g., 70% or greater, or typically all, wild-type copies of the cyanobacteria! DNA in foe cell with foe transformant DNA copy that carries die nptl*GPI > & and foe cannabinoid biosynthesis operon traosgenes. This is normally attained Over time, under th continuous selective pressure (antibiotic) conditions applied, and entails the gradual replacement during growth of the wikh type copies of the DNA with the transgenie copies, until no Wild-type cop of the cyanobacierial or other mleroorganismal DNA Is left in any of the transformant cells.
  • Achieving homoplasmy is typically verified by quantitative amplification methods such as genomic-DNA FCR using primers and/or probes specific for the wild-type copy of the cyanobacteria! DNA,
  • the presence of wild-type cyanobacteria! DNA can fee detected by using primers specific for the wild-type cyanobaeterial DNA and detecting the presence of .g., the native pe operon, gigA l arpsM 2 genes.
  • Transgenic DNA is typically stabl e under homoplasmy conditions and present in all copies of the cyanobacierial DN A.
  • the photosytthetie microorganism eg. cyanobacteria
  • the photosytthetie microorganism is cultured under conditions in which the light intensity is varied.
  • the photosytthetie microorganism eg. cyanobacteria
  • transformed cyanobaeterial cultures can be grown at low light intensity conditions (e.gr,, 10-50 pmol photons m 2 s then shifted to higher light intensity' conditions (e.g , 500-1 ,000 pmol photons m - s 4 ).
  • cyanobaeterial cultures can; be exposed to increasing light intensit conditions (e.g., from 50 pmol photons m 2 to 2,500 p ol photons m - s f ) corresponding to a diurnal increase in light intensity up to full sunlight.
  • the psbA2 promoter responds to the gradual increase in light intensity by up-regulating the expression: of the nptI*CrPP$ or the cannabinoid biosynthesis operon genes hi Svneehocytitis in parallel with the increase in light intensity,
  • eyanpbacterial or other microbial cultures are cul tured under conditions in which the cell density is high and transmitted light intensity through the culture is steeply attenuated.
  • a epe promoter is used as a promoter to drive expression of Hptf*GFPS or the cannabinoi biosynthesis operon genes
  • transformed cyanobacteria! cultures can be grown at cell densi ty conditions in which incident light intensity is high but irradiancc entering the culture is quantitatively absorbed due to the high density of the culture, a desirable property for commercial exploitation (e,g. I g dry cell biomass per L, culture) .
  • the epe promoter responds to the diminishing light intensity within the culture by up- regulating the expression of the associated nptf*GPP$ or the cannabinoid biosynthesis operon: genes mSyneckoeysfis, typically at least about 10-fold.
  • the epe promoter responds to the gradual decline in effective light intensi ty transmitted through the culture by up-regulating the expression of the nptl ⁇ GPFS or the cannabinoid biosynthesis operon genes in S tiethocystis in a function antipafallel with the lowering in light intensity.
  • transformant photosynfhciie mieroorpnisms eg;, cyanobacteria
  • cyanobacteria transformant photosynfhciie mieroorpnisms
  • Methods o mass culturing photosynthetie microorganisms, &g.. cyanobacteria are known to one, skilled in the art.
  • Cyanobacteria or other microorganisms can be grown to high ceil density in photobioreaetors (see, e.g., lee et hi., Biotech.
  • photobioreaetors include cylindrical of tubular bioreaetors, sec, e.g , tLS, Pat Nos, 5,958,761, 6,083,740, US Patent Application Publication No, 2007/0048859; WO 2007/Di 1343, and W02007/09gl50.
  • Hip density photobioreaetors are described in, for example, Lee, et al, Biotech Bioengineering 44:1 161 -1167, 1994
  • Other photobiorcaetors suitable for use in tire invention are described, e:g combat in WG/2011/034567 and references cited therein, e.g,, in the background section, Phntobioreaeior parameters that can be optimized, automated and regulated for production of photosynthetie organisms are further described in Mr (Arr ⁇ Microbiol Biotechnol 57:287- 293, 2001 ), Such parameters include, but are not limited to, materials of construction, efficient light delivery into the reactor lumen, light path, layer thickness, oxygen released, salinity and nutrients, pH, temperature, turbulence, optical density, and the l ike,
  • Transformant photosyathetic microorganisms g,, eyanpbacteria, that express a heterologous npi GPPS and the eannahinoid biosynthesis operon genes can be grown under mass culture conditions for the production of eanightoids.
  • the transformed organisms are grown in bioreactors or fermenters that provide an enclosed : environmetif,
  • the cyanobacteria are grown in enclosed reactors in quantities of at least about 100 liters, or 500 liters, often of at least about 1000 liters or greater, and in some embodiments in quantities of about 1,000,000 liters or more.
  • Large-scale eidturc of transformed cyanobacteria dial comprise a heterologou nptI*GPPS and the eannahinoid biosynthesis operon genes where expression is driven, by a light sensitive promoter, such as a pshA2 or epe promoter, is t pically carried out in conditions where the culture is exposed to natural sunlight. Accordingly, in such embodiments, appropriate enclosed reactors are used that allow light to reach the cyanobacteria or other microbial culture,
  • cyanobacteria or other mictoorganisnis may be rown on solid BCi-M media (see, e g. ⁇ Rippka ei at, J. Gm MidroMol .1 11 : 1 -hi , 1979), Alternatively, they may be grown in liquid media ⁇ s e.g , Bentley, FK and Melis, A. Blaiechiiol Bioeug. 109: 100-- ] 09. 2012).
  • liquid cultures are employed for example, such a liquid culture may bemaintained at, e,g,, about 25 °G to 35 under a slow strea of constant aeration and illumination, &g., at 20 pmol photons m “? s or greater.
  • an antibiotic e.g , chloramphenicol
  • chloramphenicol may he used at a concentration of 15 pg/ml.
  • photosynthetic microorganisms g., cyanobacteria* transformants: are grown pheioautotrophieaUy in a gaseons/aqneous two-phase photobioresetor (see, e.g., United States Patent 8,993.290; also Bentley, FK. and Melis, A . BiotechnoL Sioeng., 109: 100-10 (2012)).
  • the methods of the present invention comprise obtaining cannabinoi s using a diffusion- ased method for spontaneous gas exchange in a gaseous/aqueous two-phase photobioreaotor (see, ag., United States Patent 8,993,290).
  • carbon dioxide is used as a feedstock for the photosynthetic generation of cannahinoids in. cell culture, and the headspace of the bioreactor is filled with 100% C0 2 am! sealed. This allows diffusion-based CO uptake and assimilation by the cells via photosynthesis, and eonemfti tantreplaeement of the CO ? in the headspace with O .
  • the pliotosymkerically generated cannabraoids accumulate as a nan-miscible product floating on the to of the liquid culture.
  • a gaseous/aqueous two-phase photo- bioreaetor is seeded with a culture of microbial, e.g., cyanohacteriab cells and grown under continuous illumination, eg., at 75; nmol photons nr ; s h and continuous bubbling with air.
  • Inorganic carbon is delivered to the culture in the form of aliquots of 100% CO gas, whic is slowly bubbled through the bottom of the liquid culture to fill the bioreaetor headspace.
  • Gnee atmospheric gases ar replaced with 100% G0 3 ⁇ 4 the headspace of tiie teactor is sealed and the culture is incubated, e.g., at about 25°C to 40 & C under continuous illumination, e.g., of 50 nmol photons m r f or greater up to full sunlight
  • Slow continuous mechanical mixing is also employed to keep cells in suspension and to promote balanced pell illumination and nutrient mixing into the liquid culture in support of photosynthesis and biomass accumulation, Uptake and assimilation of headspace GO ? by cells is coneomi tatrtly exchanged for O* during photoautotrophic growth.
  • the sealed bioreaetor headspace allows for the trapping, accumulation and concentration of photosyauhetieally produced catinabinoids.
  • the photoaatotrophic cell growth kinetics of the microbial, e.g., cyanobacteria, transformants are similar to those of wild type cells in some embodiments, tile rates of oxygen consumption during dark respiration are about the same in wild-type cyanobacteria or other photosynihetic microbial cells.
  • the rates of oxygen evolution and the initial slopes of photosynthesis as a function of light intensity.'' are comparable in wild-type Sywckocystjs cells and Syned c tis transformants, when both are at sub-satufating light intensities between 0 and 25ft p ol photons nr 2 s _! .
  • Gannabinuids produced by the modified cyanobacteria or other microorganisms can be harvested using knowm techniques, Gannabinoids are not miscible in water and they rise to and float at the surface of the microorganism growth medium. Accordingly, in some embo i ents cannabinoids are siphoned off from the- surface- of the growtlt medium and sequestered in suitable containers, or floating eannabinoids are skimmed from the surface of the liqui phase of the culture an isolated in pure form.
  • the photosymthetipally produced non-miseible eaiioabinoids in liquid form are extracted from the liquid phase by a method comprising overlaying a solvent such as heptane, deeane, or dodecane on top of the li quid culture in the biorcaetor, incubating at, e.g., room temperature for about 30 minutes or longer; and removing tire solvent, e.g * heptane, layer containing the eannabmokls,
  • the eannabmokls produced by the modified cyanobacteria or other microorganisms are extracted from the interior of the cells.
  • the cells can be isolated, e,g., by centrifugation at 5,000 for 20 minutes, and then resuspended In, e.g,, distilled waten
  • the resuspended cells can then be disintegrated, e,g., by forcing the cells through a French press ⁇ e.g., at 1500 psi), by sonic-atk , or treating them with glass beads.
  • the resulting crude cell extract can then he centrifuged, e.g,, at 14,000 g for 5 minutes, and the supernatant ⁇ or “disintegrated cell suspension”) used for extraction of th cannabinoids.
  • the cannabinoids are extracted by first mixing the disintegrated cell suspension with a strong: acid and a salt, e.g., HIBOL and MaCl, to ease the separation of the; aqueous phase from: the solvent phase, and to force hydrophobic molecules such as CBD to migrate to the solvent phase, Sneh methods arc known in the ail, in some embodiments, HaSO and NaCi are added at a volume-to-volunie ratio of about [cell suspension / H2SO4 / NaCl - 3 / 0,12 / 0.5], The suspension can then be extracted with one or more Organic solvents, e.g., hexane, heptane, ethyl acetate, acetone, m
  • the organic layer can then be separated from the aqueous medium and dried by solvent evaporation* leaving the cannabinoids in pure form.
  • the purified cannabinoids can then be resuspended and analysed, e.g., using GC-MS, CiC-FlO, or absorbance spectroplmtoinetry such as D ' V spectrophotometry.
  • Example 1 Cannabrooifi production using genetically engineered cyanobacteria
  • the present invention provides methods and compositions for the genetic modification of cyanobacteria to confer upon these microorganisms the ability to produce cannabinoids upon heterologous expression of a nptf*GPPS fusion construct fro Norway spruce (Pieea abies) and the eannabineid biosynthesis operon genes fro cannabis ⁇ Cannabi saliva) or a variant thereof in some embodiments * the invention provides for production of earinabmoitfs in pseous-aqueous two-phase photobioreaetors and results in the renewable generation of a hydrocarbon bio-product which can be used, e:g , for chemical syn thesis , or for pharmaceutical, medical, and eosmetics-related applications.
  • This example illustrates the expression of the heterologons npiPGPPS and earmabinoid biosynthesis operon genes for the production of eannabinoids.
  • camiabinoids can be eontimiously (eonstitutively) generated in cyanobacteria transformants that express the heterologous npti ⁇ GPPS fusion construct and cannabinoid biosynthesis operon genes
  • this example demonstrates that eannabinoids can spontaneously diffuse out of cyanobacteria transformants and into the extracellular water phase, and be collected from the surface of the liquid cidture as a water- floating product
  • This example also demonstrates that this strategy for production of eannabinoids alleviates product feedback inhibition, product toxicity to die cell, and the need for labor-intensive extraction protocols,
  • the eannabinoids were spontaneously emitted by the ceils into the extracellular space, after which they floated to the surface of the liquid phase where they were easily collected without imposing any disruption to The growih/productivlty of the celts,
  • the genetically modified cyanobacteria remained in a continuous growth phase, coostitutively generating and emitting eannabinoids.
  • the example further provides a: eodon-optimixed npiI*GPPS fusion construct and cannaMnoid biosynthesis opero genes for improve yield of eannabinoids in photosynthetie cyanobacteria, e.g , Synechocy lis.
  • the ⁇ . coU strain "DH5d was used for routine subcloning and plasmid propagation, and was grown in LB media with appropriate antibiotic as selectable markers at 37 °C, according to standard protocols ⁇ .
  • the glucose- olerant cyanobacteria! sfaai& yneehqeysiis sp. PCC 6803 (Williams, JGK (1988) Methods EnzymoL 167:766-768) was used as the recipient strain in this study* ari is referred to as the wild type.
  • Wild type and transformant strains were maintained on solid BG-11 media supplemented with 10 roM TES- aQH (pH 8,2), 0.3% sodium thiosulfate. and S mM glucose. Where appropriate, chloramphenicol. k ramyoin, spectmomycin, or erythromycin were used aft a concentration of 15-30 pg/mL. Liquid cultures were grown in BG- 11 containing 25 mM sodium phosphate buffer, pH 7,5.
  • Liquid cultures for inoculum purposes and tor photoautofrophic growth experiments and SDS-PAGE analyses were maintained at 25 £' C under a slow stream of constant aeration and illumination at 20 pmol photons nr 3 s L
  • the growth conditions employe when measuring the production of catmabinoids from Syneckocyst cultures are described below in the cannabinoid production assays section.
  • the nucleotide and translated protein Sequences of the heterologous h r ⁇ I ⁇ RR8 fusion construct and cannabinoid biosynthesis operon genes were obtained from the NCBI GenBank database (National Center for Biotechnology Information; see, e.g., able 1).
  • the protein sequences of the heterologous nptI*GPPS fusion construct and cannabinoid biosynthesis operon gene products ere obtained from the NCBI GenBank database (National Center for Biotechnology Information; see, 1.g,, SEQ ID NOS:2, 4-8, The eodon-use of the resultin e-DMAs was then optimized for expression in Synechacystis ap.
  • PCC 6803 and £, c -oli SEQ ID NOT and SEQ ID NOG
  • c -oli SEQ ID NOT and SEQ ID NOG
  • the codon-optimiKation process was performed based on the codon Usage table obtained fro Kazttsa DNA Research Institute, Japan (*3 ⁇ 4*?, e.g: , the www website kaznsa.ofop/eodon/), and using the“Gene Designer 2,0” software from DNA 2,0 (see, e.g., the W W Website drta20.com/),
  • the codon-optimized genes were designed with appropriate restriction: sites flanking the sequences to aid subsequent cloning steps.
  • Samples for SDS-PAGE analyse were prepared from Synechocys s cells resuspende in phosphate buffer pH 7.4 at a concentration of 0.12 mg/ml chlorophyll. The suspension was supplemented wife 0.05% w v lysoz e (Thermo Scientific) and incubate with shaking at 37 3 C for 45 min. Cells were then pelleted at 4,000 g, washed twice with fresh phosphate buffer and disrupted with a French Pressure chamber (Am!nco, USA) at 1500 psi in the -presence of 1 niM PMSE Soluble protein was separated from the total cell extract by centrifugation at 21,000 g and removed as the supernatant fraction.
  • Any kDTM (BIO-R D) precast SDS-PAGE gels were utilized to resolve proteins, which were then transferred to PVDF membrane (!mmobi!on-FL 0.45 pm, Miilipore,USA) for immnnodeteetion using the rabbit immune serum containing specific polyclonal antibodies against the proteins of interest.
  • Cross- reaetions were visualized by the Supersignal West Pico Chemiluminiscent substrate detection system (Thermo Scientific, . USA).
  • Chlorophyll a concentration in cultures was determined speetrophotometrieaily in 90% methanol extracts of the cells according to Meeks and Castenholz ⁇ Arch. Mikrdbwi 78:25-41, 1971). Photosynthetie produetiyiiy of the cultures was tested polarographieally with a Clark-type oxygen electrode (Rank Brothers, Cambridge, England). Cells were harvested at the mid-exponential growth phase, and maintained at 25”C in .BCrl 3 containing 25 mM HEPES-NaOH, pH 7.5, at: a chlorophyll a concentration of 10 pg/mE.
  • Oxygen evolution was measured at 25 C in the electrode upon yellow actinic illumination, which was defined by a C 3-69 long wavelength pass cutoff filter (Coming, Coming, NY).
  • i3 ⁇ 4otosynthetic activity of a 5 mL aliquot of culture was measured at varying actinic light intensities in the presence of 15 mM NaHCCh pH 7.4, added to provide inorganic carbon substrate and thereby facilitate generation of the light saturation curve of photosynthesis.
  • Culture biomass 'accumulation was measured gravimetrically as dry cell weight, where 5 ml, samples of culture were filtere through 0.22 pm Millipore filters, washed three times to remove nutrient salts. Subsequently, the immobilized ceils were dried at 90 °C for 6 h prior to Weighing the dry ceil weight.
  • Inorganic carbon was deli vered to the culture in the form of 500 uiL aliquots of .100% COj gas, which was slowly bubbled though the bottom of the liquid culture to fill the bioreactor headspace. Once atmospheric gases were replaced with 100% OOj, the headspace offhe reactor was sealed and the culture was incubated under continuous illumination of 150 pmol photons nr 2 s i; at 35°C.
  • Oven temperature was initially maintained at 40 °C for 4 min, followed by a temperature increase of 5“C/mirs to 80 °C, and a carri er gas (helium) flow rate of 1.2 ml per minute, Absorbance spectrophotometry analysis was carried out: with a Shimadzu IJ V-I MO spectrophotometer.
  • Tlie tiative Escherichia cofi K12 - pfl gene, the Picea aMes (Norway spruce) GGPS gene, and the native Cmmbis sativa eannabinoid biosynthesis genes have codon usage different from that preferred by photnsynihctie microorganisms, e.g., cyanobacteria and mictoalgae.
  • the unicellular cyanobacteria SytiechmysiL ⁇ sp. were used as a model organism in the development of the present invention. Lie novo codon -optimised nptI &GPS, and C&mahis smiva.
  • eannabinoid biosynthesis genes were designed and Synthesized.
  • SEQ ID NO; 1 an SEQ ID NO:3, the codon usage was adapted to eliminate codons rarely used in Synmtuxystis, and to adjust the GC/AT ratio to that of the host.
  • Rare codons were defined using a codo usage table derived from tlie sequenced genome of Sy diOcyst
  • the SEQ ID NO: 1 and SEQ ID NO:3 sequences used in this example were: the codon-optim ed npil, GGPS. pud Cmnabis sativa eannabinoid biosymhesis genes for expression in Sytiedwcystis.
  • Sy ehoeystis can be used for heterologous transformation using the nptI, GGPS gene, and the CamiaPis sativa eannabinoi biosynthesis genes, and that such transformants expressed and accumulated the respective proteins in their cytosol.
  • wild type and transformants were cultivated under the conditions of the gaseous/aqueous two-phase bioreactor (Bentley FK and Metis A. (20G2), Biotedinol Biaeng.
  • Samples were obtaine from the surface of liquid cultures (to detect non-niiscible liquid cannabinoids floating on top of the aqueous phase) and analyze by GC-FID (e.g., FIG, 6) of GC-MS (e.g., FIGS. 14.4-148).
  • GC-FID e.g., FIG, 6
  • GC-MS e.g., FIGS. 14.4-148
  • Criteria for foe selection of potential commodity produets include (i) foe commercial utility of the compound and (it) the question of product separation from the biomass, which enters prominently in the room of the proces and i a most important aspect in commercial application.
  • This example demonstrates that catraaMrioids are suitable in this respect, as they are not miscible in water, spontaneously eparating from foe biomass an ending-up as floating compounds on the aqueous phase of the reactor and culture that produced them.
  • eanoabinoids are extracted from plants, sueii as Cannabis which, depending on the species, may contain a variety of can ahinoids and other compounds in their glandular frichome essential oils.
  • photosynthetic microorganisms e.g., cyanobacteria and jm6roa1gae> through heterologous expression of, e.g., the vpft*GPPS & the cannahinoid biosynthesis operon genes in a reaction of the native MEP and heterologous MVA pathway, driven by the process of cellular photosynthesis
  • the carbon atoms used to generate eannabinoids in: such a system originate front COy cyanobacteria) and nrieroalgal production represents a carbon-neutral source of biopharmaceutieal and medicinal compounds
  • Cannahinoids woul also be suitable a a feedstock an building block for the chemical synthesis of al tern
  • Cyanobaeterial cells (Syneehocystis) were transformed with genes of the cannabidioiic acid (CBOA) biosynthetic pathway (FIGS, 8-13), Cells were grown in 150 ml, liquid media for 3 days. The starting culture OD730 was 0.2. One hundred twenty-five (125) mL were centrifuged at 5000 g for 20 min. The pellet was resuspended in 5 mL distilled water. Passage of the cells through French press at 1,500 psi resulted in disintegration of the cells.
  • CBOA cannabidioiic acid
  • the crude cell extract was centrifuged at 14,000 g for 5 min to remove large debris and the supernatant was used for cannabinoid extraction, as follows.
  • 3 mL of the supernatant were mixed with 0.12 L of HjSCL and 0,5 mL of 30% (wry) NaCi. This mix was extracted with i mL of hexane, The organic layer was separated from the aqueous medium and dried by solvent evaporation.
  • the dry extract was resuspended with 0.1 ml, of BSTFA including 1 % TMCS (deri vatization reagents) and injected in: GC-MS for content analysis, CG- MS standards were prepared by drying the original sohxmt and resuspending in BSTFA ⁇ ! ⁇ 1% TMCS prior to injection in the GC-MS.
  • the results, presented in Table 2, showed evidence for the presence of CBOA (most abundant), €BD, Olivetolie acid and Olivetol in the transgenic cell extracts.
  • SEQ ID s O L DNA sequence of nptJ*GfiPS fusion construct for protein overexpressiou
  • RBS Nucleotides 4300-4319
  • UPPER CASE 4 - CBGAS: Cannubigeroiic acid synthase (Nucleotides 4320-5507)
  • RBS Nucleotides 5508-5527
  • the cpo is Operon downstream sequence for homologous recombination (Nucleotides 7882-8442)
  • PKSK.O HLfErSASl'TDMPGADYHCAKLLGLSPSVRRVMMYpLGCyGGG ' rVLRlAKD
  • ERPlFELVSXGOXiEPMSEGXiGG REAGLJFDLHKDYPMElSNNlERGLlEAFrPiGiSD
  • SEP ID NO: 6 PAG: Olivetollc acid cyclase (OAC)
  • SEP ID O 7: CBGAS; Caanabigerolie acid svathase
  • SEP ID MQ APdetrahYdrocamiahmoHc acid synthase (1 ICAS) gene
  • SEQ IP NO:! 1 Gannabichro enic acid synthase (CSC 1 AS) gene
  • GCGCGACGTl GGGGGAAGrrmCTACTGGATTAATGAAATGAATGAAAAXTTCA
  • CAAACTGACGl AGATCAGl ACGGAAACGXGTGTGCT-rAGTTGGGXAGGGArTA

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Virology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Botany (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nutrition Science (AREA)
  • Cell Biology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention provides methods and compositions for producing cannabinoids in photosynthetic microorganisms, e.g., cyanobacteria.

Description

PRODUCTION OF CANNABINOIDS USING GENETICALLY ENGINEERED PI tOTOSYNTHETIC MICROORGANISMS
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001 j The present application claims priority to ITS. Provisional Application No,
62/S 12,906, filed March 1, 2019, the disclosure of which i s incorporated herein in its entirety.
BACKGROUND OF THE INVENTION
[0002 j Interest in and use of Cannabis sativa products has expanded recently. The specific interaction of cannabinoids with the human endocaonabinoid system makes these compounds attractive products to be used for therapeutic purposes and for the treatment of a number of medical condi tions. However, understanding of the physicochemical properties and stability of these compounds is limited, production yield is low, and moreover, there is a variable range and mix of products produced by different Cannabis satim cirttivars and other plants. This variability is -further exacerbated by variable growth conditions. Agricultural production of cannabinoids is subject to additional challenges such as plant Susceptibilit to climate and disease, variable yield and product composition due to prevailing cultivation and climatic conditions, the; need for extraction of cannabinoids by chemical processing and, by necessity , the, harvesting of a mix of products that need to be purified and certified for biopharmaeeutieal use,
fO003| The biosynthesis of cannabinoids by engineered microbial steins could e an alternative strategy for tine production of these compounds. Accordingly, there is a need to develop the relevant biotechnology and produce the chemically different cannabinoids individually,: in pure form, so as to alleviate the above-mentioned difficulties and to enable the unambiguous application of these chemicals in: the pharmaceutical industry.
111004} Gannahinoids are terpenophenolic compounds, generated upon the reaction of a 10- catbon isoprenoid intermediate with a modified fatty acid metabolism precursor as par of the secondary metabolism of QmmMs ative and other plants (Carvalho eta!, (2017) FEME feast Res 17). More than 100 different chemical species belonging to this class of compounds have been identified (Carvalho et at. (2017), FEME Yeast Res 17(4); Zirpel et at (2017), JBiotectm 259, 204-212). fOiflSJ Photosynthetie microorganisms, sueh as niicroalgae and cyanobacteria, utilize the MethykTythritol 4-phosphate (MEP) pathway, which generates geranyl diphosphate/ (GPP) intermediates, and utilize the corresponding isoprenoid pathway enzymes for the biosynthesis of a great variety of endogenously needed terpenoid-type molecules like carotenoids, toeopherols, phytol, sterols, hormones, and many others (see, FIG, 1), The MEP isoprenoid biosynthetic pathway (Lindberg et al (201 Q), Metah Eng , 12:70- 79) consumes pyruvate and glyeeraidehyde-3-pb08phate (G3F) as sUbstratesv which are eosnbined to form deoxyxylulose- 5-phosphate (DTiP), as first 4ascnbe-6 f Escherichia coll (Rohmer et al (1993), Biockem. J., 295:517-524). DXP is then converted into methylerythritol phosphate (MEP), which is subsequently modified to term hydrox:y-2-meihy]-2-butenyl-4-diphospbate (MMBPP), IIMBPP is the substrate required for die formation of isopenteny! diphosphate (IPP) and dinrethykllyi: diphosphate (DMAPP), which are the universal terpenoid precursors. Cyanobacteria also contain ail IPP isbmerase (ipi in FIG. 1) which catalyzes the inter- conversion of IPP and DMAPP. In addition to reactants G3P and pyruvate, the MEP pathway consumes r edueihg equivalents and cellular energy in tlie form. of NADFli, reduced ferredox in, DTP. and ATP, ultimately derived from photosynthesis. For reviews, see, e,g., Ershov et at (2,002), J. Bactenol 184(18):5fl45-St)51 ; Sharkey M el (2002), Arm. Sat 101(1 ):5~f 8; Bentley et al (2014), MciL Plant 7:71-86,
ί0ίKM>] The 5-carbon (5-C) isoniciie molecules dimethylallyl diphosphate (DMAPP) and isopenteny! diphosphate OFF) are the universal precursors of all isopretoids (Agranoff et aL (1960); Lichtentha!er (2010))^ comprising units of 5-carbon configurations, Two distinct and separate: biosynthetic pathways evolved independentl in nature to generate these universal DMAPP and IPP precursors (Agranoff eta!. (I 60), J. Biol C hem , 236, 326AΪ32; Lichtenthaler (2001) Phot ynih, Res 9.2, 163-179; Lichtenthaler (2010), Chem. Biol, Volatiles, pp 11 -47), Most fermentative aerobic and anaerobic bacteria, attexygeme photosynihetie bacteria, cyanobacteria, algae (micro & macro), and chloroplasts in all photosynthetie organisms operate the methylei thritol 4~phosphate (MEP) pathway, as described above, beginning with glyceraldefa de 3 -phosphate and pyruvate metabo Sites (FIG.1). Archaea, yeast, fungi, insects, animals, and the eukaryotic plant cytosol generally operate the mevalonic acid (MYA) pathway, whieh begins with aceiyl-CoA metabolites (Lichtenthaler (2010) Chem BiolVolatiles, p 1 .1 -47; MeGarvey and Croteau (1995), Plant Cell 7, 1015-] 026; Sehwender et al (2001), Plant : 212, 416-423) (FIG. :2). Both pathways result in: the synthesis of Identical DMAPP and IPP metabolites. Synthesis of geranyl diphosphate (GPP) is due to the presence of a geranyl diphosphate synthase (GBPS) gene tha t condenses, in a tail to head linear addition, anlPP to a DMAPP molecule (FIG. 3), GPP is the intermediate prenyl metabolite that reacts in flie cannabinolb biosynthetic pathway for the synthesis of eannabinoicis. Although photosyathetic microorganisms such as mieroalgae and cyanobacteria utilise the MEP pathway, which generates the DM APP and IFF precursors, these microorganisms do not need and do not actively and directly express the GPPS enzyme (Betterle and Melis (2018), ACS Symh. £iol. 7, 912-921), nor do they accumulate noticeable levels of the GPP metaholite;
|00»7J The dedicated pathwa for the cellular synthesis of cannahinoids (FIG, 5) commences wif exanoic acid, a 6-earbon intermediate in the fatty acid biosynthetic pathway. Action by acyl activating enzyme 1 (AEE1) converts the hexaooid acid: to its coenzyme A (Hexanoyl-CoA) form (Stout et al (2012), Plant 171 -353-55; Carvalho et al. (2017), ASMS feast M s 17; Zitpel et al, (2017), J Bioiechtl 259, 204-212) , Action of the enzymes olivetol synthase (GLS), which is a type III polyketidc synthase; and olivetolic acid cyclase (OAC), which is a poiy etide eyc!ase, eombines one molecule of hexanoyl-CoA and three molecules of malonyl-CoA reactants, followed by cyclization of the C2-C7 aldol portion of the molecule to generate olivetolic acid, a 12-carbon pathway (Ct3¾j0·*) intermediate (Gagne etat. (2012); Raharfo et «/. (2004)). A geranyl diphosphate :oSivetolic acid prenylfransferase, eannabigerolie acid synthase (GBG AS), catalyzes the C-alkylation of olivetolic acid by geranyl diphosphate (GPP) to form eannabigerolie acid (GBGA), a 12-earhon (C22H12Q4) cannahiooid Intermediate (Fdlermeier and Zenk 1998). Subsequent catalysis by the canhabidiolie acid synthase (CBDAS) results in the oxidative eyclization of the monoterpeueportioo of the CBGA, leading to tlie formation of cannabidiolic acid (CBDAj, a 12-carbon (GJTHI OI) oxidized derivative of eannabigerolie acid (MorimOto etal. (1998), Phytochemistry 49:1525- 1529: Sirikantaratnas ei al (2004), J Biol Chem 279:39767-39774; "faura et at (2007), FEBS Lett 581 :2929-2934), A deearhoxylated and biologically active hut non-gsyclioactive form of the latter (eannabidiol) typically occurs by a non-enzymatic process that may happen during heating or exposure to sunlight (dc Meijer et al, Oemtles 163,335-346, 2003) fOflf!S] Alternative oxidocyclase enzymes catalyze the oxidative cyclizatiOrt of the monoterpeoe moiety' of CBGA for the biosymthesis of AP-tetrahydrtreannabinolic acid (D9- f-iCA) and cannabicbromenic acid (GBCA) (Morimoto et at (1998),R¾i.7oό¾o/aBί?n 49:1525- 1529; Sifikantaramas et aL (2004), JBiol Chem 279:39767-39774; Taura et al (2007), FEBS Lett 581 :2929-2934). The latter are chemical isomers of the CfiDA, having the same C H G* chemical formula. Deearboxyiated and biologically active (psyehoactive) forms of the D9- THCA and CBCA cannabimrids (ATTMC and CBC, respectively) typically occur b a nom enzymatic process that may happen during heating or exposure to sunlight (de Meijer ei a! . (200$), Genetics 163,335-346).
100(19) The present invention provides improved methods and compositions for producing cannabinoids in photosynthetic microorganisms, allowing the production of highly pure cannabinoids that can be used in numerou biotechnological, pharmaceutic, and cosmetics applications.
BRIEF SUMMARY OF THE INVENTION
iWMj The current invention provides new methods -for generating purified ean binoids, e.g., catinabidiolie acid, in photosypthette microorganisms, e.g> cyanobacteria and microalgae. The eanoabidiolic acid (CBDA) and other cannabmoids produced using the present methods are derived via photosynthesis from sunlight, carbon dioxide, and water,
fOOll] The invention takes advantage of improvements in tile engineering of photosvTithetic microorganisms, e.g,, cyanobacteria, which, upon suitable genetic modification, ean be used to produce large quantities of highly pure eannabinoids such as earmabidiolie acid. The invention provides methods and compositions for generating an hanesting eannabidiolic acid and other cannabmoids from genetically modified cyanobacteria o other p oiosyntheiic microorganisms, Such genetically modified mietOorganisms can be used commercially in an enclosed mass culture system, e. ., a photobioreaetor, to provide a source of highly pure and valuable compounds for use in various industries, such as the medical, pharmaeeniical, andcosmetics industries,
10012] in one aspect, the present disclosure provides a method for -producing cannabmoids in a photosynthetic microorganism, the method comprising (i) introducin into the microorganism: a polynucleotide encoding a GPPS polypeptide; an one or more polynucleotides encoding AAB.1V OLS, OAG, GBGAS polypeptides mi an oxidocyelase selected from the group consisting of CHDAS, THCAS, and CBCAS; wherein the polynucleotide encoding the GPPS polypeptide is operably linked to a first promoter, and the one or more polynucleotides encoding the AAEl, OLS, OAG, GBGAS polypeptides and the oxidocyelase are operably linked to one or more additional p omoters; and (it) culturing the microorganism under conditions in which the GPPS, AAEL GLS, GAG, GBGAS polypeptides and the oxidocyelase are expressed and wherein cannabinoid biosynthesis takes place. {00131 In some embodiments, the photosymthetie microorganism modified in accordance with the disclosure is cyanobacteria, in some embodiments, the GPPS polypeptide is a fusion protein encoded by a polynucleotide encoding GPPS fused to the 3 ! end of a leader nucleic: acid sequence encoding a protein that is expressed *!! cyanobacteria at a level of at least 1% of the total cellular protein. In some embodiments, the GPPS polypeptide is an nptl^GPPS fusion protein, in some embodiments·, the GPPS polypeptide comprises an ami.no acid sequence that is at least 90% Or 95% identical to SEQ ID NQ:2, In some embodim nts, the GPPS polypeptide comprises the amino acidsequeoce of SEQ ID NO'2. In some embodiments, the polynucleotide encoding the GPPS polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NDil . In some embodiments, the poiyaucleotide encoding the GPPS polypeptide Comprises the nucleotide sequence of SEQ ID O:L
I ©0141 in some embodiments, the AAEl polypeptide used in accordance with the disclosure comprises an amino acid sequence that is at least 99% or 95% identical to SEQ: ID N€3:4, In some embodiments, the AAEl polypeptide comprises the amino acid sequence of SEQ ID MO:4. In some embodiments, the polynucleotide encoding the AAEl polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 636-2798 of SEQ ID NG:3, In some embodiments, the polynucleotide encoding die AAEl polypeptide comprises nucleotides 636-2798 of SEQ ID %Q;3, in some embodiments, the OLS polypeptide rtsed in accordance with the disclosure comprises an amino acid sequence that is at least 90% or 95%identical to SEQ ID NO:5, hr some embodiments, the OLS polypeptide comprises the amino acid sequence of SEQ ID NQ;5. in some embodiments, the polynucleotide encoding the OLS polypeptide comprises a nuekotide sequence that is at least 99% or 95% identical to nucleotides 2819-3973 of SEQ ID NO;3, in some embodiments, the polynucleotide encoding the OLS polypeptide comprises nucleotides 2819-3973 of SEQ ID NO:3. fiOi 5{ In some embodiments, the GAG polypeptide used in accordance with the disclosure comprises an amino acid sequence that is at least 90¾s or 95% identical to SEQ ID NG:6. In some embodiments, the GAC polypeptide comprises the amino acid sequence of SEQ ID NO:6. In some embodiments, the polynucleotide encoding the OAC polypeptide comprises a nucleotide Sequence that is at least 070 or 95% identical to hue teoti es 3994-4299 of SEQ ID Q:3, In some embodiments, the polynucleotide encoding the OAC polypeptide comprises nucleotides 3994-4299 of SEQ ID NO : 3, In some embodiments, the CBGAS polypeptide used in accordance with the disclosure comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO: 7. in some embodiments, the CBGAS polypeptide comprises the amino acid sequence of SEQ ID O:7, In some embodiments:, th polynucleotide encoding the CBGAS polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 4320-5507 of SEQ ID NO:3. in some embodiments, the polynucleotide encoding the GBG AS polypeptide comprises nucleotides 4320-5507 of SEQ ID O:3. fOQMj in some embodiments, the oxidocyclase used in accordance with the disclosure is CBDAS, and the CBDAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:S, is some embodiments, the oxidocyclase is CB DAS, and the CBDAS comprises the amino acid sequence of SEQ ID NO:8.,ln some embodiments, the polynucleotide encoding the CBDAS comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 3528-7162 of SEQ ID NQi3, in some embodiments, the polynucleotide encoding the CBDAS comprises nucleotides 5528-7162 of SEQ ID NO: 3. In some embodiments, the oxidocyclase used in accordance with the disclosure is TldCAS, and the THCAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NCilfl In some embodiments, the oxidocyclase is TIICAS, an thcTIlCAS comprises the amino acid sequence of SEQ ID N0: 10. in some embodiments, the polynucleotide encoding the THCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO:9. in some embodiments, the polynucleotide encoding the TI-iC AS comprises the nucleotide sequence of SEQ ID NO:9.
[68171 in some embodiments:, the oxidocyclase use in accordance with die disclosure is CBCAS, and the CBGAS comprises an amino acid sequence that is at least 9(3% or 95% identical to SEQ ID NO:.12. In some embodiments, the oxidocyclase is CBCAS, and the CBCAS comprises the amino acid sequence of SEQ ID NO: 12. In some embodiments:, the polynucleotide encoding the CBCAS: comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO: 1 1 . In some embodiments, the polynucleotide encoding the CBC S comprises the nucleotide sequence of SEQ ID NO: II .
109181 In some embodiments, two or more of the polynucleotides unending the AAEl, QLS, QAC, CBGAS polypeptides and the o idoeyelase are present w-ithiu a single operon, In some embodiments:, all of the polynucleotides encoding the AAEl , QLS» OAC, CBGAS polype tide and the oxidocyclase are present within a single operon. In some embodiments, the operon is at least 90% or 95% identical to $EQ ID NQ;3, SEQ ID NO:13, or SEQ ID 0:I4 in some embodiments, the operon comprises SEQ ID NQ:3, SEQ ID NO: 13, or SEQ ID NO: 14. In some embodiments, the first and/or additional promoters used in accordance with the disclosure are selected from the group consisting of a cpc promoter, a psbA2 promoter, a glgAl pro oters a TPtrc promoter, and a T7 promoter.
100:19] In some embodiments, one or more of the polynucleotides encoding the GPPS, AAEI, OPS, OAC, CBGAS polypeptides and the oxidocyelsse are codo optimized for the photosynthetie microorganism. In some embodiments, the microorganis modifie in accordance with the disclosure is fro a genus selected from the group consisting of Syme iocystis, Sy choceec , Atkraspim, Nestoc, and Anah m* In some embodiments, one or more of the codin g sequences for the GPPS, AAEI, QLS, O AC, CBGAS polypeptides and the oxidoeyelase are preceded by a ggaattaggaggttasttaa ribosome binding site (RBS).
1(10201 In some embodiments, the method further comprises a ste (c) comprising isolatin cannabinoids .fe the microorganism or: from the culture medium. In some embodiments, the cannabinoids are isolated from the surface of the liquid culture as floater molecules in some embodiments, the eatraabinoids are extracted from the interior of the mi croorganism in some embodiments, the cannabinoids am extracted from a disintegrated cell suspension prodiieed by isolating the microorganism and disintegrating It by forcing it through a French press, subjecting it to sonieatkra, or treating it with glass beads. In some embodiments, the disintegrated cell suspension is supplemented with H2SO and 30% (w:v) Nad at a volume- to- volume ratio of (cell suspension / H2SQ4 NaCl ~ 3 / 0.12/ 0.5). In some embodiments, the cannabinoids are extracted from hie I-ESCb and NaCbtreated disurtegrate cell suspension upon incubation with an organic solvent, In some embodiments, the organic soiyent is hexane· or heptane. In some embodiments, the Organic soiyent is ethyl acetate, acetone, methanol, ethanol, or propanol. In some embodiments the microorganism is freeze-dried. In some embodiments, the cannabinoids are extracted from th ffeezodrie microorganism with an organic Solvent. in some embodiments, the organic solvent is methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, or heptane. In some embodiments, the organic solvent is dried by solvent evaporation, leaving the eatnahiftoids In pure form.
[08 1 j In another aspect, the presen disclosure provides a photosynthetie microorganis produced using any of the methods described herein. In another aspect, the present disclosure provides a photosynfheiic microorganism comprising: (i) a polynucleotide encoding a GPPS polypeptide: and (ii) one or more polynucleotides encoding AAE1, OLS, OAC, CBGAS polypeptides and an oxidocyclase selected from the group consisting of CBD AS, Ti l CA S, and CBCAS; wherein the polynucleotide encoding the GPPS polypeptide is operahly linked to a first promoter, and wherein the one or more polynucleotides encoding the AAE I , OLS, OAC, CBGAS polypeptides and the oxidocyelas tire operably linked to one or more additional promoters.
100221 in some embodiments, tje photosyaTthetie microorganism is cyanobacteria. In some embodiments, the GPPS polypeptide is a fusion rotein eneoded by a polynucleotide encoding GPPS fused to the 3’ end of a leader nucleic acid sequence encoding a protein that is expressed in cyanobacteria at a level of at least 1% of the total cellular protein. In some embodiments, the GPPS polypeptide is an uptPGPPS fusion protein. I some embodiments, the GPPS polypeptide comprises an amino acid sequence that is at least 90% or 95% identieal to SEQ ID G:2, In some embodiments, the GPPS polypeptid comprises the amino acid sequence of SEQ ID NO:2. In some embodiments, the polynucleotide encoding the GPPS polypeptide comprises a nucleotide sequence that is at least 90% or 1)5% identical to SEQ ID NO:I. in some embodiments, the polynucleotide encoding the GPPS polypeptide comprises the nucleotide sequence of SEQ ID NO: 1.
|0 23| In some embodiments, the AAEI polypeptide comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:4. In some embodiments^ the AAEI polypeptide comprises the amino acid sequence of SEQID NCEd. in some embodiments, the polynucleotide encoding die AAEI polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 6M 2798 of SEQ ID O:3. In some embodiments, the polynucleotide encoding the AAEI polypeptide comprises nucleotides 636-2798 of SEQ ID NO:3, in some embodiments, the GLS polypeptide comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:5. In some embodiments the OLS polypeptide comprises the amino acid sequence of SEQ ID O:S, in some embodiments, the polynucleotide encoding the OLS polypeptide co prises a nucleotide sequence that is at least 90 or 95% identical to nucleotides 2819-3973 of SEQ ID NO: 3 , in some embodiments, the polynucleotide encoding the OLS polypeptide comprises nucleotides 2819-3973 of SEQ ID NO:3.
109241 In some embodiments, the OAC polypeptide comprises an ammo acid sequence that is at least 90% or 95% identical io SEQ ID NQ:6, in some embodiments, the OAC polypeptide comprises the amino acid sequence of SEQ ID N 0:6. In some embodiments, the polynucleotide encoding the OAC polypeptide comprises a nucleotide sequence that is at feast 90% or 95% identical to nucleotides 3994 4299 of SEQ ID NO:3, In some embodiments, the polynucleotide encoding the OAC polypeptide comprises nucleotides 3994-4299 of SEQ ID NO:3. in some embodiments, the CBGAS polypeptide comprises an amino acid sequence that is at least 9034 or 9534 identical to SEQ ID O;7. In some embodiments, the CBGAS polypeptide comprises file amino acid sequence of SEQ ID NO:7. In some embodiments, the polynucleotide encoding the CBGAS polypeptide comprises pucleotide sequence that is at least 90% or 95% identical to nucleotides 4320-5507 of SEQ ID NO: 3.in some embodiments, the polynucleotide encoding the CBGAS polypeptide: comprises nucleotides 4320-5507 of SEQ ID NO:3.
(0025] in some embodiments, the oxidocyclase is GBDAS, and the CBDAS comprises a amino acid sequence that is at least 90% or 95% identical to SEQ ID NO 8. In some embodiments, the oxidocyclase is CBDAS, and the CBDAS comprises the amino acid sequence of SEQ ID NO: 8. in some embodiments, the polynucleotide encoding the CBDAS comprises a nucleotide sequence that Is at least 90% or 95% identical to nucleotides 5528-7162 of SEQ ID NQ;3. In some -embodiments, the polynucleotide encoding the CBDAS comprises nucleotides 5528-7162 of SEQ ID NO; 3: In some embodiments, the oxidocyclase is THCAS, and the THCAS comprises an amino acid sequence that Is at least 90% or 95% identical to SEQ ID NO: 10, In some embodiments, the oxidocyclase is THCAS, and the THCAS comprises the amino acid sequence of SEQ IP Q:!0. in some embodiments, the polynucleotide encoding flic THCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NG:9, in some embodiments, the polynucleotide encoding the THCAS comprises the nucleotide sequence of SEQ ID N():9,
10926| In some embodiments, the oxidocyelase is CBGAS, and the CBGAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NQ:12. In some embodiments, the oxidocyclase is CBGAS, and the CBGAS comprises the amino add Sequence of SEQ ID NO: 12. In some embodiments, the polynucleotide: encoding the CBC AS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO: I I . in some embodiments, the polynucleotide encoding the CBGAS comprises the nucleotide sequence ofSEQ ID NO: 1.1 ,
f 0027) In some embodiments, two or more of the polynucleotides encoding the A AE1 , OES, OAC, CBGAS polypeptides and the oxidocyclase are present within a single operon. In some embodiments, all of the poIymicleot es encoding the AAEI , OI,S, OAC, CBGAS polypeptides and the oxidocyclase are present within a single operon. In some embodiments, the operon is at least 90% or 95% identical to SEQ ID NO:3, SEQ ID NQ:I3, or SEQ ID NO: 14, In some embodiments, tire operon comprises SEQ ID N0:3, SEQ ID NOP 2, or SEQ IQ NO:14, in some embodiments, the first and pr additional promoters are selected from the group consisting of a epe promoter, a psbA2 promoter, a gigAl promoter, a Ptre promoter, and a T7 promoter. 108281 In some embodiments, one or more of the polynucleotides encoding the GBPS, AABL OLS, QACj CBGAS polypeptides and the axidoeyclase are codon optimised for thephotosynthetie microorganism, in some embodiments, die microorganis is from a genus selected from the group consisting of Syn chacysUs, Symd coccus, Athmspim, Nostaty and: Anabaerm. In some embodiments , one of more of the coding sequences for the GBPS, AAEl, OLS, QAC, CBGAS polypeptides and the oxidocyelase are preceded by a ggaattaggaggttaattaa ribosome binding she (RBS),
IO8293 in other aspects, the present disclosure provides 3 polynucleotide encoding a GBPS, AABL OLS, OAC, CBGAS, CBDAS, TIICAS polypeptide and/or CBGAS polypeptide, wherein the polynucleotide is codon optimized for cyanobacteria or other photosynthetie microorganism i some embodiments, the polynucleotide is at least 90% of 95% identical to a sequence selected from the group consisting of SEQ ID NO;!, SEQ ID NO 3» SEQ ID NO;9, SEQ ID NO:ll , SEQ ID NO: 13, SEQ ID NO: 14, nucleotides 636*279$ of SEQ ID NO:3, nucleotides 2819-3973 of SEQ ID NO:3s nncieot)des 3994-4299 of SEQ ID NQ:3, nucleotides 4320-5507 of SEQ ID NQ:3, and nucleotides 5528-7162 of SEQ ID NO:3. In some embodiments, the polynucleotide comprises a sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NQ:3, SEQ ID NQ:9, SEQ ID NO: 1 1 , SEQ ID NO: 13, SEQ ID NO: 14, nucleotides 636-2798 of SEQ ID NG:3, nucleotides 2819-3973 of SEQ ID NO:3, nucleotides 39944299 of SEQ ID NO:3, nucleotides 4320-5507 of SEQ ID NO:3, and nucleotides 5528- 7162 of SEQ ID NOG,
18838} In another aspect, the present disclosure provides an expression cassette comprising any of the herein-described polynucleotides. In another aspect, the present disclosure provides a host cell comprising any of the herein-described polynucleotides or expression cassettes. In another aspect, the present disclosure provides a cell culture comprising an of the herein- described microorganisms or host cells,
198311 In another aspect, the present disclosure provides a method for producing cannahinoids, the method comprising culturing any of the heroin-described p otosynthetie microorganisms or host cell under conditions in which the CiPPS, AAEl , OLS, OAC, CBGAS polypeptides and the aoxidocydase are expressed and wherein eannabinoid biosynthesis takes place.
|9032| in some embodiments, the metho further comprises a step (c) Comprising isolating cannabinoids fro the microorganism or from the culture medium. In. some embodiments, the eannahinoids are isolated j&pra the surface of the liquid culture as floater molecules. In some embodiments, the cannabinoids are extracted froni the interior of the microorganism. In some embodiments, the cannabinoids are extracte from a disintegrated cell suspension produced by isolating the microorganism and disintegrating it by forcing it through a French press, subjecting it to so icatian, or treating it with glass beads in some embodiments, the disintegrated ceil suspension is supplemented with HiSCh and 30% (w:v) NaCl at a volume- to-volume ratio of {cell suspension / i-pSCk / NaCl 3 / 0.12 / CIS), in some embodiments, the cannabinoids are extracted from the HaSCh and NaCl-treated disintegrated cell suspension upon incubation with an organic solvent, in some embodiments, the organic solvent is hexane or heptane, in some embodiments, the orpnie solvent, is ethyl acetate, acetone, methanol, ethanol, or propanol. In some embodiments, the microorganism is freeze-dried, in some embodiments, the eannahinoids are extracted from the freeze-dried microorganism with an organic solvent in some embodiments, the organic solvent is methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, or heptane in some embodiments, the organic solvent is dried by solvent evaporation, leaving the cannafoinosds in pure form,
B RIEF DESCRIPTION OF THE DRAWINGS f0h33S FIG, 1, Terpenoid biosynthesis via the endogenous MEP {meihylefythritoF4- phosphate) pathway in photosynfhefic microorganisms, e.g. Sy chacystvs sp. Abbreviations used: G3P, gl>¾eraldehydc 3-pbospliate: Dxs, deoxyxyiulose 5-phosphate synthase; Dxr, deoxyxylulose 5-phosphate reductoisomefase; ispP, diphosphocytidylyl methyierythritol synthase; IspE, diphosphocytidySyl methyleiyihrito! kinase; ispF, methyl erythiito.l-2:,4- cyeiodiphosphate synthase; IspG, hydrcjxynrefhydbutenyl diphosphate synthase; IspH, hydroxymethylhuteuyl diphosphate reductase; Ipi, 1PP isomemse,
[9034] FIG, 2. Terpetmid biosynthesis via the heterologous M V A (mevalonic acid) pathway in phot syuihetic microorganisms, e.g. Synechocysti sp. Abbreviations used: AtoB, acetyl- CoA acetyl transferase; HmgS, Hmg-CoA synthase FirngR, Hmg-GoA rednetase; MK, mevalonic acid kinase; PMK, mevalonic acid 5-phosphate kinase; PMD, mevalonic acid 5- diplxoshate decarboxylase: Fni, iPP isomemse.
[0035] MG, 3, Biosynthesis of geranyi diphosphate (GPP) by the action of the enzyme geranyl diphosphate synthase (GPPS). GPP is the first precursor to mono-, sesqui-, di-, hi-, tetra-terpenoids and all their derivatives- 10036] FIG* 4. Protein expression analysis of Symedtacysiis wild type (WT) arid transformant strains. Total cell proteins were resolved by 5DS-PAQE, transferred to nitrocellulose and probed with specific a-GPPSS polyclonal antibodies. Individual native anti heterologous proteins of interest are indicated on the right side of the blot . Transformant lines expressing GPPS along with Sm (GPPS-SmR) or the fusion Npti*GPPS only (NptI*GPP$) were loaded onto the gel Sample loading eoiresponds to 0,1:25 pg of chlorophyll for the Western blot analysis. Upper arrow shows the presence of the NplPGPPS ftision protein. Upper arrow shows a strong specific cross-reaction the polyclonal Fice alnes GPPS2 antibodies and a protein band migrating to 62 ID in tlie NptDGPPS2 fusion transformant, showing that die FrRv-NptUGPPS construct was truly overexpressed at the protein level in Spnechocyst Lower am» shows a feint eross-reaction at 32 kD observed in wild type and transformants. By reference to the Mycapl ma tuberculosis GPPS, GenBank accession number AF082325.1, this was assigned to ORF sk06l I encoding a utative prenyltransferase of 32 kD. which could thus account for the !ow-leyei expression of the native GPPS in Syneehocys .
10037] EIG. 5. The eannabinoid biosynthesis pathway in pbotosynthetie microorganisms, e,g, SymckoCystis sp. Abbreviations used: AAET Acyl Activating Enzyme 1; OLS, Glivetol synthase; OAC, Olivetolie acid Cyclase; CBGAS, Carmabigerofic acid synthase; CBDAS, Cannabidiolic acid synthase,
f 0938) FIG, 6, Gas chromatograph detection with a flame ionization detector (GC-FID) of floater extracts fro m Someehocjsstis wil type (WT) untreated an cultures treated with cannabidioi (CBP) (Upper panel) GC-FID analysis of heptane, extracts front a Synechoeysfy wild type untreated culture. Floater extracts from wild type cultures displayed a flat profile, without any discernible peaks, {Lower panel) GC-F1D analysis of floater extracts front a Syuechixysth culture incubated in the presence of cannabidioi, Cannabidioi was the m¾or product detected, showing a retention time of 9.2 min under these experimental conditions. Smaller amounts of an additional compound, with retention times of 10.3 min were also detected as secondary product of the process (5ee, e.g., Dussy FE et at. (2005), Isolation of D9-THCA-A from hemp and analytical aspects concerning the determination of D9-THC In cannabis products. Forensic Science tntermimrml 149:3-10; Ibrahim BA :et at {2018} Determination of acid and neutral cannabinoids in extracts of different strains of Catmabis sativa using GC-FiB. Manta Med 84:250-259). {00391 FIG, 7. Spectrophotoili tric detection of caanab !iolic acid and cannabidiol inheptane solution (Upper panel) Absorbance spectrum of eaiinabidkdic add (CBDA) showing UV maxima at 225 and 270 a from which the concentration of CJBDA can be calculated, (Lower panel) Absorbance spectrum of cannabidiol (CBD) showing UV peak at 214 am and a shoulder at 233 tim from which the concentration of CBD can be calculated. A system of equations based on the extinction coefficients of CBDA and CBD at the above-mentione wavelengths permits delineation of the concentratio of the two eannabinoids in a mix solution. Caunabinoids can be siphoned off the top of the liquid medium .front transformant: SynechoeyMs cultures after applying a known volume of heptane sol vent as over-layer (see, e,g„ US patent No. 9,951354). f§049] FIGS. 8.4-8B. Linear addition of Symchocystk CBDA transforming constritets. FIG. SA; Map of the upper (construct U#i; 5,300 at) find lower (construct ! 2; 4,640 nt) Syftefhocysiis codon-optimized eannabidiolic acid biosynthetic path way encoding genes. IM harbored the LLEI, QLS, OACf am! zeocin (2mR) resistance genes, I,#2 harbored the OLS) (MC. CSGAS, €8DA$* and chloramphenicol {cmR encoding genes. Symckocystis was transformed linearly {sequentially) first with construct L# l and, upon reaching homoplas y, with L 2, FIG, SB; Genomic DNA PCS analysis testing for the insertion of the CBDA-relatccl genes in Syneehecyst {ranstprajants. Primers <Ol<$-jof> and <cmR f v> were employed for screening the transformants harboring the genes required lor CBDA synthesis i nSymdioeysfis. Genomic DN A from wild-type f T) and the L# 1 transformant strains, with the latter harboring only the upper CBDAtencQding genes, were used a controls, Both wild type and L#1 PCR products generated unspecific 700 bp size products, whereas four different cell lines (019* Nl3, N15, and NI7), comprising both the Lhl and Lh2 constructs, generated the expected 3,822 bp size product. These results showed the full integration of the CBDA biosynthetic pathway in Sytiechocystis.
10041] FIGS, 9A-9B. Linear addition of Symch yatis CBDA transforming constructs. FIG. 9A; Map of the upper (construct L#l ; 3300 nt) and lower: (construct I 2; 464(3 nt) Sy ciiOcystis eodon-optimlzed caonabidiolic acid (CBDA) biosynthetic pathway-encoding genes, L#1 harbored the AAEL OLS, CMC, and zeociu resistance cassette genes, I harbored the OLS, QAC, C GAS, CBDAS, and cmR eneoding genes. Syneehocystis was transformed linearly {sequentially) with construct L#i and, upon reaching homoplasmy, with L#2. FIG, 9B: Genomic DNA PCR analysis testing for the correct insertion of individual CBDA biosynthesis-relate genes in Synechocystis transformants. (Upper left panel) Primers <QLS jbr> and <cpc~ds rev> generated a 1,978 bp product in the L t transformant and 5,130 bp products in three different transformants com rising both the L#1 and L#2 constructs, PCR using WT genomic DNA did not generate a PCR product, as expected, (Upper right panel} Primers <OAC for> and <epc~ds re\f> generated a 1,202 bp product ½ the L#1 hansfbnnant and 4354 bp products in three different transformants comprising both the L#1 and L#2 eonstruets. PCR «sing WT genomic DNA did not generate a PCR product, as expected, (Lower left panel) Primers <cpc-usjw-> and 0ACr ¹> generated 4,320 bp products both in the L#1 transformant and in three different transformants comprising the L#1 and L#2 constructs, PCR using WT genomic DNA did not generate a PCR product, as expected, (Lower right panel) Primers <cpc~mfor> and <0£S rev» generated 3,542 bp product both in the L#1 transformant and in three different transformants comprising the L#1 and IJ2 constructs. PCR using WT genomic DNA did not generate a PCR product, as expected. These results strengthened the notion of correct insertion of the entire heterologous CBDA biosynthetic pathway genes inBytie hocpsii ,
10042] FIGS. 10A-40B. Linear addition of Sjm&skvcysiis CBDA transforming constructs. FIG, 10A (upper): Map of CBDA biosynthetic pathway encoding genes installed as an open)» in the genomie DNA of Syfuschd ys s, Transgenic operon replaced the native cpc operon, under the control of the c promoter. FIG. 10 A (lower); Ma of the heterologous mevalonic acid pathway-encoding genes installed in ihc Syneehocystis gigA i locus, expressed under the control of the Lko promoter, FIG. 10B: RT-PCR analysis of Symchoe st CBDA transformants offers evidence of transcription and mRNA accumulation of the cell endogenous 16 rRNA gene (200 bp product), as well as the heterologous AAEJ transgene (275 bp product), CBDAS transgene (295 bp product), and GPPS pmsge (286 bp product). /These results validate the successful installation and expression of two exogenous opetons, shown in FIG.10A, comprising twelve heterologous transgenes expressed In Sy ckocystis,
10043] FIGS, 1 lA-llC, Parallel addition ΰΐ Syneekacyatis CBDA transforming eonstruets, FIG. IΪAί .Ma of the CBDA construct MT (6,674 nt) in the epc o eron locus harbori ng the AAEI, OLS, 6MC, atoB, cmR genes, and CBDA construct fftZ (6,573 nt) in the pshAJ gene locus of Bvneekocystis harboring the iip§*GDPS fusion, CB6AS , CBDAS, and smR encoding genes. FIG. FIB: Screening by PGR analysis of a set of colonies transformed wit CBDA construct P#l, For verification of insertion <cpc bit> and <qpe d$ re > primers were used, Colonies 8, 9, 17 and 20 showed the expected size products. FIG. IJC: Screening by PCR analysis of the second set of colonies transformed with CBDA construct Pffl. For verification of cawretet insertion, <cpc-t sfi r> m&< AEi rev> primers were used. Again, colonies 8, 9, 17 and 20 showed the right size products. The results showed that colonies 8, 9, 17 and 20 are successful GBDA construct P#1 transformants.
{00441 MGS, Ϊ2A-12B. Parallel addititm-uf Smedkocys-t CBD transforming constructs, FIG. l2At Map of the CBDA construct Ml (6,674 nt) in the pc operon locus harboring the ALEI, OIS, 0<4C, atoB, cmR genes, and CBDA construct P#2 (6,573 nt) in the /wMJ gene loeUS-of Sy ephocystis harboring the npiPGPPS fusion, CBGAS, CBIMS, and swii encoding genes. FIG. 12B; Screening by PGR analysis of a set of colonies transformed with CBDA construct M2, For verification of correct insertion, strains were tested with primers <pabA2~ fof> and <psbA2~ds rev> (CBDAS) (left side of the construct map and gel panel), spanning the fill! length of the insert. Also, <€BDASfar> md<pshA2-ds r v> primers were used (right side of the construct map and gel panel) to test for the location of the CBDAS gene in relation to the pxbA2 DS gene region. Colonies 1, 2, 4, 5, 6 and 7 had the correct, roduct size an insertion position in the: p$M gene locus, showing successfully transformation of these heterologous genes.
10045} FIG. 13. SDS-PAGE (left panel) and Western blot analysis (right panel) of wild type and three GBDA biosynthetic pathway transformants, as described in FIG. 12. Lane WT- wild type. Lanes 4, 5, 6: Same as lanes 4, 5, and 6 in FIG. 12. Wild type and transformant cells were grown tinder the same experimental conditions. Lanes were loaded with 0,3 pg cellular chlorophyll, The Coomassie stain in the SDS-PAGE panel showed die distinct presence of the ptl^GPPS fusion plus CBDAS proteins, both migrating in foe vicinity of 62 kD, and the presence of the CBGAS protein migrating to about 45 kD. Polyclonal antibodies against the GPF8 protein were used to show the presence of the Npt GPPS fusion protein. Onl transformants ½ lanes 4, 5, and 6 were positive in the SDS-PAGE and Western blot analysis for the expected K'ptFClPPS, CBDAS, and CBGAS proteins. fiMMbl FIG. 14. Cyanobaeterial eannabinoid analysis by GC-MS. FIG, 14A: standards; FIG. I4B· cell extracts,
10047} FIG. IS. Codon-optimized DNA sequences in operon configuration of the catmabinoi biosynthesis pathway shown in FIG. S, leading to the synthesis of cannahidio!ie acid. DETAILED DESCRIPTION OF THE INVENTION
1, Introduction
|004S] The present invention provides methods and composi tions tor producing highly pure, easily isolatable eannabirroids in photosynthetic microorganisms feat can be used for pharmaceutical, cosmeties-related, and other applications. The present method provide numerous advantages for the production of eannabinoids, including that the eanoahinoids can be produce eonstitutively fro the natural photosynthesi of the ceils, with no need to supplement growth media wife antibiotics of organic nutrients, and that the produced cannabinoids can be readily harvested from th growth medium, Further, in some embodiments, the heterologous polynucleotides encoding the enzymes for the production of cannabinoids in the cells are integrated into the genome of the microorganisms, thereb avoiding potential difficulties resulting fro the use of high-copy plasmids. Another advantage of the present methods is that cyanobacteria and other photosynthetie microorganisms contain abundan t thylakoid membranes of photosynthesis, whi ch makes them particularly suitable for the expression and function of the transmembrane CBCiAS enzyme,
fiMMii S Tlie genetically modified photosynthetic microorgaiiisnis of the invention can be use commercially in an enclosed mass culture system to provide a source of cannabinoids which can be developed as biophamiaceuticals in: the manifold therapeutic applications of cannabinoids currently employed, of contemplate by the synthetic chemistr and pharmaceutical industries. For instance, the therapeutic potential of cannabidiol (CBD oil), auon-psychoactive substaiiee, is currently being explored far a number of indications including for the treatment of paitn inflammatory diseases, epilepsy, anxiety disorders, substance abuse disorders, schizophrenia, cancer, and others. 2. Definitions fhOSiij As used herein, the following terms have the meanings ascribed to them unless specified otherwise, jjiKiSlj The terms“a,”“an,” or“fed” as used herein not only include aspects with one member, but also include aspects wife more than one member. For instance, the singular forms
“a¾” and“the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to“a cell” includes a plurality of such ceils an reference to“the agent” includes reference to one or more agents known to those skilled in the art, and so forth, i0 S2j The ten “a out” aod“approximately” as used herein shall generally mean anacceptable degree of error for the quantity measured given the nature or precision of the measurements, Typically, exemplary degrees of error ar within 20 percent (%), preferably within 10%, and more preferably within $% of a given value or range of values. Any reference to“about X” specificall indicates at least the values X, 0.SX, 0.81X, 0.82X, 0.83X, 0.84X, 0.85X, 0.86X, 0;8?X, 0.88X, 0.89X, 0; X, 0.91X, 0.92X. 0.93 X, 0.94X, 0.95X, 0.96X, D.97X, 0,98X, f).99X, .OIX, 1 M, 5.03X, I MX, 1.05.X, 1.06X., 1.07X, 1.08X, I .09X, LIX, Ifl lX, U2X, 1.13X, 1.14X, L1 SX, 1.16XS 1.17X, U 8X, 1 J 9X, and 1,2X, Thus,“about X” is intended to teach and provide written description support for a clai limitation of, e,g.„ “0,98X.”
10053} The term“nucleic acid” or“polynucleotide” refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form.Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides: that have similar binding properties as the reference: nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides/ Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (&g,t degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyraosme residues (Saizer et al., ffyekte y M ¾?s. 19:5081 (1991); Uhtsnka et al, J. Biol. Chem, 260:2605-2608 (1985):; and Rossolioi ei a! , Mol. Cell Probes 8:9X98 (1994)).
"10054] The ter “gene” refers to the segment of DNA involved in producing a polypeptide chain. It may include regions preceding and following the coding region (leader and trailer) as well as intervening -sequences (intrOns) betwee individual coding segments (exons).
|0q55] A " romoter" is defined as an array of nucleic acid control sequences that: direct transeription of a nucleie acid. As used herein, a promoter includes necessary' nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase ΪI type promoter, a TATA element, A promoter also optionally includes distal enhancer or repressor elements. Which can be located as much as se veral thousand base pairs from the start site of transcription. The promoter can be a heterologous promoter, or an endogenous promoter, e.g , when a coding sequence is integrated into the genome and its expression is then driven by an adjacen t promoter already present in the genome. 109561 An“expressi n cassete” is a nucleic acid construct generated recomhinantly or synthetically, with a series of specified nucleic acid dements that permit transcription of a particular polynucleotide sequence in a host eell. An expression cassette may be part of a plasmid, viral genome, or mieleie acid fragment, in some e bodiments, an expression cassette includes a polynucleotide to be transcribed, operably linked to a promoter. The promoter can be a heterologous promoter, in the context of promoters operably linked to a polynucleotide, a “heterologous promoter” refers to a promoter that would not be so operably linked to the same polynucleotide as found in a product of nature (e.g. in a wild-type organism), in some embodiments, the expression cassette comprises a coding sequence whose expression is designed to be driven by an endogenous pron er subsequent to integration into the genome,
|(>Q57| As used herein, first polynucleotide or polypeptide i s "hefottldgoits" to an organism or & second polynucleotide or polypeptide sequence if the first polynucleotide or polypeptide originates from a foreign species compared to the organism or secon polynucleotide or polypepdde, or, if from the same species, is modified from its original for , For example, when a promoter is said to be operably linked to a heterologous coding sequence, it means that the coding sequence is derived from one species whereas the promoter sequence is derived fro atiother, different species; or, if both are derived from the same species, th coding sequence is not naturally associated with the promoter (e.g,, is a genetically engineered coding sequence).
[0058j “Polypeptide/’“peptide/' and“protein” are use interchangeably herein to refer to a polymer of amino acid residues. Alt three terms apply to amino acid polymers in which one or ore amino acid residue is an artificial chemical mimetic of a corresponding naturally oeeuiring amino add, as well as to natorally occurring amino acid polymers and non-natti U occurring amino acid polymers. As used herein, the terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
10959} “Conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences,“conservatively modified variants” refers to those nucleic acids that encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode ny' given protein. For instance, the codons GCA,
GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are“silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein that encodes a polypeptide also describes every' possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which Is ordinarily the. only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yiel a il etionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit: in each described sequence, fOhhff One of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a“conservatively modified varianfi’ where the alteration results in the substitution of an amino acid with a chemically similar ammo acid. Conservative substitution tables providing func tionally simila amino acids are well known in the art Such -conservatively modified variants are in addition to and do not exclude polymorphic variants, interspeeies homolqgs, and alleles, in some cases, conservatively modified variants can have art increased stability, assembly, or activity,
109611 The following eight groups each contain ammo acids that are conservative substitution for one another;
1} .Alanine (A), Glycine (G);
2) Aspartic aeid (D), Glutamic acid (E);
3} Asparagine (N), Glutamine (Q);
4) Arginine (R), Lysine (K);
5) Isolencine 0), Leucine (L), Methionine (M), Valine (V);
6) Phenylalanine (P),Tyrosine (¥), Tryptophan (W)t
7) Serine (S), Threonine (T); arid
8) Cysteine (C), Methionine (M)
(see, e.g. ,OoeightOn, Protews, W. M, Freeman and Co., N. Y, (1984)),
|0062j Amino acids may foe referred to herein by either their commonly known: three letter symbols or by foe one-letter symbols recommended by the iUPAC-IUB Biochemical Momenelafuxu Commission, Nucleotides likewise, may be referred to by their commonly accepted single-letter codes. I» the present application,, amino acid residues are numbered according to their relative positions from the left most residue, which is numbered 1, in an unmodified iid-type polypeptide sequence,
|U963| As used in herein, the terms“identical” or percen “identity,” in the context of describing two or more polynucleotide oraminp acid sequences, refer to two or more sequences or specified subsequences that are the same. Two sequences that are "‘substantially identical* have at least 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90% 91%, 92%, 93, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithm or by manual alignment and visual inspection where a specific region is not designated. With regard to polynucleotide sequences, this definition also refers to the complement of a test sequence. With regard to amino acid sequences;* in some eases, the identity exists over a region that is at least about 56 amino acid in length, or more preferably over a region that is 75- 100 amino acids in length in some emodimenis, percent identity is determined over the M!-length of the amino acid or nucleic acid sequence,
10064} For sequence comparison, typically one sequence acts: as a reference sequence, to which test sequences am compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm: then calculates the percent sequence identities for the test sequences relative to fee nrierenee sequence, based on the: program parameters. For sequence comparison of nucleic acids and proteins, the BLAST 2.0 algorithm and the default parameters discussed below are used,
| 8(5S A“comparison window”, as used herein, includes reference to a segment of any one of the number of eontiguesus positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a .reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
|0066| An algorithm for determining percent sequence identity1' and sequence similarity is the BLAST 2,0 algorithm, which is described in Altschul taL, (1990) ,/. MoL Biol 215: 403-410, Software for performing BLAST analyses is publicly available at the National Center for Biotechnology infor ation website, uebLnl .nih,gov. The algorithm involves fust identifying high scoring sequence pairs (HSFs) by identifying short words of length W in die quer sequence, which either match or satisfy some positive-valued threshold score T when aligned with a wqstd of the same length in a database sequence. T is referred to as the neighborhood word score threshol (Altschuie/ e .j supra). These initial neighborhood word hits act as seeds for initiating searcites to find longer HSFs containing them. The word hits are then extended i both directions along each sequence for as far as the cumulative alignment score can be increased, Cumul tive scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residue ; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the ord hits in each direction are halted when: tire cumulative alignment score foils off by the quantity X fro its maximum achieved value; the cumulative score goes to zero or below , due to the accumulation of one or more negative -scoring residue alignments; or the en of either sequence is reached. The BLAST algorithm parameters; W, T, and X determine the sensitivity and speed of t e alignment. The BLASIK program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of I f), M-l , N--2, and a comparison of both strands, For amino acid sequences, the BLASTP program uses as defaults s word size (W) of 3, an expectation (E) of 10, and: the BLOSUM62 scoring matrix (see Henikoff <fe Henikofy Pmc. Nat t. Amd. SeL USA 89: 10915 (1989)).
1119671 The BLAST algorithm also performs a statistical analysis of the similarity , between two sequences (see, &g,, Karlin & Altschul, Proc. Natl. Aca Sci, USA 90:;5873 S787 (1 93)}. One measure of similarity provided by the BL AST algorithm is the smallest sum probability (F(N)k which provides ah indication of the probability by which; a match between two nucleotide or amino aci sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability·® a comparison of the test nucleic acid to the reference nucleic acid is less than about 0,2, more preferably less than about 0,0 L and most preferably less than about 0.001.
3. Photosy iithetie microorganisms
10 681 Any number of photosynthetie microorganisms can be used in the present methods. In particular embodiments, unicellular cyanobacteria are modified as described herein to produce cannabinoids. Illustrative cyanobacteria include, e.g„ S nechocystis sp., such as strain Synechocystis PC 6803 ; mi& Synechaco ctis sp , e.g., the thermophilic Synechac ccu !fvklus; the .mesop ic I pechocoecus eiongatus and S neckococcus 6301, and the euryhaline Symchoceccus 7002, Mtlt eilular, kiclud g filamentous cyanobacteria, may also be engineered to express the heterologous GPPS and eannabinoid biosynthesis operOn genes in accordance with this invention, including,
Figure imgf000024_0001
Gtoeoaxpsa, as well as filamentous cyanobacteria such. as Nbstov sp., e g,, Nosft >c sp, PCC 7120, Nocΐoa sphmroia’esj: Amth ena
, such as Arihmspir&plaimsis
Figure imgf000024_0002
Algae, e g. < green microalgae, can also be modified to express GPPS and eartnabinoid biosynthesis genes. Green microalgae are single cell oxygenic photosyothetie eukaryotic organisms that produce chlorophyll a and chlorophyll b. Thus, lor example, in some embodiments, green microalgae such as Ckkmydomoms reiuhardtii, which is classified as Voiyocales, Ciilamydomonadaceae, Sce desm ohliquus, NaamcMpmpsis, ChlomlL·. Botryocoecm hmunii Bairyococms sudeiims, DmaMelia Salma, ffaemataeoccus pluviads, Chiofella fused, and Mareta vulgaris are modified a described herein to produce cannahinoids,
{0070] in some embodiments, photosyaithefic microorganisms such as diatoms are modified. Examples of diatoms that can be modified to produce cannabinoids in accordance with this disclosure include Pheodaciylum fricprnutim CyliadtOi em Jmifbrmis Cychteila gatima; Nanwchloivpsis oc tlica; and Thakissiosim pseudomma. 4. Polynucleotides lOOTi I In the presen t disclosure, pohmudeondes encoding a GPPS enzyme and encoding the enzymes of the eannahinokt biosynthesis pathways e g AAB1, OLS, OAC, CBGAS, and one or more of CHDAS, THCAS, and CBCAS, are introduced into the photosynthetie microorganism, e.gv. cyanobacteria.:
[0072] It is desirable that GPPS- in particular is overexpressed to ensure a high level of GPP production in the cells. To obtain high levels of expression of GPPS or any of the present carmabinoid biosynthesis enzymes, one or more of the proteins may he expressed as a fusion construct, in preferred embodiments, the GPPS enzyme is expressed as a fusion construct, tog.* by fusing the poly ucleotide encoding the GPPS polypeptide ith the V end of a leader nucleic acid sequence encoding a protein that is expressed in cyanobacteria at a level of at least 1 % of the total cellular protein. For example, SEQ ID NO:l discloses the DMA sequence of the nptl GPPS fusion construct, comprising the GPPS gene from Picea abies (Norway spruce} fused to the npil gene encoding the kanamycin resistance protein, codon optimized for high- level Npt!*GPP protein expression and GPP pool size increase in the cyanobacteriumSynitchmy&tis (Betterle and Metis 2018). SEQ ID NO:2 discloses the amino add sequence of this Nptl:*GPP fusion construct, the expression levels of which approach those of the abundan t RfccL, the large subunit of Ruhisco in the modified cyanobacteria (FIG. 4).
|OQ73ί The use of Nptl and other fusion proteins to obtain high transgene yields in cyanobacteria an other photosynthetic microorganisms is described; e.g,* in US Patent Application No, 2018/0171342 and in Application PGT/US2017034754, the entire disclosures of both of which are incorporated herein by reference, f0974| Other polynucleotides that may be employed in fusion construct include, e,g,, chloramphe ea! aectyltransferase palynnclcotides; which confer chloramphenicol resistance, or polynucleotides encoding a protein that confers streptomycin, ampiciUin, or tetracycline resistance, or resistatiee to another antibiotic. In some embodiments, the leader sequence encodes less than the full-length of the protein, but typicall comprises a region that encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least %, or greater, of the length of the protein in some embodiments, a polynucleotide variant of a naturallyoccurring antibiotic resistance gene is employed. As noted above, a varian t: po!ynncleotideneed not encode a protein that retains the native biologies! function, A variant polynucleotide typically encodes a protein that has at least 80% identity, or at least 85% or greater, identity to the protein encoded by the wiid-type gene, e.g,, antibiotic resistance gene, in some embodiments:, the polynucleotide encodes a protein that has 90%. identity, or at least 95% identity, or greater, to the: wild-type antibiotic resistance protein. Such variant polynucleotides employed as leader sequences can also be codon-optimized for expression in cyanobacteria. The percent identi ty' is typically determined ith reference to the length of the polynucleotide that is employed in the construct, i,e,, the percent identity may be over the full length of a polynucleo tide that encodes the leader polypeptide sequence, of may be over a smaller length, erg., in embodiments where the polysmcleotide encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least 95%, or greater, of the length of the protein, A protein encoded by a valiant polynucleotide sequence need not retain a biological ftinciion, although codons that are present in a variant polynucleotide are typically selected such that the protein structure relative to the wild-type protein structure is not substantially altered by the changed codon, e.g.> a codon that encodes aft amino acid that has fee same charge, polarity, and/or is similar in size to the native amino acid.
100751 in some embodiments, the leader sequence encodes a naturally occurring cyanobacteria or other microorganisnial protein that is expressed at a high level {e,g., more than 1% of the total cellular protein) in natix¾ cyanobacteria or the other microorganism of interest, i.e., the protein is endogenous to cyanobacteria or another microorganism of interest. Examples of such proteins include cpeB, cpeA, cpeA, cpeB, apcA, apcB, rboL, rbcS, psbA, rpl, and rps. In some: embodiments, the leader sequence encodes less than the full-length of the protein, but it typically comprises a region that encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least 95%, or greater, of the length of the protein. Use of an endogenous microorganismal, e.g., eyanobacterial, polynucleotide sequence for constructing an expression construct in accordance with the invention: provides a sequence that need not he codon-optimized, as the sequence is already expresse at high levels in the microorganism, e.g., cyanobacteria, although codon optimization is nevertheless possible Examples of cyanobacterial or other microorganismal polynucleotides that encode epcB, epcA, cpeA, epefi, apcA, apeB, rbcL, rbcS, psbA, rpl, or rps are available, e,g,, at the WW website geneme.mierobedbjp/eyanobase. fft07til The polynucleotide sequence that encodes the leader protein need not he !M identical to a native cyanobacteria or other mieroorganisniai polynucleotide sequenee, A polynucleotide variant having at least 50% identity or at least 60*% identity, or greater, to a native microorganismal, e.g., cyanohaeterial, polynncleotidc sequence, e.g , a native epcB, cpeA, cpeA, cpeB, rbcL, rbcS, psbA, rpl, or rps polynucleotide sequence, may also be used, so long as the codons that vary relative to the native; polynucleotide are codon, optimized for expressio in cyanobacteria or the microorganism being used and do not substantially disrupt the structure of the protein. In some embodiments, a polynucleotide variant that has at: least 70% identity, at least 75% identi ty, at least 80% identity, or at least 85% identity, or greater to a native microorganismal,, e.g>, cyanobacterial polynucleotide sequence, c.g,> a native cpeB, epcA, cpeA, cpeB, rbcL, rbcS, psbA, rpl, or rps polynucleotide sequence, is used, again maintaining codon optimization for cyanobacteria o fee microorganism of interest in some embodiments, a polynucleotide variant that has least 90% identity, or at least 9.5% identity, or greater, to a native microorganismal, e,g., cyanobacterial, polynucleotide sequence, e.g., a native cpeB, cpcA, cpeA, cpeB, rbcL, rbcS, psbA, rpl, or rps polynucleotide sequenee, is used, The percent identity is typically determined with reference the length of the polynucleotide that is employed in. the construct, i.e., the percent identity may be oyer the full length of a polyirucieotide that encodes the leader polypeptide sequence, or may be over a smaller length, e.g., in embodiments where the polynucleotide encodes at least 25%, typically at least 50%, or at least 75%, or at least 90%, or at least 95%, or greater, of the length of the protein. Although the protein encoded by a variant polynucleotide sequence as described herein need not retain a biological function, a codon that varies from the wild-type polynucleotide is typically selecte suc that the protein structure of the native eyanobaeterial or other niicroorganismal sequence is not substantially altered by the changed eodon, e.g,, a codon that encodes an amino acid that has the same charge, polarity, and/or is similar in size to the native amino acid is selected.
100771 In some embodiments, a protein that is expressed at high levels in, the photosynthetie microorganism, e.g., cyanobacteria,, is not native to the organism in which the fusion construct in accordance with the invention is expressed, f or example, polynucleotides from bacteria or other organisms that are expressed at high levels in cyanobacteria or other photosynthetie microorganisms may be used as leader sequences, in such embodiments, the polynucleotides from other organisms are codon optiniized for expression in the photosyatheiie microorganism, e.g,, cyanobacteria. In some embodiments, eodon optimization Is performed such that codons used with an average frequency of less titan 12% by, e.g., S nedkocystk are replaced by more frequently used codons. Rare codons can be defined, e.g,, by using a codon usage table derived from the sequenced genome of the host cyanobacteriai cell. See, eg., the eodon usage table obtained from Kazusa DMA Research institute, Japan (website WWW, bazusa or.jp/codon/) use in eonfuiwtlom With software, e,«·,,“Gene Designer 2,0” software, from DM 2,0 (website www.dna20.com/) at a cut-off thread of 15%,
10078.1 In the context of the present invention, a protein, e g,, GFPS, that is“expressed at high levels” in photosynthetie microorganisms, e,g., cyanobacteria, refers to a protein that accumulates to at least 1% of total cellular protein as described herein. Such proteins, when fused at the N -terminus of a protein of interest to be expressed in cyanobacteria of othermicroorganisms, are also referred to herein as“leader proteins”,“leader peptides”, or“leader sequences”, A nucleic acid encoding a leader protein is typically referred to herein as a“leader polynucleotide” or '“leader nucleie acid equence” or leader nucleotide sequence”,
[0070] In all cases, suitable leader proteins can be identified by evaluating the level of expression of a Candidate leader protein in: the photosynthetie. microorganism of interest, e.g. , cyanobacteria. For example, a leader polypeptide that does not occur in the wil type microorganism, e.g., cyanobacteria, may be identified by measuring the level of protein expressed from a polyaucleotide codon optimized for expression in the microorganism, e.g., cyanobacteria, that encodes the candidate· leader polypeptide, A protein may be selected for use as a leader polypeptide if the protein accumulates to a level of at least 1%, typically at least 2%;, at least 3%, at least 4%, at least 5%, or at least 10%, or greater, of the total protein expressed in the cyanobacteria when th polyr cleotide encoding the leader polypeptide is introduced into cyanobacteria and the cyanobacteria cultured under conditions In which the transgene is expressed. The level of protein expression I typicall determine using SDS PAGE analysis. Following electrophoresis, the gel is scanned and the amount of protei detertnined by image analysis.
(09801 in one embodiment, a GPPS fro Abies gremdis is used, e g,, as show in SEQ ID NC):2. it will be appreciated, however, that any GPPS enzyme from any species that is capable of catalyzing the synthesis of GPP in the ceils can be used, e.g,, that is capable of catalyzing the productio of GPP from XPP and/or DM APP in the microorganisms,
10081] in a particular embodiment, the photosymlietic mieroorgahisms are modified to overexpress the GPP synthase (GPPS) gene, e.g. , by use of a codon-optimized Ahim gr ndis GPP synthase gene fused with the nptfhanamycin resistance DNA cassette (SEQ ID NO: 3 ), i order to overexpress the GPP synthase enzyme in the cell {SEQ ID NQ:2), Such overexpression leads to greater amounts of the GPPS enzyme in the cell and enhancement of the GPP pool size in the microorganism, e.g., cyanobacteria. Polynucleotides that are functional variants, conservatively modified variants, and/or that are substantially identical to SEQ ID NO;ls e.g., polynucleotides having 50%, 60%, 70%, 75%, 80%, 85%, 00%, 95%. 96%, 97%, 98%, 99%, or more identity to SEQ ID NO:l one can be used, o a p0lyuueleotide that encodes a protein having substantialidentity, e.g., 50l?4, 6:0%/70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identity to SEQ ID Q;2, can be used, in particular when their presence in the cell leads to the generation of sufficient GPP for cannabiuoid synthesis in some embodiments, a polynucleotide haying at least 95% identity to SEQ ID NO:l is used. In some embodiments, a polynucleotide dial encodes a protein baying at least 95% identity to SEQ ID NO: 2 is used. In, preferred embodiments, the GPPS are codon optimized for the, cyanobacteria or other photosynthetic .-microorganism used in the method
10082] Genes encoding enzymes of the can foinoid biosynthetic pathway are known and any such enzymes can be employed in the present methods, from any Species, so long as they ean be functionally expressed in the photosynthetic microorganisms, e.g , cyanobacteria, to effect the biosynthesis of the cannabinoids in the cells, A list of the genes needed to drive the cannabinoid biosynthetic pathway is show» in FIG. 5. and the associated alternative oxidocyelase enzymes (THCAS an CBCAS) that catalyze the oxidative eyciization of the monoterpene moiety of CBQA for the biosynthesis of Afotetrahydtoeatinahinoiie acid. (D9- THCA) and eannabiebromenic acid (CBCA), respectively, are provided HI Table 1 (Carvatho et al. 2017). In general, in addition to the C PPS-encodlng gene, genes are included for AAEL QLS, QAC, and CBGAS, as well as for CBDAS, THCAS, or CBCAS, depending on whether CBDA, .49-THC.4, or CBCA, respectively, is desired it will be appreciated, however, that other combinations of genes are possible as well, for example GPPS, AAEl, QLS, OAC, and CBGAS if CBCrA is desired, or GPPS, AAEl, OLS, OAC, as well as CBGAS, THCAS, and CBCA, if a combination of CIBDA, A9-THCA, and CBCA is desired. Tile coding sequences for the: indi vidual genes in the cannabinoid biosynthesis pathway are indicated in SEQ ID Q:3, Le,:, nucleotides 636-2798 for AAEl , nucleotides 2819^3973 for OLS, nucleotides 3994- 4299 for OAC, nucleotides 4320 5507 for CBGAS, and nucleotides 5528-7162 for CBDAS, These sequences, or variants thereof as described herein, can be used individually or in any combination, e.g., within the same openm, to bring about cannabinoid synthesis in the phoiosyuthetic microorganisms, e.g., cyanobacteria.
1(1083} In one embodiment, a codon-optimized polynucleotide sequence in operon configuration of the cannabinoid biosynthesis pathway is used, leading to the synthesis of cannabidioiic acid. Such a polynucleotide is shown as SEQ ID NO: 3, and includes coding sequences for AAEl , OLS, OAC, CBGAS, and CBDAS, whose polypeptide sequences are shown as SEQ ID NO :4, SEQ ID O:5, SEQ !D NO:6, SEQ ID NO:?, an SEQ ID NO: 8, respectively. Polynucleotides that are substantially identical to SEQ ID NQ;3, e.g., that have at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%!, 9634, 97%, 98%, 99%, or ore identity to SEQ ID NG:3, or that encode polypeptides that are functional variants, eg., conservatively modified variants, are substantially Identical to any of SEQ ID NOS, 4, 5, 6, 7, or 8, can he used, e.g., that have at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%. 98%, 99%, or more identity to SEQ ID Nos. 4, 3, 6, 7, or 8, can fee used, in some embodiments, a polynucleotide that has at least 95% identity to SEQ ID NO: 3 is used. In some embodiments, a polynucleotide that encodes a protein having at least 95% identity to SEQ ID NO;: 4, 5, 6, 7, or 8: is used.
10084} In embodiments where A9-THCA synthesis is desired, a poHmncleotide comprising the sequence shown as SEQ ID NO:9 can be used, or a polynucleotide that is substantially identical to SEQ ID NO:9, e.g., at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identical to SEQ ID TSiC>: , or that encodes a polypeptide comprising the amino acid sequence shown a S!Q ID NG;iG can be used, or that encodes a functional variant polypeptide that is substantially identical to SEQ ID NO: 10, e.g,, at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 10, In some embodiments, a polynucleotide that has at least 95% identity to SEQ ID NO: 9 is used. In some embodiments, a polynucleotide that encodes a protein having at least 9:5% Identity to SEQ ID NO: 16 is used hi a particular embodiment when A9-DICA synthesis is desired, all of the biosynthesis genes arc present within a single operon, e,g„ as shown in SEQ ID NO: 13, or using a polynucleotide having at least 56%, 60%, 70%, 73%, 80%, 85%, 90%, 95 , 96%, 97%, 98%, 99%, or more identity to SEQ ID NO:13. in some embodiments, a polynucleotide having at least 95% identity to SEQ ID NO: 13 is used.
{06851 In embodiments where CBCA synthesis is desired, a polynucleotide comprising the sequence shown as SEQ ID NOT l can be used, or a polynucleotide that is substantially identical to SEQ ID NOT T c.g , at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identical to SEQ ID NO: 11, or that encodes a polypeptide comprising the amino acid sequence shown as SEQ ID NO: 12, or that encodes a functional variant polypeptide that is substantially identical to SEQ ID NO: 12, e,g„, at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more Identical to SEQ ID NO: 12 to some embodiments, a polynucleotide having at least 95% identity to SEQ IP NO; 1 1 is used. In some embodiments, a polynucleotide that encodes a protein having at least 95% identity to SEQ ID NO: 12 is used, hi a particular embodimeftt, when CBCA synthesis is desired, all of the biosynthesis genes are present within a single operon, e,g„ as shown in SEQ ID NO 14, or using a polynucleotide having at Ieast59%, 60%, 70%, 75%, 8034, 85%, 90%, 95%, 96%, 97%, 98'%, 99%, or more identity to SEQ ID NO: 14 to some embodiments, a polynucleotide having at least 959» identity to SEQ ID NO: 14 is used.
|0086| The genes encoding the enzymes within: the biosynthesis pathway, ie,, AAE1 , OLS, OAC, and CBGAS, as well as CBDAS, THCAS, and/o CBCAS, can be together present within a single operon (c.g,, as in SEQ ID NO:3 in the case of CB1T4S synthesis, in SEQ ID NO:! 3 in the case of .49-THCA synthesis, or in SEQ ID NO: 14 in the case of CBCA synthesis) or present separately, or in any combination of individual genes and genes in an operon (e.g,, AAE 1 , OLS, QAC, and CBGAS within an operon, and CBDAS separately). The gene encoding CiPPS can also be included in the operon. The operon can include any combination of 2, 3, 4, 5, 6, 7 or 8 genes selected from GBPS, AAEl , OLS, OAC, CBGAS, CBDAS, THCAS, and CBCAS, and arranged in any order.
100871 In some embodiments, one or more of the genes wi thin the cannahinoid biosynthesi pathway, and/or the GPlPS gene, individually or as present within one or more operons, can be integrated into the genome of the host cell, e.g,, via homologous recombination, in one embodiment, all of the transgenes used in the invention, i.e., GPPS, AAE1 , OLS, OAC, CBGAS, and either CBDAS, THCAS, or CBCAS, are integrated into the host cell genome, in certain embodiments, however, one or more of the genes are present on; an autonomously replicating vector.
Table 1. List of the genes and enzymes involved in the biosynthesis of cannahinoids in Cannabis saliva L. (Carvalho et al., FEMS Yeast Mes 17, 2017),
Figure imgf000031_0001
I Cannabicbromenic acid | CBCAS [ WO f i ,3: § Morimota et al, j synthase i 2015/196275 i I 1998; I i Page and Stout j
\ 2015 j
Figure imgf000031_0002
(0088] in some embodiments, a ggaattaggaggttaattaa ribosome binding site (BBS) is positioned in front of fee ATG start codon of one or more of the GPPS and/or cannahinoid biosynthesis pathway genes, in fee photosynthetic microorganisms. This is designed to enhance the level of translatio of all fee genes encoded by the operon or construct. In some em bodiments, the n ucleic acids of the ggaattaggagghaattaa RBS are a codon-modified variant having at least 80% identity, typically at least 85% identity or 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the ggaattaggaggttaaiia RBS mseleotid.es, in some embodiments* the nucleic acids have at least 95% identity to the ggaattaggaggttaattaa RBS nucleotides.
10989) For the optimal expression of the GPPS and or cannabinoid biosynthetic proteins in cyanobacteria or other photosynthetic microorganisms, the coding sequences can be codo optimfeed for expression in the cyanobacteria or other nncroorganisms. In some embodiments, codon optimization is performed such that codons used with an average frequency of less titan, e.g,, 12% in a species such as Synechocystis (or whichever species is being used to perform themethods) are replaced by more frequently used codons. Rare codons can he defined, e.g./by usinga codon usage table derived from the sequenced genome of the host cyanobacteria! cell or other microorganism. See, e,g., the codon usage table obtained from Kazusa DNA Research institute, Japan (website www.kazusa.or jp/codon/} used in conjunction with software, eg>, "Gene Designer 2,0” software, from 1)19 A 2,0 (website wWw.dna20.com/) at a cut-off thread of 15%.
10090] The polynucleotides encoding the GPPS enzyme and/or tee eannabmojd biosynthesis operon are operabiy linked to one or more promoters capable of bringing about the expression of the GPPS and/or cannabinoid biosynthesis ehzymes in the cell at levels sufficient for the biosynthesis of cannab pids, In some embodiments, tire heterologous polynucleotide eneodteg the GPPS and/or the cannabinoid biosynthesis operon is operabiy linked to an endogenous promoter, e.g., the psbA2 promoter, e.g., by replacing the endogenous gene, e.g., the Sm chocyMis pshA 2 gene, with tire codon-optimized GPPS-eiicoding gene or the cannabinoid biosynteesis Qperori vda double homologous recombination,
10891] In other embodiments, the GPPB-eneoding polynucleotide andfor the cannabinoid biosynthesis operon are integrated into the genome and clones identified in which GPPS and/or the enzymes of the eannabmoid biosynthesis pathway are produced at sufficiently high levels to obtain eamiabinoid biosynthesis in tee cell, and the polynucleotides encoding the promoter or promoters responsible for the expression, identified by analyzing: the 5’ sequences of the genomic clone or clones corresponding to the GPPS gene or the operon. Nucleotide sequences characteristic of promoters can also be used to identify the promoter.
f8092] in other embodiments, tee G PS-eneoding: polynucleotide andfor the cannabinoid biosynthesis operon are operabiy linked to a heterologous promoter capable of driving expression in the pell, e.g., they are linked to a promoter within a vector before being introduced into the cell, and are then integrated together into the genome of the celf or are maintained together on an autonomously replicating vector. 1¾e promoters used can he either constitutive or inducible. In some embodiments, a promoter used for driving the expression of the GPPS or operon is a constitutive promoter. Examples of constitutive strong promoters for use in cyanobacteria or other photosynthesis microorganisms include, tor example, the psfi l gene or the basal promoter of the psb£>2 gene, or the rbcLS promoter, which is constitutive under standard growth conditions. Other promoters that are active in cyanobacteria and other photosynthetic microorganisms are also known. These include the strong cpc operpo promoter, the epe operon and ape operon promoters, which control expression of phyeohilisome constituents. 1"he Sight-indncible promoters of the pshAI, psbA2, an psM genes in cyanobacteria may also be used, as noted below. Other promoters that are operative in plants, e.g., promoters derived from plant viruses, such as the GaMV35S promoters, or bacterial viruses, such as the T7, or bacterial prompters, such as the PTrc, can also he employed in cyanobacteria or other photosynthetie microorganisms. For a description of strong and regulated prompters, any of which can be used in the present methods, e.g., promoters active in the cyanobacterium Amtbaena sp. strain PCC 7120 and $}weckocy$fy 5803, see e.g ., Elhai, FEMS Micmbmi Lett 134: 179484, (1993) and Fomiighieri, PImtu 240:309-324 (2014), the entire disclosures of which are mcoiporated herein by reference,
|0093) In some embodiments, a pro oter is used to direct expression of the inserte nucleic acids under the influence of changing environmental conditions. Examples of environmental conditions that may affect transcription by inducible promoters include anaerobic conditions, elevated temperamre. or the presence of light. Promoters that are inducible upon exposure to chemical reagents are also used to express the inserted nucleic acids. Other useful inducible regulatory elements include copper-inducible regulatory elements (Met ef al, Proc. Natl Acad. Set. USA 90:4567-4571 (1993); Furst et a!,. Cel! 55:705-717 (1988)5: copper-repressed pell promoter in SyMc ocpsiis (Kiuchmina ei a! . 2012 , J Blatechn 162:75-80): riboswitches, e.g, thcophyll e-dependent (Nafcahira ei at. 2013, Pkmt Cell Physiol 54:17244735; tetracycline apd chloMctraeyelffie-mducib!e regulatory elements (Gate el nf. Plant J. 2:397- 404 (1992): Roder te ed., Mat Gen. Genet. 243:32-38 (1994); Gate, Me0u Cell Bid. 50:411- 424 ( 1995)) ecdyspne inducible regulatory elements (Christopherson et al , Pmc. Natl Acad Set, USA 89:6314-6318 (1992); KtmtmUt · et aί, Bhό toxica! . Emirm, Safety 28:14-24 (1994)); heat shock inducible promoters, such as those of the bsp70/dnaK genes (Takahashi ei al, Plant PhysM. 99:383-390 (1992); Yabe et al, Plant Cel! Physio!. 35: 1207-1219 (1994); Ifeda ef al., Mol. Gen. Genet. 250:533-539 (1996)); an lac operon elements, which are used in combination with a constitutively expressed lac repressor to confer, for example, IPTG- indudble expression (Wilde etal, EMBO J. 1 1 :1251-1259 (1992)), An inducible: regulatory element also can be, for example, a nitrate-mdueible promoter,
Figure imgf000034_0001
derived from the spinach nitrite reductase gene {Back etal., Plant Mol Biol 17:9 (1991)), or alight- nducible promoter, such a that associated with the small subunit of RuBP carboxylase or the LHCP gene fa ilies (Peinhaum et el, Mot Gen, Genet. 226:449 (1991); Lam aiid Chua, Science 248:471 (1990)),
(0094} in some embodiments, the promoter is from a gene associated with photosynthesis i the species to be transformed or another species. For example such a promoter from one species may be used to direct expression of a protein in transformed cyanobacteria or other photosynthetie microorganisms. Suitable promoters may be isolated fk>m or synthesized based o.a known sequences from other photosyntlietie organisms,
109951 In certain embodiments, the methods comprise introducing expression cassettes that comprise nucleic acid single genes or operons encoding the genes of the camiabinoid biosynthetic pathwa (FIG, 5) into the photosynthetie microorganism, e,g„ cyanobacteria* wherein the operon is linked to a epc promoter, or other suitable promoter; and culturin the microorganism, e.g., cyanobacteria under conditions in hich the single gene or nucleic acids encoding the cannabinoid biosynthesis operon are expressed. In some embodiments, expression cassettes are introduced into flie xfrdPgene locus, eneoding the Dl/32 kD reactio center protein of photosystem-II, in which ease the
Figure imgf000034_0002
2 promoter is the native cyanobacteria promoter. In other embodiments, expression cassettes are introduced into the g!gAl gene locus, encoding the glycogen synthase 1 enzyme, in which ease the g!gAl promoter is the native cyanobacteria prompter:
10996} In a partieu r embodiment, the polynucleotides encoding the GFPS enzyme, e,g., a GPPS fusion protein, and encoding the members of the cannabihoid biosynthesis pathway are introduced into the ceils using a vector. Vectors comprising nptl*GPPS or the camiabinoid biosynthesis pathway operon: nneleie acid sequences typicall comprise a marker gene that confers a selectable phenotype on cyahobaeteda or other microorganisms transformed wi th the vector. Such markers are known, for example markers encoding antibiotic resistance, such as resistance to chloramphenicol, kanamyciu, spectinomycio, etythromycin, G418» bleomycin, hygromycin, and the like. 10097] Cell transformation methods and selectable markers for cyanobacteria and other photosynthetie mictoorgairisrfts are well known in the art (Wirth, MQI. Gen . Genet·. 2l6{1): 175-7,1989; Koksharova, AppL Micr hiol, Sioteehn 58(2); 123-37, 2002; Thelwell et aL Froc. Natl Aead. Set LISA . 95:10728-10733, 1998: Foraiighieri and Melts, Planta 248{4):933-946, 2018: Bctterle and Melts, ACS Synth Biol 7:912-921, 2018). transformation methods and selectable markers for are also well know ( <¾¾ «,£.> Sambrook :et ai, stipni%
1(1098} In some embodiments, an expression construct is generated to allow the heterologous expression of the npff*GPPS and/or the eaunabinoid biosynthesis operon genes in$yiwcfw $tis through the re lacement of the Syneckocystis psbA2 gene wit the codon- optimized nptI*GPPS or cannabinoid biosynthesis ope on genes via double homologous recombinaiion. In some embodiments, the expression: construct comprises a codon-optimixed nptl*GPP$ or the eannabmoid biosynthesis operon genes gene operabfy linked to an endogenous cyanobacteria promoter, in some aspects, the: promoter is the p$hA2 promoter,
|O099j In some embodiments, ihe: vector includes sequences for homologous recombination to insert the fusion construct at a desired site in a photosynthetic microorganismak e.g., cyanobaetetial, genome, .g.* such that expression of the polynucleotide encoding the fusion construct is driven by a promoter that is endogenous to the organism. Vectors to perform homologous recombination include sequences required for homologous recombination, suc as flanking sequences foat share homology with the target site for promoting homologous recombination,
(010d] In some embodiments, the, photosynthetie microorganism, e.g,, cyanobacteria, is transformed with an expression vector comprising fhe npil GPP$ or the cannabinoid biosynthesis operon genes and an antibiotic resistance gene Detailed descriptions are set forth, e.g., in Formighieii and Melis (Phmia 240:309-324, 2014) Bglupd t &l (Set Rep. I8;6:36640, 2016), and Wang et al (ACS Synth. Biol. 7:276-286, 018), which are incorporated herein by reference, Transfermants are cultured i selective media containing a antibiotie to which an tmtraiisformed host cell is sensitive. Cyanobacteria, for example, normally have up to 1 (50 copies of identical circular DNA chromosomes in each cell. The successful transformation with an expression vector comprising, e.g., the nptl*GPPS, the cannabinoid biosynthesis operon genes, and an antibiotic resistance gene normally occurs in only one, or just a few, of the many cyanobacterial DNA copies, Hence, the presence of the antibiotic is necessary to encourage expression of the transgenic copy or copies of the DN A for cannabinoid production in the absence of the selectable marker (antibiotic), the transgenic copy or copies· of the DNA would be lost and replaced by wild-type copies of the DNA.,
{01011 lii some embodiments.. cyanobacteria! or other mieroorgaiiismai transformants are cultured under continuous selective pressure conditions (presence of antibiotic over many generations) to achieve DNA homoplasmy in the transformed host; organism. One of skill in the art understands that, to atai homoplasmy, the num ber of generations and length of time of culture varies depending on the particular culture conditions employed. Homoplasmy can be determined, e.g., by monitoring the genomic DNA composition in the cells to test for the presence or absence of wild-type copies of the cyanobacierial or other microorganismal DNA,
|0102} “Achieving honioplasmy” refers to a quantitative replacement of most, s,g., 70% or greater, or typically all, wild-type copies of the cyanobacteria! DNA in foe cell with foe transformant DNA copy that carries die nptl*GPI>& and foe cannabinoid biosynthesis operon traosgenes. This is normally attained Over time, under th continuous selective pressure (antibiotic) conditions applied, and entails the gradual replacement during growth of the wikh type copies of the DNA with the transgenie copies, until no Wild-type cop of the cyanobacierial or other mleroorganismal DNA Is left in any of the transformant cells. Achieving homoplasmy is typically verified by quantitative amplification methods such as genomic-DNA FCR using primers and/or probes specific for the wild-type copy of the cyanobacteria! DNA, In some embodiments, the presence of wild-type cyanobacteria! DNA can fee detected by using primers specific for the wild-type cyanobaeterial DNA and detecting the presence of .g., the native pe operon, gigA l arpsM 2 genes. Transgenic DNA is typically stabl e under homoplasmy conditions and present in all copies of the cyanobacierial DN A.
{0103} In some embodiments, the photosytthetie microorganism, eg. cyanobacteria, is cultured under conditions in which the light intensity is varied. Thus, for example, when psbA2 promoter is used as a promoter to drive expression of tiptI*GPPS or the cannabinoid biosynthesis operon genes, transformed cyanobaeterial cultures can be grown at low light intensity conditions (e.gr,, 10-50 pmol photons m 2 s
Figure imgf000036_0001
then shifted to higher light intensity' conditions (e.g , 500-1 ,000 pmol photons m - s 4). The ps:M2 promoter responds to foe shift: in l ight intensity by up-regulating the expression of the stptl*GPPS fusion construct iransgene and the cannabinoid biosynthesis pperon genes in Symehotystts, typically' at least about 10- fold. In other embodiments, cyanobaeterial cultures can; be exposed to increasing light intensit conditions (e.g., from 50 pmol photons m 2 to 2,500 p ol photons m - s f ) corresponding to a diurnal increase in light intensity up to full sunlight. The psbA2 promoter responds to the gradual increase in light intensity by up-regulating the expression: of the nptI*CrPP$ or the cannabinoid biosynthesis operon genes hi Svneehocytitis in parallel with the increase in light intensity,
[0104] in some embodiments, eyanpbacterial or other microbial cultures are cul tured under conditions in which the cell density is high and transmitted light intensity through the culture is steeply attenuated. Thus, for example, when a epe promoter is used as a promoter to drive expression of Hptf*GFPS or the cannabinoi biosynthesis operon genes, transformed cyanobacteria! cultures can be grown at cell densi ty conditions in which incident light intensity is high but irradiancc entering the culture is quantitatively absorbed due to the high density of the culture, a desirable property for commercial exploitation (e,g. I g dry cell biomass per L, culture) . The epe promoter responds to the diminishing light intensity within the culture by up- regulating the expression of the associated nptf*GPP$ or the cannabinoid biosynthesis operon: genes mSyneckoeysfis, typically at least about 10-fold. Thus, the epe promoter responds to the gradual decline in effective light intensi ty transmitted through the culture by up-regulating the expression of the nptl^GPFS or the cannabinoid biosynthesis operon genes in S tiethocystis in a function antipafallel with the lowering in light intensity.
Si Production of caMiabinoids in eyatiohiiefe isi or other photosyattietic
microorganisms
|bG05] To produc cannabinoids, transformant photosynfhciie mieroorpnisms, eg;, cyanobacteria, are grown under conditions in which the heterologous nptl^GPPS and the eannabinoid biosynthesis operon genes are expressed. Methods o mass culturing photosynthetie microorganisms, &g.. cyanobacteria, are known to one, skilled in the art. For example, Cyanobacteria or other microorganisms can be grown to high ceil density in photobioreaetors (see, e.g., lee et hi., Biotech. Bioengineering 44:1161 -1167, 1994; Chaumont, J AppL Phymlogy 5:593-604, 1990). Examples of photobioreaetors include cylindrical of tubular bioreaetors, sec, e.g , tLS, Pat Nos, 5,958,761, 6,083,740, US Patent Application Publication No, 2007/0048859; WO 2007/Di 1343, and W02007/09gl50. Hip density photobioreaetors are described in, for example, Lee, et al, Biotech Bioengineering 44:1 161 -1167, 1994 Other photobiorcaetors suitable for use in tire invention are described, e:g„ in WG/2011/034567 and references cited therein, e.g,, in the background section, Phntobioreaeior parameters that can be optimized, automated and regulated for production of photosynthetie organisms are further described in Puis (Arrί Microbiol Biotechnol 57:287- 293, 2001 ), Such parameters include, but are not limited to, materials of construction, efficient light delivery into the reactor lumen, light path, layer thickness, oxygen released, salinity and nutrients, pH, temperature, turbulence, optical density, and the l ike,
10106} Transformant photosyathetic microorganisms, g,, eyanpbacteria, that express a heterologous npi GPPS and the eannahinoid biosynthesis operon genes can be grown under mass culture conditions for the production of eannahmoids. In typical such embodiments, the transformed organisms are grown in bioreactors or fermenters that provide an enclosed: environmetif, For example, i some embodiments· for mass culture, the cyanobacteria are grown in enclosed reactors in quantities of at least about 100 liters, or 500 liters, often of at least about 1000 liters or greater, and in some embodiments in quantities of about 1,000,000 liters or more. Large-scale eidturc of transformed cyanobacteria dial comprise a heterologou nptI*GPPS and the eannahinoid biosynthesis operon genes where expression is driven, by a light sensitive promoter, such as a pshA2 or epe promoter, is t pically carried out in conditions where the culture is exposed to natural sunlight. Accordingly, in such embodiments, appropriate enclosed reactors are used that allow light to reach the cyanobacteria or other microbial culture,
1011171 Growth media for culturing the phutosjdithefie microorganism,
Figure imgf000038_0001
cyanobacteria, transformants are well known in the art. For example, cyanobacteria or other mictoorganisnis may be rown on solid BCi-M media (see, e g.< Rippka ei at, J. Gm MidroMol .1 11 : 1 -hi , 1979), Alternatively, they may be grown in liquid media {s e.g , Bentley, FK and Melis, A. Blaiechiiol Bioeug. 109: 100-- ] 09. 2012). In typical embodiments for production of cannahinoids, liquid cultures are employed For example, such a liquid culture may bemaintained at, e,g,, about 25 °G to 35 under a slow strea of constant aeration and illumination, &g., at 20 pmol photons m“? s or greater. In certain embodiments, an antibiotic, e.g , chloramphenicol, is added to the liquid culture. For example, chloramphenicol may he used at a concentration of 15 pg/ml.
10108} In some embodiments, photosynthetic microorganisms, g., cyanobacteria* transformants: are grown pheioautotrophieaUy in a gaseons/aqneous two-phase photobioresetor (see, e.g., United States Patent 8,993.290; also Bentley, FK. and Melis, A . BiotechnoL Sioeng., 109: 100-10 (2012)). In some embodiments, the methods of the present invention comprise obtaining cannabinoi s using a diffusion- ased method for spontaneous gas exchange in a gaseous/aqueous two-phase photobioreaotor (see, ag., United States Patent 8,993,290). in particular aspects of the method, carbon dioxide is used as a feedstock for the photosynthetic generation of cannahinoids in. cell culture, and the headspace of the bioreactor is filled with 100% C02 am! sealed. This allows diffusion-based CO uptake and assimilation by the cells via photosynthesis, and eonemfti tantreplaeement of the CO? in the headspace with O . In some embodiments, the pliotosymkerically generated cannabraoids accumulate as a nan-miscible product floating on the to of the liquid culture.
10109] in particular embodiments, a gaseous/aqueous two-phase photo- bioreaetor is seeded with a culture of microbial, e.g., cyanohacteriab cells and grown under continuous illumination, eg., at 75; nmol photons nr; s h and continuous bubbling with air. Inorganic carbon is delivered to the culture in the form of aliquots of 100% CO gas, whic is slowly bubbled through the bottom of the liquid culture to fill the bioreaetor headspace. Gnee atmospheric gases ar replaced with 100% G0¾ the headspace of tiie teactor is sealed and the culture is incubated, e.g., at about 25°C to 40&C under continuous illumination, e.g., of 50 nmol photons m rf or greater up to full sunlight Slow continuous mechanical mixing is also employed to keep cells in suspension and to promote balanced pell illumination and nutrient mixing into the liquid culture in support of photosynthesis and biomass accumulation, Uptake and assimilation of headspace GO? by cells is coneomi tatrtly exchanged for O* during photoautotrophic growth. The sealed bioreaetor headspace allows for the trapping, accumulation and concentration of photosyauhetieally produced catinabinoids.
101101 In some embodiments, the photoaatotrophic cell growth kinetics of the microbial, e.g., cyanobacteria, transformants are similar to those of wild type cells in some embodiments, tile rates of oxygen consumption during dark respiration are about the same in wild-type cyanobacteria or other photosynihetic microbial cells. In some embodiments, the rates of oxygen evolution and the initial slopes of photosynthesis as a function of light intensity.'' are comparable in wild-type Sywckocystjs cells and Syned c tis transformants, when both are at sub-satufating light intensities between 0 and 25ft p ol photons nr2 s_!.
10111] Gannabinuids produced by the modified cyanobacteria or other microorganisms can be harvested using knowm techniques, Gannabinoids are not miscible in water and they rise to and float at the surface of the microorganism growth medium. Accordingly, in some embo i ents cannabinoids are siphoned off from the- surface- of the growtlt medium and sequestered in suitable containers, or floating eannabinoids are skimmed from the surface of the liqui phase of the culture an isolated in pure form. In some embodiments, the photosymthetipally produced non-miseible eaiioabinoids in liquid form are extracted from the liquid phase by a method comprising overlaying a solvent such as heptane, deeane, or dodecane on top of the li quid culture in the biorcaetor, incubating at, e.g., room temperature for about 30 minutes or longer; and removing tire solvent, e.g * heptane, layer containing the eannabmokls,
|01121 In some embodiments, the eannabmokls produced by the modified cyanobacteria or other microorganisms are extracted from the interior of the cells. For example, the cells can be isolated, e,g., by centrifugation at 5,000 for 20 minutes, and then resuspended In, e.g,, distilled waten The resuspended cells can then be disintegrated, e,g., by forcing the cells through a French press {e.g., at 1500 psi), by sonic-atk , or treating them with glass beads. The resulting crude cell extract can then he centrifuged, e.g,, at 14,000 g for 5 minutes, and the supernatant {or “disintegrated cell suspension”) used for extraction of th cannabinoids. In on embodiment, the cannabinoids are extracted by first mixing the disintegrated cell suspension with a strong: acid and a salt, e.g., HIBOL and MaCl, to ease the separation of the; aqueous phase from: the solvent phase, and to force hydrophobic molecules such as CBD to migrate to the solvent phase, Sneh methods arc known in the ail, in some embodiments, HaSO and NaCi are added at a volume-to-volunie ratio of about [cell suspension / H2SO4 / NaCl - 3 / 0,12 / 0.5], The suspension can then be extracted with one or more Organic solvents, e.g., hexane, heptane, ethyl acetate, acetone, methanol, ethanol, and/or propanol in some embodiments, the cannabinoids are obtained from the cultured modified cyanobacteria or other microorganisms by freeze drying the cells and subsequently extracting them with one or mom organic solvents, e.g., methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, and/or heptane. In some embodiments, following extractio of the cannabinoids from the disintegrated or freeze -dried cells, the organic layer can then be separated from the aqueous medium and dried by solvent evaporation* leaving the cannabinoids in pure form. The purified cannabinoids can then be resuspended and analysed, e.g., using GC-MS, CiC-FlO, or absorbance spectroplmtoinetry such as D'V spectrophotometry.
EXAMPLES
IMIS] The examples described, herein are provided by way of illustration only and not by way of limitation. One of skill in the art recognizes a variety of non-crit al parameters that could be changed or modified t yield essentially similar results,
Example 1: Cannabrooifi production using genetically engineered cyanobacteria
[0114] The present invention provides methods and compositions for the genetic modification of cyanobacteria to confer upon these microorganisms the ability to produce cannabinoids upon heterologous expression of a nptf*GPPS fusion construct fro Norway spruce (Pieea abies) and the eannabineid biosynthesis operon genes fro cannabis {Cannabi saliva) or a variant thereof in some embodiments* the invention provides for production of earinabmoitfs in pseous-aqueous two-phase photobioreaetors and results in the renewable generation of a hydrocarbon bio-product which can be used, e:g , for chemical syn thesis , or for pharmaceutical, medical, and eosmetics-related applications. This example illustrates the expression of the heterologons npiPGPPS and earmabinoid biosynthesis operon genes for the production of eannabinoids.
iOiiSS Thi example further illustrates that camiabinoids can be eontimiously (eonstitutively) generated in cyanobacteria transformants that express the heterologous npti^GPPS fusion construct and cannabinoid biosynthesis operon genes, Further, this example demonstrates that eannabinoids can spontaneously diffuse out of cyanobacteria transformants and into the extracellular water phase, and be collected from the surface of the liquid cidture as a water- floating product This example also demonstrates that this strategy for production of eannabinoids alleviates product feedback inhibition, product toxicity to die cell, and the need for labor-intensive extraction protocols,
101161 Photosynthetic microorganisms, with the cyanobacterium Spmcl cpstis sp, BCC68Q3 as the model organism, were genetically engineered to express a nptl*GPPS fusion construct and cannabinoid biosynthesis operon genes, thereby endowing upon them the property of cannabinoid production (FIG, 5), Genetically modified strains were used in an enclosed mass culture system to provide renewable eannabinoids that are suitable as feedstock in chemical synthesis and the pharmaceutical, medical, and eosmetics-relate industries. The eannabinoids were spontaneously emitted by the ceils into the extracellular space, after which they floated to the surface of the liquid phase where they were easily collected without imposing any disruption to The growih/productivlty of the celts, The genetically modified cyanobacteria remained in a continuous growth phase, coostitutively generating and emitting eannabinoids. The example further provides a: eodon-optimixed npiI*GPPS fusion construct and cannaMnoid biosynthesis opero genes for improve yield of eannabinoids in photosynthetie cyanobacteria, e.g , Synechocy lis.
Materials and Methods
Strains md growth e ulith
|0117j The Έ. coU strain "DH5d was used for routine subcloning and plasmid propagation, and was grown in LB media with appropriate antibiotic as selectable markers at 37 °C, according to standard protocols·. The glucose- olerant cyanobacteria! sfaai& yneehqeysiis sp. PCC 6803 (Williams, JGK (1988) Methods EnzymoL 167:766-768) was used as the recipient strain in this study* ari is referred to as the wild type. Wild type and transformant strains were maintained on solid BG-11 media supplemented with 10 roM TES- aQH (pH 8,2), 0.3% sodium thiosulfate. and S mM glucose. Where appropriate, chloramphenicol. k ramyoin, spectmomycin, or erythromycin were used aft a concentration of 15-30 pg/mL. Liquid cultures were grown in BG- 11 containing 25 mM sodium phosphate buffer, pH 7,5. Liquid cultures for inoculum purposes and tor photoautofrophic growth experiments and SDS-PAGE analyses were maintained at 25 £'C under a slow stream of constant aeration and illumination at 20 pmol photons nr3 s L The growth conditions employe when measuring the production of catmabinoids from Syneckocyst cultures are described below in the cannabinoid production assays section.
Codon-use optimization of the heterologou nptt*GPPS fusion constfiJct and cannabinoid biosynthesis operon genes for expression in Synechocysiis $p PCC 6S(>3 a d Escherichia col;
jOllRj The nucleotide and translated protein Sequences of the heterologous hrέI <}RR8 fusion construct and cannabinoid biosynthesis operon genes were obtained from the NCBI GenBank database (National Center for Biotechnology Information; see, e.g., able 1). The protein sequences of the heterologous nptI*GPPS fusion construct and cannabinoid biosynthesis operon gene products ere obtained from the NCBI GenBank database (National Center for Biotechnology Information; see, ¹.g,, SEQ ID NOS:2, 4-8, The eodon-use of the resultin e-DMAs was then optimized for expression in Synechacystis ap. PCC 6803 and £, c -oli (SEQ ID NOT and SEQ ID NOG) To maximize the expression of the heterologous p(I*GPPE fusion construct and cannabinoid biosynthesis Operon genes iti Syttedmcystis sp, PCC 6803 and E. colli, these protein sequences were back-translated and codon-optimized according to the frequency of the codon usage in Syneehocystis - . PCC 6803. The codon-optimiKation process was performed based on the codon Usage table obtained fro Kazttsa DNA Research Institute, Japan (*¾*?, e.g: , the www website kaznsa.ofop/eodon/), and using the“Gene Designer 2,0” software from DNA 2,0 (see, e.g., the W W Website drta20.com/), The codon-optimized genes were designed with appropriate restriction: sites flanking the sequences to aid subsequent cloning steps.
[0119] Samples for SDS-PAGE analyse were prepared from Synechocys s cells resuspende in phosphate buffer pH 7.4 at a concentration of 0.12 mg/ml chlorophyll. The suspension was supplemented wife 0.05% w v lysoz e (Thermo Scientific) and incubate with shaking at 37 3C for 45 min. Cells were then pelleted at 4,000 g, washed twice with fresh phosphate buffer and disrupted with a French Pressure chamber (Am!nco, USA) at 1500 psi in the -presence of 1 niM PMSE Soluble protein was separated from the total cell extract by centrifugation at 21,000 g and removed as the supernatant fraction. Samples for SOS-PAGE analysis were solubilized with 1 volume of 2x denatufing rotein solubilization buffer (0.25 M Iris, pH 5,8, 7% w/v SDS, 2 M urea, and 20% glycerol). I addition, all samples in denaturingSolutions were supplemented with a 5% (Wv) of (Tmercaptoeibanol and centrifuged at 17,900 g for 5 mi prior to gel loading. For Western blot analyses. Any kD™ (BIO-R D) precast SDS-PAGE gels were utilized to resolve proteins, which were then transferred to PVDF membrane (!mmobi!on-FL 0.45 pm, Miilipore,USA) for immnnodeteetion using the rabbit immune serum containing specific polyclonal antibodies against the proteins of interest. Cross- reaetions were visualized by the Supersignal West Pico Chemiluminiscent substrate detection system (Thermo Scientific,. USA).
CMo phylldeierminatim, pfioiosynthetic productivity and biomass quantitation
10129] Chlorophyll a concentration in cultures was determined speetrophotometrieaily in 90% methanol extracts of the cells according to Meeks and Castenholz {Arch. Mikrdbwi 78:25-41, 1971). Photosynthetie produetiyiiy of the cultures was tested polarographieally with a Clark-type oxygen electrode (Rank Brothers, Cambridge, England). Cells were harvested at the mid-exponential growth phase, and maintained at 25”C in .BCrl 3 containing 25 mM HEPES-NaOH, pH 7.5, at: a chlorophyll a concentration of 10 pg/mE. Oxygen evolution was measured at 25 C in the electrode upon yellow actinic illumination, which was defined by a C 3-69 long wavelength pass cutoff filter (Coming, Coming, NY). i¾otosynthetic activity of a 5 mL aliquot of culture was measured at varying actinic light intensities in the presence of 15 mM NaHCCh pH 7.4, added to provide inorganic carbon substrate and thereby facilitate generation of the light saturation curve of photosynthesis. Culture biomass 'accumulation was measured gravimetrically as dry cell weight, where 5 ml, samples of culture were filtere through 0.22 pm Millipore filters, washed three times to remove nutrient salts. Subsequently, the immobilized ceils were dried at 90 °C for 6 h prior to Weighing the dry ceil weight.
Cannahinoki pmditciion an qumtUficathm assays
1012:1] ’nech.acystis cultures for eannabinoid production were grown photoautotrepbically in 1 L gaseous/aqueous two-phase photobioreactors, described in detail by Bentley and Mefis (2012; Bkuechno! Bioeng. 109: 100- 109}. Bioreaetors were seeded with a 700 ml cultur of SynechOcystis cells at an OD730 am of 0.05 in BOl 1 medium -containing .25 siM sodiu phosphate buffer, pH 7.5, and grown under continuous illumination at 75 mhioΐ photons nr2 s
1 , and continuous bubbling with air, until an OD730 nra of approximately 0.5 was reached. Inorganic carbon was deli vered to the culture in the form of 500 uiL aliquots of .100% COj gas, which was slowly bubbled though the bottom of the liquid culture to fill the bioreactor headspace. Once atmospheric gases were replaced with 100% OOj, the headspace offhe reactor was sealed and the culture was incubated under continuous illumination of 150 pmol photons nr2 s i; at 35°C. Slow continuous mechanical mixing was employed to keep cells in suspension and to promote balanced ceiHilumination and nutrien t mixing: into the liquid culture in support of photosynthesis and biomass accumulation, Uptake and assimilation of headspaee CO2 by ceils wa concomitantly exchanged for Ch during photoantotrophie growth. The sealed bioreactor headspaee allowed for the trapping, accumulation and concentration of photo ynthetiealiy produced caftnabinoids, as liquid compounds floating on the surface of the aqueous phase,
10122} Photosyttheficallyprodueednon-miscible canftabino ids in liquid form were extracted from the liquid phase upon overlaying 20 ml, heptane: on top of the liquid culture In the bioreactor, and upon incubating for 30.mit; or longer, at room temperature, The heptane layer was subsequently removed and analyzed by GCfPlD, GC-MS, and absorbance spectrophotometr for the detection of cannabinoids by comparison with the liquid of a standard also dissolved in heptane, GO-FID analysis was performed with a Shimadzu 2014 instrument, GC-MS analyses were performed with an Agilent 6890GG/5973 MSD equipped with a 0B-XJL.B column (0,25 mm,i,d. x 0.25 yurt 30 m, J <&W Scientific), Oven temperature was initially maintained at 40 °C for 4 min, followed by a temperature increase of 5“C/mirs to 80 °C, and a carri er gas (helium) flow rate of 1.2 ml per minute, Absorbance spectrophotometry analysis was carried out: with a Shimadzu IJ V-I MO spectrophotometer.
0123 Accumulation of cannabinoids in the liquid phase was quantified speetrophotometricaily according to .known absorbance spectra and extinction coefficients of eatnabidiol and cannabidiolie acid in organic solvents ifo.g , see FIG. 7), The majority of photeswthetieally produced eanuahinoids accumulate -as a liquid floating over the aqueous phase of the bioreactor. A small amount of cannabinoids was initially retained within the cells, but was teased out of the cells by the 20 niL of heptane organic overlayer. Therefore, the non- miscible, heptane-extracted cannabinotds were used to generate the absorption spectra of cannabidiol and cannabidiolie acid in heptane for quantification urposes
Results
[Hi 24] Tlie tiative Escherichia cofi K12 - pfl gene, the Picea aMes (Norway spruce) GGPS gene, and the native Cmmbis sativa eannabinoid biosynthesis genes have codon usage different from that preferred by photnsynihctie microorganisms, e.g., cyanobacteria and mictoalgae. The unicellular cyanobacteria SytiechmysiL· sp. were used as a model organism in the development of the present invention. Lie novo codon -optimised nptI &GPS, and C&mahis smiva. eannabinoid biosynthesis genes were designed and Synthesized. In the optimized version of these genes, SEQ ID NO; 1 an SEQ ID NO:3, the codon usage was adapted to eliminate codons rarely used in Synmtuxystis, and to adjust the GC/AT ratio to that of the host. Rare codons were defined using a codo usage table derived from tlie sequenced genome of Sy diOcyst The SEQ ID NO: 1 and SEQ ID NO:3 sequences used in this example were: the codon-optim ed npil, GGPS. pud Cmnabis sativa eannabinoid biosymhesis genes for expression in Sytiedwcystis.
(0125j SDS-PAGE analyses and immune-detection of the¾p/:/, GGPS, and Cannabis satim eannabinoid biosynthesis gene products, using specific polyclonal antibodies raise against tlie E, cu/i-ex pressed recombinant protein, confirmed the presence of these recombinant proteins in Svwcbaeystis (e.g., FIG.4) These results clearly showed that the recombinant npff, GGPS, and Cmmtibis sativa eannabinoid biosynthesis gene products were expressed in Synechovystis transformants, and that they accumulated as internal proteins in the cell.
{0i26j The above results demonstrated that Sy ehoeystis can be used for heterologous transformation using the nptI, GGPS gene, and the CamiaPis sativa eannabinoi biosynthesis genes, and that such transformants expressed and accumulated the respective proteins in their cytosol. To determine whether the expresse recombinant proteins are metabolicaliy competent, wild type and transformants were cultivated under the conditions of the gaseous/aqueous two-phase bioreactor (Bentley FK and Metis A. (20G2), Biotedinol Biaeng.
109; 100-109), with 100% CCh gas occupying the headspace prior to sealing the reactor to allow autotrophic biomass accumulation. Samples were obtaine from the surface of liquid cultures (to detect non-niiscible liquid cannabinoids floating on top of the aqueous phase) and analyze by GC-FID (e.g., FIG, 6) of GC-MS (e.g., FIGS. 14.4-148). [0127j Quantification Of cannabinoi ds in the heptane-ex tragted samples from th nptI*GPPS fusion construct and cannahinoid biosynthesis operon transformants was determined according to foe Beer -Lambert Law, using foe absorbance values measured at 250 nm and th known molar extinction coefficient of eannabinoids. During 48 h of active photoautotropble rowth in the presence of CO? in a sealed gaseous/aqiteous two-phase bioreaetor, a 700 ml culture of nptI*GPPS fusion construct and cannaMooid biosynthesis operon trans&rmants produced caiinabinoids in the form of a non-m erble product floating on the surface of foe eidture.
Figure imgf000046_0001
101281 This example illustrates the production of eannabinoids in a system: where the same organism serves both as photo-catalyst and producer of ready-made compounds. A number of guidelines have been applied in the endeavor of cyanobacteria! eannabinoid "biosynthesis, as they pertain to foe selection of organisms and, independently, to the selection of potential product. Cri teria for the selection of Organisms include the soiar-to-product energy conversion efficiency, which must be as high as possible.: This important criterion is better satisfied with : photosynthetic microorganisms than with crop plants { dis A., Plani Science 177:272-280, 2009). Criteria for foe selection of potential commodity produets include (i) foe commercial utility of the compound and (it) the question of product separation from the biomass, which enters prominently in the economie of the proces and i a most important aspect in commercial application. This example demonstrates that catraaMrioids are suitable in this respect, as they are not miscible in water, spontaneously eparating from foe biomass an ending-up as floating compounds on the aqueous phase of the reactor and culture that produced them. Such spontaneous product separation: from the liquid culture alleviates the requirement of time-consuming, expensive,: and technologically complex biomass harvesting and dewatering (Panquah e/ at, J Chem Tech Biotech· 84: 1078Ί083, 2009; Saveya fi/ aL, ,L Re. Set lech. 6:51-56, 2009)) and product excision from the cells which otherwise would he neede for product isolation.
|0129| In the piimsii of renewable product, photosynthesis, eyanobaeteria. or microalgae and eannabinoids meet the above-enumerated criteria: for“process’;“organism” and‘product”, respectively. Thi example shows that eannabmoids can be heterologously produced vi photosynthesis in microorganisms, :e.g., cyanobacteria, genetically engineered to heterologously express plant nptI*GPPS and the cannahinoid biosynthesis operon genes. 10130] The canfta moids discussed in the present disclosure are useful it,:eqg„ die cosmetics, biopharmaceutkaj:, and medicinal fields. Currently, eanoabinoids are extracted from plants, sueii as Cannabis which, depending on the species, may contain a variety of can ahinoids and other compounds in their glandular frichome essential oils. However, this example shows that specific and high purity eannabinoids can be produced by photosynthetic microorganisms, e.g., cyanobacteria and jm6roa1gae> through heterologous expression of, e.g., the vpft*GPPS & the cannahinoid biosynthesis operon genes in a reaction of the native MEP and heterologous MVA pathway, driven by the process of cellular photosynthesis, Since the carbon atoms used to generate eannabinoids in: such a system originate front COy cyanobacteria) and nrieroalgal production represents a carbon-neutral source of biopharmaceutieal and medicinal compounds, Cannahinoids woul also be suitable a a feedstock an building block for the chemical synthesis of al ternative bi ophamiaeeuiieal and Medicinal compounds, for use in the respective industries.
Example 2. Cyanobacterial MS
Figure imgf000047_0001
fiilSl! Cyanobaeterial cells (Syneehocystis) were transformed with genes of the cannabidioiic acid (CBOA) biosynthetic pathway (FIGS, 8-13), Cells were grown in 150 ml, liquid media for 3 days. The starting culture OD730 was 0.2. One hundred twenty-five (125) mL were centrifuged at 5000 g for 20 min. The pellet was resuspended in 5 mL distilled water. Passage of the cells through French press at 1,500 psi resulted in disintegration of the cells. The crude cell extract was centrifuged at 14,000 g for 5 min to remove large debris and the supernatant was used for cannabinoid extraction, as follows. In a glass vial, 3 mL of the supernatant were mixed with 0.12 L of HjSCL and 0,5 mL of 30% (wry) NaCi. This mix was extracted with i mL of hexane, The organic layer was separated from the aqueous medium and dried by solvent evaporation. The dry extract was resuspended with 0.1 ml, of BSTFA including 1 % TMCS (deri vatization reagents) and injected in: GC-MS for content analysis, CG- MS standards were prepared by drying the original sohxmt and resuspending in BSTFA ·!· 1% TMCS prior to injection in the GC-MS. The results, presented in Table 2, showed evidence for the presence of CBOA (most abundant),€BD, Olivetolie acid and Olivetol in the transgenic cell extracts.
Tsfole 2,
Figure imgf000047_0002
Figure imgf000048_0001
{0132} it is understood that die examples and embodiments described herein are for Illustrative purposes only an that various modifications or -changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. AH publications, patents, and patent applications cited herein are hereby incorporated by refereoee in their entiret ibr all purposes,
Inforiiiisi Sequence Listing
SEQ ID s O: L DNA sequence of nptJ*GfiPS fusion construct for protein overexpressiou
• fr&c promoter (UP FEE CAS BOLD)
• nptl K amycin resistance i UPPER CASE GNDERUNEDi
• GPPS iUP ER CASE ITALICS}
• mbA2 termina tor i UPPER CASE BOLD U DERLI E "}
ATTCTGAAATGAGCTGTTGACAATTAATCATCCGGCTCGTATAAtgtgiggaAATT GTCAGCGGAI'AACAAITAGGAGGTTAAITAAGAATGAGIUACATCCAGAGAGAA A CTAGTTGiTCCCGACCTCGTTTG AA1 AGCA ATATGG A1X3CAG Ai CTGT ACGGAT
ATAAATGGGCGCGAGATAAGGTAGGCCAATCTGGGGCCAC ATTTATCGGTTATA
TOGGA ACCAGATGCTCCCGAACTGTTTCTGA 5GATGGGAAAOGGTG1CGGGCC
AA'rGATGTTAGGGATGAAATGGTGCG0rTGAACrG0rTGACAGAATrTATGCCCC
TCCCGACCATCAAACATTT^ATCAGGACTCCAGACGATGCAXGGCiATlAACTAC
GGCCATlUCiGGiMAAACTGCCT TCAGGTtu GGAAGAAJATCCGGATTCTGGT
GAG ATATCGTGGATGCGITAGCGGTn'TTCTAAGACGTCTACATAGCATrCCCG
TTl¾C^¾GTCGCTTLjGATiCGGACCGGGTGTTCeGCTTGGCGeAGGCTCAGTCC
CG^TGAA:TAACGG:TTTGGTj¾ATGCCTGGGAC:iTi¾ATGATGAACGGAACGGC
TGGCCCGTTGAACAGGTTTGGAAAGAGAIGCATAAGCTGGTGCCGITCTCCCCC AC A¾OTXGTiACiC ATGG AG Ί ΐ3Ί¾0Ϊΐ¾ ¾AI¾0A T¾0A¾A ¾E
AAGCTAAI GGCTGTAIGGATGTGGGACGGGTAGGGAI GCGGACCGGTATCAA
GACCGAGCAAITIAGTGGAACTGCC AGGTGAATTTTGGCCCAGCCTACAAAAAC
GGCTGTTTGAAAAATAGGGAATGGATAATCCGGACATGAACAAATTACAATTTCA
1XGGArGCTAGAfGAGrfGTlTCAiATGiO¾CGG GC¾2/iAGG0C7½G?GQJc?· AGCTG TCTA IGCG iCAAGrAAAJJACGTGGTGGAATlTGA TITTGACAAGTA TATGCA CTCCAAGGCCATTGCGGrrAATGA GGCCTTA GA TAAA GTTA TTCCCCCCCGCTATCCTC AAAAAATCTATGAAAGTATGCGCTATTCCCTCCTAGCGGGGGGGAAGAGGGTTCGAGC A nT1 iTGmiTGCGGCCmmAGCTAAmGGGGGGACTGAG(MACrTGCCATGCCT ACGGCnGTGCCAlGGAGA IGA WCACACIATGAGTnGAnGAAGAGGAmGCCCm TATTGATAACGA IGA JTTGCGTCGCG&TAAGCCTACCAA CCACAAAGmTTGGTGAAG A CACGGCGA EGA TTGCTGGCGAT CA EΎA TTGTCA TTGGCCTTTGAA CA TGTA GCCGTG JGCACCAGTCGTACCCTAGGMCTGAGATTATTTTACGGTTGCTATCCGAAATmGACG CGCCACA GGAA GIGA GGGCGTGAIGGGTGGTCAA GfGGTGGA TA TTGAAAGCGAA GG mA TCCCAGTAAAGACTTAGAAACGCTGGAArGGGJOCA lAT7GAJAAAACGGCTGlGr TGTTGGAA rGCAGTGTCGlG GlGGCGCAAllAjGGGGGGIGCCAGCGAGGACGACA TCGAGCGTGCTAGAGGGTACGCTCGCTGTGTAGGATI'GCTTTTCCAAGTTGTCGA TGA TA TTTTGG JW'AAGCCAGTCCTCGGAA GAAGTCGGAAA&AClGCTGGGAAAGA TTTGA TTTCTGACAAAGCCACCTATCCCAAAC ATGGGTTTGGAAAAAGCGAAGGAATTmCC GAWAATTACrGAAGCGmGAAAACAGGAACnAGrmr VA TCCJACX AAGCAGC AGClGTAinGCGTTAGCAGAC CAATGCAlClCGmAGAAllAAGGPTrCCFCCrm M^ ^A M ££EG£ rn£}£ !Ccr iGmGGm
GCXXTTTGCTTGACXGAGXAArCXTCTGAXXGCXGAXCTTGAXXGCCATCGA
CGCCGGGGAGXCCGGGGCAGTTACCAXXAGAGAGXCXAGAGAAXXAAXCCA CXTCGATAGAGGAAXXATGGGGGA GAACC
SEQ 11) NO:2. ptl*GPPS fusion protein construct
MSlilQRETSCSRPRLNSNMD ADL YGYK WARDN VGQSGATIYRL YG PDAPELFLKH GRGSYANDVTDEMVRLNWLTEFMPLPnKBFiRTPDDAWLLTTAfPGKXAFQVLEEY
:PDS¾ENiVDALAVFtRRUiSiPYCNCPRNSDRyFRLA AQSRMNNGLV ASPFl)i)EE
NGWPVEQYWKEMHKLLPFSPDSVVTHGDFSLDNLIEUEGKLlGCiDVGRVGiADRYQ
DLAlLW CEGEFSPSLQKRLFQRYGiDNRDMNRLQFHi lEDBFFHM'rRSSKALVQL
ADLSEQYK VVEFDFbKYMHSKAiAYNEALDKViPFRYPQiGYESMRYSLLAGGKR.
U¾ E€]AAE EEMO€PΈEEAU1RTAE'AIEM1HtU!dEIίII)OERUIONϋϋEKM0KRTNHKn
FGED SlAGDALLSLAFEHYAVSTSRT TDIiL liSEiGRATGSEGV GGQVVDiE
SEGDPSlDLETLEWVHlHKTAVELECSVVCGAiMGGASEDDiERARRYARC GLLFQ
YVDDILDYSOSSEELG rAGKDEiSDRAtYPKLMGEEKAKEFADELLNRGKQELSCF
DPTEAAFLFALADYiASRQN
SEQ ID N0:3. Codon-optimized DNA sequences in operon configuration of the caanabinoid biosynthesis pathway shown iu FIG. 5, leading to the synthesis of cannabidiolic acid. See, e.g., FIG, 15
UPPER CASE ITALICS, cpe_us pperon upstream sequence lor homologous recombination (Nucleotides 1 556)
UPPER CASE BOLD: Fire promoter (Nucleotides 557-615)
Lower case : RBS (Nueleoti des 616-635)
UPPER GASH, - AAEl: Acyi Activating Enzy e 1 (Nucleotides 636-2798)
Lower esse: RBS (Nucleotides 2799-2ST8)
UPPER CASE, 2 - 0LS; Oiivetol synthase (Nueieotldes 281 -3973)
Lower ease: RBS (Nucleotides 3974 3993)
UPPER CASE, 3 - OAC: Olivetolic acid cyclase (Nucleotides 3994-4299)
Lower case: RBS (Nucleotides 4300-4319) "UPPER CASE, 4 - CBGAS: Cannubigeroiic acid synthase (Nucleotides 4320-5507) Lower case: RBS (Nucleotides 5508-5527)
UPPER CASE, 5 - CRDAS: Cannahidioiic acid synthase (Nucleotides 5528-7162)
Lower case: RBS (Nucleotides 7163-7182)
UPPER CASE, chloramphenicol resistance cassete (both starting an stop codons were underlined) (Nucleotides 7183-7881)
Lower case underlined italics , the cpo is Operon downstream sequence for homologous recombination (Nucleotides 7882-8442)
CTGGAGAAGAGTCCCTGAA i'GAAAATGGWGGA mAAAAGCTGAAAAAGGAAAGIAG
GCTGIGGTTCGCTAGGCAA CA GfCTfCCCTA CCCCAGTTGGAAA CTAAAAAAA CGAGAAA
AGnGGGACCGAAGATCAATTGCATAATTnAGCCCTAAAAGATAAGCTGAACGAAACT
GGZTGlgTTCCCTTCCCAA TCCA GGACAATCTGAGAA TCCCCI'GCAACA TTACTTAACA
AAAAAGCAGGAAiAAAATfAACAAGAiGTAACA CA JAAGlVCCAiVACCGTmiAJAA
AGiTAACTGmGGAnGCAAAAGCATIGAAGCCTAGGCGCimGCJGlt GAGCAJOC
CGGlGGCCCnGTCGCTGCCTCCGTGTnGlGCCmGArnATnAGGmA lAJGJGlG
ATAAATCCCCGGGtA GTTAACGAAAGITAA TGGAGArCAGTAACAATAACTCTA GGGTC
AmiClTTGGACTCCClGAGmATCGGGGGGAAnGrGTnAAGAAAATCCCAAClGAT
AAAGTCAAGlAGGAGATlAAiTCAGAGCAGnGACAATTAAjC rCCGGCTCXri!MA
AXGXGTGGAAAXTGlGAGCGGATAACggaataggaggtaattaaAXGGGAAAAAACXAIA
AATCCGTGGAGAGIGTGGTCGCGTCTGATTTlATTGCATTGGGCATTAGCAG GA
AGTAGCAGAGACCCTGCATGGGCGAGTAGCTGAAAtCGTTTGTAATTAeGGAGC
AGGGAGTCCACAAACGTGGATCAACATeGCGAATCATATCTTAAGTCCAGATGTG
GCriTCIGClTGCACCAGAI'GTTGTTnmGGGATG'nmiAAGGATTITGGGGCCGC
GeCTGCTGCTTGGATCCCAGACCCTGAGAAGGTAAAAAGCACCAACTTGGGAGC
AXXACTGGAGAAGGGXGGCAAAGAGTXCTXAGGAGTAAAGXACAAAGACCCAAX
XTC LAGCTXTAGXCAGTXTCAAGAATXiAGXGTTCGGAAXCCXGAAGTGXATXGGC
GTACAGXAXXAAXGGAXGAAAXGAAGAXCAGXXXXXCXAAGGACCGAGAAXGXAT
CCTAaGTCGAGATGATATCAACAATGCAGGAGGTAG GAATGGGTACCTGGAGG
TXACXTGAAGAGTGCXAAGAACTGXX AAATGTCAACTCTAATAAAAAGXTGAAC
GACACTAXGAXCGTCXGGCGCGACGAAGGCAACGAXGAXXXACCAXXGAACAAA
CxeACGTtAGAJGAGTTAGGGAAACGTGTGTGGTTAGTTGGGTACGCATTAGAA
AGAXGGGXTrGGAGAAAGGTTGIGCGATTGCXAXXGACAIGCCAATGCACGXCG
CeCGGXeGXXAXCXAXXT GGXATGGXACXAGCCGGAXAXGTAQTXGTGXCTAXGG
CGCACTCXXXCAGXGCCCCCGAGATCAGXACTCGXCTGCGACXAXCCAAGGCGAA
GGCTAXCTTCACGCAGGATCACAXCA'ITCGGGGCAAAAAAGGAATTCCITTGTAC
XCTCGCGXGGXXGAGGCGAAAAGGeCXAXGGCTAXGGXGAXXCCGXGGAGCGGAA
GCAAXAXTGGTGCAGAACXACGAGAXGGAGACATCAGXXGGGACTAXXXCXXAGA
ACGAGCXAAAGAGTXCAAAAAI GTGAAXTGACAGCGCGAGAACAACCAGTGGA
CGCX'rATACAAAGAXCTXAXrrXCTAGXGGAACAACAGGAGAACCrAAAGCAArC
CCXXGGACXCAAGCGAGCCCXGXAAAAGCXGCCGCGGATGGAXGGAGGCATCX
GACATXCGTAAGGGTGATGXCAXrGTTTGGCCGAGGAATClGGGTTGGATGAIGG
G1'CCTTGGCXAG7T1'ACGCATCTCTCGXAAACGGGGCCAGTAJCGC1'CTCTACAAG
GGGXGXGCXexGGXXAGGGGAXXeGCAAAAXXCGTGCAGGACGCXAAAGXGACXA
TGG XAGGAGTGGTCGGXTCTATGGXGCGIAGCXGGAAGAGCAGAAACXGGGTCXC
XGGArAXGAXTGGX'CXAGeAXCCGGTGCX XAGTTCrXCCGG GAAGCCAGCAAX G TGAXGA GXACCXGXGGXXAAXGGGCCOGGC AAAXXAGA A ACC AGXXAXTGAGA TGTGTGGAGGAACAGAAAXTQGGGGAGCGrTCTCXGCGGGGAGXXXCTIGCAAG CCCAATCCCTCTCCAGTTTTAGCAGXCAATGXATGGGCTGCACTFXATACATTTTG GACAAGAACGGXXACCCAAXGCCGAAAAACAAACCGGGCATXGGXGAAXXAGCA CTAGGTCCAOTAATGTTCOGAGCtAGTAAOACAeTGTTAAATGGCAACCATeACG
ATGTCTATTTCAAGGGGATGCCCACATtAAATGGTGAGGTClTACGTCGTCACGG
GGACATTTTCGAGTIAACCTCTAATGGGTATTATCACGGTCACGGGCGAGCGGAT
GACACGATGAACATCGGAGGGATTAAAATCAGTTCCATCGAAATTGAGCGTGT
TGCAATGAGGTAGAeGATCGGGTATTCGAGACAACGGCCATCGGGGTGCCGCCG
CTCGGAGGGGGAGCeGAACAAIXGGTAAITTXXXXXGXeCIGAAGGAXXCCAACG
ATAGCACAATCGACTTGAATCAGTTGCGCCTCAGCTTCAACTTAGGGTTGCAGAA
GAAGCTAAACCCACtCTTCAAGGTTAeGCGGGTTGTAGCACTGTCTAGGCTGCCT
CfJGACTGCTACGAA AAAATCATGCGGCGAGTACTCCGCCAACAAlTCAGTCACT
TCGAAIAAggaaitaggiSggttaai aATGAATCACTTGCGAGCGGAAGGTCCCGCTAGTG
TACTCGCTAtTGGGACTGCCAACCCAGAAAATATTtTACTCCAGGATGAGTTeCC
GGATTATTACTTCGGAGXCACAAAGAGCGAAGACATGACGCAGXTAAAAGAGAA
GTtGCGCAAAATCTGTGACAAGTCTATGATTCGCAAACGCAATTGCrrrrTGAAT
GAAGAACATCTGAAGCAGAATCCACGTCTGGTTGAGCACGAGATGCAGACTTTA
GACGCTCGACAGGACATGCTAGTGGTGGAAGICCCGAAACTGGGIAAAGACGCG
TGTGGCAAGGCCAITAAGGAATGGGGTCAACCTAA AGTAAGATCACCCATCTG
AlTiTrACCAGTGCGTCGAGGACAGACATGGClOGAGCTCACmCCATTGrGCCA
AGCXCCTAGGACXAXCXCCAXGXGTGAAACGGGTAATGAXG'tAXCAGC'J'AGGATG
TlAtGGTGGGGGGAGtGTGTTAGGGATGGCAAAGGATATCGCG(}AGAATAACAA
GGGGGCTCGGG iGCIAGCCGTTTGCTGCGACAlTAl GGCGTGGCI CnTCGGGGA
C€GTCCGAGA.GGGACI'TGGAGClA rTAGrAGGGCAAGGGATCT'rTGGAGATGGG
GCCGCfGCTGTTATTGtTGGCGCTGAAeCGGATGAGAGTGTAGeTGAGCGCCCAA
TTTTCGAGTTGGTCTGCACGGGTCAGACAATTCTCCCCAACAGTGAAGGCACAAT
IGGGGGACAtArcCGGGAGGCAGGACTGATCTTTGACCmCAlAAGGACGIGCC
GATGCTCATtTGTAACAACATTGAAAAGTGCCTGATTGAAGCGTTCACCCCAATC
GGCAXTAGXGAlTGGAAXAGTAXeXXGTGGAXTACXCATCCCGGAGGXAAAGCCA
XICXAGAXAAGGXGGAAGAAAAGrTACACTXAAAGXCGGAGAAGXITGTCGATA
GTCGTCACGTGGXGAGCGAGCAXGGGAAXATGAGXAGCTCXACGGTTTTGXXCGT
T XGGAGGAATXACG A A AGCGCAGCTXGGAGG GGGAAAAAGCAGG ACAGGG G
ATGGATlTGAGXGGGGAGTXCXCTTTGGA nAGGTCCCGGGCTGACAGXAGAGCG
CGXGGXGGXGCGCXCCGXGCGGATTAAGXGAggaaitaggaggtiaaitaaATGGCCGTAAA
GCACCTGAXTGTATXGAAAXTCAAAGATGA3AXCACGGAGGCGCAGAAGGAGGA
GXrrTTCAAGACGTAGGTGAA€CTAGXGAATATCATGCGGGCGAXGAAGGATGTe
TAXXGGGGTAAAGAXGXAAGTCAGAAAAACAAGCJAAGAAGGTXACACCCATATX
GXXGAAGTGAGATTCGAAAGTGTAGAGAGGAXGCAAGAXTAXAXXAXTCATGCGG
CTCACGITGGATI GGAGACGTGTAICGTrCI TXTTGGGAGAAGTTGITAAirTIG
GACXACACGGCCCGCAAAXAGgga ttaggaggitaatlaaAXGGGCXTAAGCXCTGXAXGCA
CTTXCAGXXXeCAAACCAAXTAXGAXACGCTCCTA AGCCCCACAAXAACAACCC
AAAAACAXCCrXGXrGTGGXArCGAGACCeTAAAAeGGCAATCAAGTAXTCrrAX
AACAATXTXGCCXGCAAAGAGIGCTCCACTAAGAGCnGCAGCTAGAAAAGAAAX
GTAGCGAATCCXXGXCCAXGGCCAAGAACTCCATTCQAGCAGCAACCACCAATGA
GAGAGAGGCACCXGAGAGCGACAATCAXAGGGICGCGAGXAAGATCCXAAATIT
CGGGAAAGCATGCTGGAAACTACAACGACGATACACGAXCATCGCG ITGACCAG
TTGCGCXXGCGGTXTAXXTGGTAAGGAATXGCTCGAXAATAeCAACCTGATXXeCX
GGAGTCXGATGrTGAAAGGAXXTXTXTXGlTGGTCGCCArGerATGTAX GGCGTCT
TX CAACAAeCAXCAATGAGATGXATGAGCTCCACAXeGArCGCAXTAAGAAGC
CAGACCXGCCAXTAGCGTGXGGTGAAAXCTCXGTGAACAGCGCCXGGAXTAXGAG
GAnAl'XGIAGCAGTGTrtGGGCrAATCATXACAAXCAAGAXGAAGGGTGGACCC
C'rCTACAXTXTXGGCTAriGCI'TCGGAATCITI'GGTGGCArrGXITACAGCGI'ACC
ACCGXXXCGGXGGAAGCAGAAXCCCAGXACCGCTXXCCTAXTGAACXXXCTGGCC CACAXGAXCACCAACXXXAGGXXXXAGXACGCAAGXCGGGCGGCACTGGGCCXCC
CAJTCGAGCTGGGACCCAGTTTTACGTTTCTCTTAGCGTTCATGAAAAGCATGGG
AAGCGCTCTCGCCCTGArrAAGGAI GCCTCCGACGTGGAAGGCGACACAAAGTT
CGGTATTTCTACATTAGCAAGCAAGTATGGTTCeCGTAACCTAACACTCTTTTGTT
CTGGAATTGTGTIACTAAGTTATGTAGCAGCTATTCTGGCAGGTATCATTTGGCC
CCAGGCC I CAATAGGAAIGTIATGCTGITAIGTCATGCGATCCTCGCCTTCTGGT
TAATCCTACAGACACGGGACTTTGCCCTCACTAATTACGATCCCGAGGCGGGCCG
ACGTTTTtACGAGTTCATGTGGAAGCTATACtATGCAGAGTACCTCGTGTACGTG
TWATTXAAggaattaggaggitaattaaATGAAGTGI'TCTAG i TCTGTTTC i rriGTCTG
CAAGATCATTTTTTTCTTCTTCTCTTTGAATAXTCAGACAAGTATTGCGAATCCCC
GGGAGAACTTTTTAAAGTGTTTTAGCCAAXATATCCCTAAXAATGCTACCAATTT
AAAATTAGTATACAGCCAAAACAAGCCGCIAXACATGrCCGTTCTCAATAGCACA
ATtGAXAACTTGCGCTTGACAAGCGATAGAAGACCGAAGGGCCTAGTTATCGTAA
CCCGGAGCGAGGTTTCTCACArrCAGGGAAGGATTCTCTGCAGiAAAAAGGXGGG
TTXGCAGAXCCGGACXCGGXCXGGGGGXCAXGACAGXGAGGGXATGTCXXAGAXT
AGGCAGGTGCCClTTGTGATCGrCGACTTACGGAAGAXGCGGTCTArrAAGAXXG
ATGTCCATAGCGAAACCGCGTGGGTAGAGGeCGGAGGAACCCTGGGTGAAGTGT
ATIACTGGGTAAATGAGAAAAACGAGAACTTAAGTGTGGCAGCTGGATAGTGTC
CAAGCGTCtGCGCGGGGGGiGATTTCGGAGGGGGAGGC CGGCCCAGTCATGC
GXAAXTATGGG ITGGCGGCXGACAACAXT XXGAXGCXCACTXAGTXAAGGXGCA
CGGTAAAGTACXGGAXCGGAAAXCCAXGGGGGAAGAXCXAlTrXGGGCGXTACG
AGGAGGAGGAGCXGAGXeTTTGGGGATTAXGGTCGCGXGGAAAAXTCGGXXAGTe
GCGGXACCCAAGXCTACGAXGTTXTCGGXGAAAAAAAX AXGGAGAXGCACGAAC
TGGXGAAGCTAGrcAACAAGTGGCAGAArAXl'GCXTAXAAGTACGACAAGGAXC
XGtXAtXGAXGACGGATXTGAXCAGAeGAAAXATCACAGAeAAXCAACiGXAAAAA
CAAGACXGCrXATCGACAGCtAGrTXAGCTCGGXXXXGTXAGGGGGGGTGOAXTCCe
XGGTCGAXCXAAXGAAXAAAAGXXTCCGCGAACTAGGCAXTAAAAAGACAGAXX
GTCGTCAATXATCXTGGAXTGACACTAXTAXTXTCXATAGCGGCGTGGTAAACTAX
GACACGGAXAACXTTAATAAGGAGAXCXTGTXGGATCGeAGTGCGGGACAGAAC
GGCGCGTrFAAGATTAAGTFGGATTATGTAAAGAAGCCCATXCCAGAGXCXGXTX
TCGXACAGATCXTAGAAAAAXXAXATGAGGAGGATAXCGGGGCCGGXATGXATG
GCtXGXAXCCGTACGGTOGAAXGAXGGAGGAAAXCAGCGAGAGXGCCAXXeeGTX
CCCeCArCGAGCCGGAAXXXXGrAXGAAXrAXGGrACA rCXGCAGCTGGGA AAA
CAAGAAGATAA€GAGAAACACTXGAAGTGGATTCGTAAGATCXATAAXTXGAX
ACXCCGTAXGXCAGXAAAAACCCXGGGTXGGCXXACCTAAAXTACCGTGACCXCG
A"IAXTGGAATTAAGGACGC1AAGAA1'CGAAACAAXXACACXCAAGGCCGGA1 ITG
GGGGGAGAAATAXXXXGGCAAGAACXXCGAtCGAXtGGXAAAGGtGAAGACXCT
CGXAGAXCCXAAXAAGXXXXXXCGXAACGAACAAXCXATCGCCCCXCXGCCXCGXC
AXCGGGAX XAGggaattaggaggtaaitaaAXGGAGAAAAAAAXCACXGGAXA'rACCACCG
TTGAXATATCCCAAXGGGATCGXAAAGAACAXXXXGAGGCAXXTCAGlCAGTXGe
TGAATGXACGTAXAACGAGACCGTXCAGCTGGATATTACGGCCTTTTXAAAGACC
GTAAAGAAAAATAAGCACAAGXTXTAXCCGGCCTTXAXXCACAIXCTXGCCCGCC
TGAXGAATGCIGAXCCGCSAA'iTCCGTATGGCAATGAAAGACGGTGAGeTGGTGA
XATGOGAXAGTGXXCACCCXXGXXACACCGTXXXCGATGAGGAAACTGAAACGTX
TTCAXCGCXGTGGAGTGAA iACCACGAeGAXTTCeGGCAGTXTCXACACArAXAT
TCGCAAGAXGTGGCGXGXXACGGXGAAAAGCXGGCCXAXTXCCCXAAAGGGTXTA
TTGAGAATATGTTXTXCGXCXCAGCGAATCCCTGGGXGAGTTXCAeCAGTTXTGAX
TXAAAeGTGGCCAATATGGACAAGXTeXXCGCCCeCGTXTTCACCAXGGGCAAAT
ATI'AXACGCAAGGCGACAAGGTGCTGATGCCGCTGGCGAITCAGGXTCATCATGC
CGTCXGTGATGGCTXCCAXGTCGGCAGAAXGCXXAAXGAAXTACAACACJXACTGC GATGAGTGGCAGGOGGOGGCGTGATXTXTXTAAGGCAOTXATTGGXOCCCXTAAA
C(XX l'(MKi tcc!&tattits2tt atfaetaffimkctmst&cmtiiiaecttactiii£tcaaaaMeattaectaac0ataa matsmMatetctttitttgmtgmctcem ctamatasecaicBmicazte ttiagttcattattagfga mtttgtt scs aaaicct^aggm c Kmcttaacctmce tmtx tteziaataattltctamatsicc catgKigeiicecgatc x' oe&^sacK£ { t&t^ieaacamti3S&si«ecttititect, ttitccite ecemt&it £'G^i iS3^c(t ea
SEQ ID NO;4 AAEI : Acyl-actlvating enfcyaie-i
MGENYKSLDSYyASDFiALGiTSEVAETLHGRLABiVCNYGAATPQTWINiANHILSP
DLPFSLHQMLFYGCYKDFGPAPPA IPDPEKVKSTMLGALLIKRGKEFLGVKYKDPI
SSFSHFOEFSVRNPEVYWRTVEMDEMRISFSKDPEGILRRDDIN PGGSEWLPGGYLM
SAK CI.NVNSNKE.LND7MiVWR»EGND»LPI.NKLTLDQLRKRVWl VGYAI,EEMG iP GCAiAiDMPMHVDAVViYIAlVLAGYVVVSiADSPSAPE!SrR RlGKAKAlFrQD
HORCiKKRJPLYSRVVEA SFMAIViPCSGSNlCSAlUEDGDiSWDYFLERAKEFKNCEF
TAREQPVPAYTNIEFSSGITGEPRAfPWTQA'G^LKAAADGSYSHLDiRKGDYIYWPTN
LGWMMGPWLV^YAStLNGASlAEYFJGSPLVSGFARFVQDAKVtMLGN^VTSiVRSW^K lXMCVSGYDWS IXRCFSSSGEASM VPEYLWEMGRANYKPViEMCGCTEiGGAFSAGS
FLQAQSl SFSSQCMGCTLYiLDKNGYPMPK^RPGIGEFAl^GPVMFGASKJELNG H
HDVYFKGMPTENGEVERRHGDIFELTSNGYYHAHGRAPDTMNIGGIKISSIEIERVGN
EVDpRVFETTAIGVPPLGGGPEQLYlFFVLKDSND FTiDLNQLRLSFNLGLQKKL PLF
RVTRVVFLSSLPRTAFNiGMRRVOiQQFSHFE
SEP ID NO: 5 OL8; Qlivefol synthase
MNIiERAEGPASVLAlGXAKEEKlLLQDEFPDYYFRVtKSEHMTQE fiRFRKlCDKSKE
IRKRNCFLNEEHLKONPRLYEHEMQTLDARQDMLVVEVPKLGKDAGAKAtKEWGQ
PKSK.OHLfErSASl'TDMPGADYHCAKLLGLSPSVRRVMMYpLGCyGGG'rVLRlAKD
IAEN KGARVLAYCCD1MAGLFRGPSESDLELLVGQA1FGDGAAAVIYGAEFDESVG
ERPlFELVSXGOXiEPMSEGXiGG REAGLJFDLHKDYPMElSNNlERGLlEAFrPiGiSD
WNSifWITHRGGl AiLDKVEEKXillRSDKFVDSRHVI-SEHG MSSSTVIEYMDELRK
RSLEEGKSTTGDGFEWGVLFGFGPGLTVERYVYRSVPIR
SEP ID NO: 6: PAG: Olivetollc acid cyclase (OAC)
MAVKHLlVLKEKDEiTEAQKEEFFKTYYMLVNliPAMKDVYWGKDYTQKKKEEGYX
HlVEVTFESVEIIQDYffi-IRAHVGFGDVYRSFWEK-LliEPYTPRK
SEP ID O: 7: CBGAS; Caanabigerolie acid svathase
MGLSSVClFSFQTNYHI'LLNPilN PiCrSLLCY HPKXPiKYSY NEPSKHCSTKSFH LONKCSESESiAKNS AAXTMQTEPPESDNHSVAXKILNFGKACWKLORFYTiiAFTS CAGGLFGKEllXiNTNliSWSLMFKAFFFlAAR iASFrmNQiYDlJJfDRiNKFDEPL ASGE1SVNT AWiMSM VAlPGLi GPKMKEKCRE Y iFGYGFGlFGGiY Y SVFPFR WKQNPS
TAFLLNFLAHIITNFTFYYASRAALGLPFELRPSFTFLLAFAIKSMGSALALIKDASDYE GDXKFGISTL ASKY GSRN i FLFCSOVLLSY V AAIlAGil WPQAFNS VMELSHAILAF WEiLQTRDFAL rNYDPEAGRRFYEFMWKLYYAEYLVYVFl SEQ IP p:S; CBDAS: Caftnabidiolie acid synthase
MKCSXFSFWFVCKilFFFFSFNiPXS!AiMFRE FlACFSQYlPN AXNLKIAYXQMNPLY
MSVFNSXIHNLRFXSDXXPKPLVIVTPSHVSHlQGXiLCSKKVGLQISTRSGGHDSEGM
SYlSQVFFViVDLRNMRSlKlDVIlSQTAWVEAGAXLGEVYYWVNEKNENLSLAAGY
CPTVCAGGHFGGGGYGPLMRNYGi-AADNHDAHLVNVHGKVLDRKSMGEDLFWAL
RGGGAESFGnVAWKiRLVAVPKSTMFSVKKlMEIHELVKLVNK ONlAYKYDKDLL
LMTHFITRNlTDNOGKNKTAmTYFSSVFLGGVDSEVDLMNKSFPELGlKKtDCRQLS
WiDmFYSGVVNYDXDNKNREiLLDRSAGQMGAFKIKI-DYVEKfXPESVFYQJXEKLY
EEDlGAGMYALYPYGGiMDEISESAJPFPHRAGlLYELWYiCSWEKQED EKHLNWlR
NiYNFMTPYVSKNPRLAYENYRDLDiGiNDPKNPN YTQARlWGERYFGKNFDRLY
RV KTL VDPN FFRN EQS IPPI.PRHRH
SEP ID MQ: : APdetrahYdrocamiahmoHc acid synthase (1 ICAS) gene
ATGAACTGliAGCGCA!TrAGX i C OGTTCGTGTGTAAOAl CA'nTn'TTCTTTTT
ATCTTTXCACArTCAGAXTXCIATCGCTAAXCCGCGCGAAAA"ITTCCTCAAA"!GCX
TTAGTAAGCACATCGCAAACAAGGiTGCGAATCCGAAAGTGGTGTACACGGAGC
ACGATCAGarCTACATGTCTATGGTGAATAGCAGAATGGAGAAGtTAGGGTTCAT
CI'CTG A i AC AAGGGGA A AGCCTrr AG1/G I GTTACACCGAGCA ACA AT I'CTG A J
A rGCAAGCCACAAXT1TG'roCAGTAAAAAGGTTGG0ITGGAAATCCGAACGCG€
AGCGGGGGACACGACGCAGAGGGTATGAGTTACATTTGTeAGGTCCCCTTeGTTG
TTGTGGATCTACGGAATATGGAGTCCATCAAGATTGACGTACACAGTCAGACCGG
ITGGGTGGAAGCCGGAGCAACC lTAGGGGAGGTG IACTAl'TGGATIAArGAGAA
AAAGGAGAACCTCTeTTTCCCTGGTGGAXAJTGTCCTACTGTAGGTGTCGGAGGG
CATTTCAGTGGCGGAGGCTATGGGGCTCTCATGCGCAATTATGGCTTGGGCGCGG
ACAATATCAXTGAGGCXCATCXeGTGAACGXCGACGGTAAGGTACXCGAXCGXAA
AAGCATGGOTGAGGATCTCTTCTGGGCTATTCGAGGTGGTGGAGGAGAGAACTT
CGGAATTATCGCAGCCTGGAAAATrAAGTIAGTrGCGGTCCCCAGTAAAAGCAC
AAXCTXTAGCGTCAAAAAGAACAIGGAAATXCATGGACXCGXAAAGCTCXTXAAT
AAATGGCAGAACATTGCAXACAAATATGACAAAGACCTAGTGTIGATGACCCAT
TTTATT GTA AAAtAJTACGGAtAACCACGGGAAGAACAAGACAACAGtACAT
GGTTACTTTAGCAGCATCiTCCACGGTGGGGrGGATTCTCTAGTAGACCTGAXGA TAAGTCGTTTGCGGAACTAGGCATCAAGAAAACTGACTGCAAAGAATTTTCCTG
GATCGACACGACXATCTICTAXAGXGGAGXAGTAAACTTTAATACAGCAAACXTC
AAAAAAGAAATCCTGCTAGATCGATCCGCGGGGAAGAAGACTGCATFTAGCAIT
AAGCTGGACTATGTAAAGAAACeCATTGGGGAGAeAGCCATGGTTAAAAtTTTG
GAiiAAATTGTAeCiAAGAGGACGTCGGAGCCGGCAtGTACGTCCTCTATCCTTATG
GCGGGATiAXGGAGGAAATGAGl GAGlGCGCrATGCCTiTCCeCCACCGTGCGGG
TATCAXGTACGAGTTATGGIACACCGGGXCCTGGGAAAAGGAGGAGGACAACGA
GAAACACAXCAACTGGGTCCGTTCCGTGXACAAXTTXACGACCCCTTATGTXTCXC
AAAA1CCGCGACTCGCCXAXTTAAACTAICGTGACCTGGACGTGGGGAAAACAA
ACCACGCGAGIGCCAAXAACTACACGCAAGCAGGAATC!GGGGTGAAAAGXACX
TTGGXAAGAATTXCAAXCGACXGGXXAAAGTTAAGACAAAAGTCGAXCCXAACAA
XTXCTXCCGAAATGAGCAATCXATOCGCCCXTGCGTeCXCAXCACCAC
SEP IP O ldi A9-tetralivdrQeaTmabirtolic acid synthase {XHCAS} protein
MNCSAFSFWFVCKIIFFFLSFHiQiSiANPRE FLKCFS HiPNNVANP LVYXQHDQL
YMSiLNSTlQNLRFlSDlTP PLVlVTPSNNSHlQATiLCSKKVGLQlRTRSGGHDAEGM SyiSOVFFYVVDLRNMHSlKTDVHSQTAWVEAGATLGEyYYWl EKNENESFFGGYe
PXVOVGGMFSGGGYGALMRNYGLAADNilDAHLVNVDGKVEDRKSMGEDLFWAlR
GGGGENFGlL¾AWKiKLYAVpSKS ILFSVKKNMF4FiGLVKIXNKWQNIAYKYDKDLV
LMTHFIXKNXrDNHGK KXTVHGYFSSIFHGGVDSLVDLMNKSFPELGiKKTDCKEFS
WIDTGFYSGYVNFNXANFKKEiLEDSSAGKKXAFSIKLDYVKKPlPEXAMVKILEKL·
YEEDVGAGMYVEYPYGOiiMiBEJSBSAIP iRAGiMYBiLWYTASWfiiC-QED BKIilM VRS V YNFTTPY VSQNPRLAYLlSi YRDLDLGKTNHASPN YT0ARI GEKYFGKNF NRLVKVKXKVDPNNFFSEiEQSlPPLFPHHM
SEQ IP NO:! 1: Gannabichro enic acid synthase (CSC1 AS) gene
AXGAATXGrAGCACGriCAGCTTGXGGTTCGTATGXAAAAXTATCTXTXTXITCCT
CAGTTTTAATATeCAAATCTCTATTGCTAAGCCCCAGGAGAATTTCCTCAAGTGTT
TCAGCGAGTAGATTCCTAAGAACCeTGCTCCAAAATTTATCTACAGGCAACACGA
TCAAITGrATAl GTGrrrTmAATTCCACCATCGAAAAOTGCGTTTT'ACCTCTG
ACACTACACeAAAGCeTGTCCfreATlGTGACGCCGAGlAAXGTTACfreATATTC'A
GGCGAGmiTCTCrGCTCI AAAGrTGGACrCCAAATGCGGACGCGrAGCGGCGGT
CACGAXGCGGAAGGGrXATCC"iACATTAGCCAGGTGCCXTTCGGXA"JTGXTGACT
TGCGTAATATGCATACAGTAGTAGACAXTCAJTCCCAGACGGCCGTGGAGGCAG
GCGCGACGTl GGGGGAAGrrmCTACTGGATTAATGAAATGAATGAAAAXTTCA
GrrrCCaiGGAGGITAGrGXGCAAGTGrrGGAGlTGGAGGTGATXTTTCCGGAGG
AGGAXACGGAGCGTTAATGCGGAATTACGGATXAGCAGCAGATAATATGATGGA
CGCXCATCXAGXAAATGXAGACGGAAAAGIAXTGGACCGAAAGAGXATGGGXGA
GGAGTTGTTCXGGGCrATXCGAGGGGGCGGGGGCGAAAACTXC'GGXATCAXCGC
AGCCXGTATCAAGCXCTGGGXACCCAGTAAGGCCACXATTTTCTCXGTCAAAAAG
AAeAXGGAGATTGACGGTCXCGtGAAGTTATTtAACAAATGGCAAAATATTGCCT
AC GGAX AAAGACiTGATCrrTGACGACGCArXl CCGCACAGGCA C lTACGGA
GAACCATGGGAAXAAAACAACTGTACACGGCXATTTTTCXAGTATCTTCGTCGGG
GGCGTAGACXCCCTCGTCGATrTGATGAAXAAAAGXTTCCCAGAACXGGGXAXCA
AAACTGACXGrAAAGAACIGTCGTGGATXGAIACCACGAriTrCTArrCCGGCTG
GtATAATACAGCCTTTAAGAAAGAAATTTXAGTGGAXCGCXCtGCGGGTAAAAAG
ACGGCTTXCAGCATCAAAGXeGACTACGXTAAAAAGGtCAXTCCGGAAACCGCXA
TGGXTAAAATCCtGAGi ArACGAAGAAGAGG'i GGGGmGGGArcr AXGTACX
GTACaCATAGGGTGGXATTAXGGATGAAATCXCCGAAXCCGCAATXCCAXTXGCC
CATCGCGCGGCJTATCATGTATGAACTGTAXACGGCGACTGAGAAACAGGAAGAC
AACGAAAAGCACAXCAACrGGGraCGGTCCGiGTATAACTTXACCACCeeXTAXG
TAAGTeAOAACCGGCGGGXGGCATATCTAAATTATeGGGACCTGGAXCTAGGCA
AAAGGAACCCGGAGTCXGCGAATAACXATACTCAGGCGGGGAXCTGGGGGGAGA
AAXACXTXGGGAAAAACTXTAACCGACTCGTAAAGGXAAAAACCAAGQCCGAGC
CGAACAAGITCTXCCGGAACGAACAAJCMTCCCCCACXGCGCCCACGCCAXCA
c
SEQ ID NO; 12; Cannabichrorneme aeid synthase (CBCAS) protein
MiiCS3 FSXWF¥CK!iFFFl,SFXliQi;SiA QjBNFi.,KCFSEY! NPAXKFiY I¾HPQlAMS
VlJ S'nQNI,RFTSDlTPKPI.ViVrPSNVSHlQASiLCSK¥GLQiRTRSGGBDAEGLSY!S
QVPFAlVDLR^MHTVVPil-lSOTAYeA AtLGfiyYYWiNEMNENFSP GGYCPtVGV
GGHFSGGGYGALMRNYGLAADNiiDAFILVNVPGKA'LDRKSMGEDLFWAlRGGGGE
NFGILAAQKLWVPSKAXIFSVKK NMEIHGLVKLFNKWQN lAYYDKDLMLTTHFRXR
NiTDNHGNKTTVilGYFSSlFLCXiVDSLVDLMNKSFPELGIKXDCKELSWlDTTlFYSG YNTAFKKEILLDRSAGKi TAliSlKL YVKKIiPETAMVi iLELYEEEVCrVGMYVLY
PYGGlMDElSESAiPPPHRAGiMYELYTATERQEDMEKMiNWVRSYYNEXTfYVSQNP
RLAYLNYRDIDLGKrNPESPNNY rQARfWGEKYFGKNFNRLVKVKXKADPNNFFRN
EQS1PPLPPRHH
SEQ W N0:13
IJFPER CASE ITALICS, epc_us operdn upstream sequence for homologous recombination: (Nucleotides 1 -556)
UPPER CASE BOLD; Eire promoter (Nucleotides 557-615)
power ease: RES {Nucleotides 616-635)
UPPER CASE, 1- AAEt : Acyl Activating Enzyme I (Nucleotides 636-2798)
Lower case: RBS (Nucleoli des 2799-2818)
UPPER CASE, 2 - OLS: Olivetol synthase (Nucleotides 28! 9-3972)
Lower case: RBS (Nucleotides 3974-3993)
UPPER CASE 3 - OAC: Olivetotic acid cyclase (Nucleotides 3994-4299)
Lower case: RBS (Nucleotides 4300-4319)
UPPER CASE, 4 - CBG AS: Cannabigerolic acid synthase (Nudeotides 4320-5507)
Lower case: RBS (Nucleotides 5508-5527)
UPPER CASE. 5 - T.RC.4S: A9yetrahydrocannab;inolic acid synthase (Nucleotides 5528- 7165)
Lower ease: RBS (Nucleotides 7166-7185)
UPPER CASE, chloramphenicol resistance cassette (both starting and stop codons were underlined (Nucleotides 7186-7884)
Lower case uftd rimed italics , the epc_ds: operou downstream sequence for homologous recombination (Nucleotides 7885-8445)
CTCmGMGAClVCCTGAA TCAAAATGCmGGAMAAAACCTCAAAAAGGMAGTAG
GCTG TGG TTCCCTA GGCA A CA GTCTTCCC ΊΆ CCCCA CTGGAAA C TAAAA AA A CGA GAA A
AGTTCGCA CCGAACA TCAJTTGGATAJTTTTAGCCCIAAAA CA TAAGCTGAA CGAAA CT
GGlTG CTiCCCTTCCCAAiVCAGGACAAlCTGAGAAmGGCTGCAACAnACnAACA
AAAAA GCAGGAA TAAAA TfAACAA GA TGTAAGAGACA TAA GTCCCA IGACCGnGTATAA
AGT AC mGGA ITGCAAAAGCA riXMAGCClAGGCGCmAGCTGITTGAGCAlGC
CGGTGGCCCTTGTCGCTGCCTGCGTG TITCIGCCIGGA TTTATTTAGGTAA TA TCTCTC
ATAAAJGCCCGGG GmiA£GAAAGTTAA 7X?GAGATCAG:TAACAA:TAAClVlAGGGlV
AHA CTTTGGA CTCCCTCA GT2TA TCCGGGGGA ATTGTGTT AA GAAAA TCCCAA CTCA T
AAAGTCAA GTd GGAGATTAA TZtdGAGCTGTTGACAATT AATC ATCCGGCTCGTA
TAATGTGTGGAAATTGTGAGCGGATAAGggaattaggaggttaattaaATGGeAAAAAAC lAI AATeCCTGGACAGTGlCGTCeCGTCTGATTTTAriGCATTGGGCATmCCA
GTGAA0rAGCAGAGA€CCTGGATGGGCGACi¾GCTGAAATC0rX1'GTAATIACG
GAGCAGCGACTCCACAAACeTGGATCAACATGGGGAATCATATCTTAAGTCCAG
ATCTGCCXXTGXCCTTGCAGCAGATGTTGTTXTACGGArGTTAXAAGGATIXXGGG
CCeGCGCCI'eCTGCTTGGAlGCCAGACCCTGAGAAGGTAAAAAGCACCAACrrG
GGAGCAJTACTGGAGAAGCGTOGCAAAGAGTTC TAGGAGTAAAGtAeAAAGAC
CCAATlTGTAGCTiXAGTCACTrXCAAGAAXTTAGTGlTCGGAATCCTGAAGTGTA
TTGGCGXACAGlAXlAATGGAXGAAAXGAAGATCAGT lTlTGrAAGGACCGAGAA
TGlATCCXACGTCGAGATGATATCAACAATCCAGGAGGTAGXGAATGGCTACeTG
GAGGTl'ACTTGAACAGrGCXAAGAACTGrXTAAArGTCAACTCXAATAAAAAGTT
GAACGACACTAXOATCGXCTGGCGCGACGAAGGCAACGATGATTTACCAXTGAA
CAAACTCACGTTAGATCAG rACGGAAACGTGTGTGG iAGTTGGGTACGCATTA GAAGAGATGGGTXTGGAGAAAGGXXGTGCCATTGCXATTGACATGCCAATGGAC GTCGACGCGGXCGTTATCTATXTGGCXATCGTACTAGCCGGATAXGTAGTTGTGXC
i:Al CGCGGACTCTTTCAGTG€CCCCGAGATCAGl ACTCGl CTGCGACTATCCAAG
GCGAAGGCTATCTTCACGCAGGATCACATCATTCGGGGCAAAAAACGAATTCCTT
TGTACTCTCGCGTGGTTGAGGCGAAAAGCCCTATGGCTATCGTGATTCCGTGCAG
CGGAAGCAATATXGGTGCAGAACXAeGAGATGGAGAeATCAGTTGGGACXATTT
CTTAGAACGAGGTAAAGAGTTCAAAAATTGTGAATTCACAGCGCGAGAACAACC
AGTGGACGGTTA ACAAACATCTTATTTTCTAGTGGAACAACAGGAGAACCTAAA
GCAArCeCITGGACrCAAGCGACCCCTCTAAAAGCTGGCGCGGA lOGATGGAGG
CATCTAGACATTCGTAAGGGTGATGTCAtTGTTTGGCeGACGAATCTGGGTTGGA
TGATGGGTCCTTGGCTAGTTTAGGCATCTCTeCTAAACGGCGCCAGTATCGCTCTe
TACAAGGGGTCTeGTCTGGTTAGCGGA:TTCG€AAAA'!TCGrGCAGGACGCTAAAG
TGAGTATGGTAGGAGTGGTCCGTTGTATCGTGCGTAGCTGGAAGAGGAGAAACT
CGTCTGTGGATATGATTGGTGTACeATCCGGTGCTtTAGTTetTCCGGACJAAGCC
AGCAATGl GATGAe CCTGlGGTTAATGGGeCGGGCAAArrACAAACCAGTT
AXTGAGAXGTGXGGAGGAAGAGAAAXTGGGGGAGCGTTCTCXGCGGGGAGXTXC
I'TGCAAGCCCAAIGCClGTCCAGTTTTAGCAGTCAATGTAJGGGCTGGACTTTATA
CATTTTGGAGAAGAACGGTTACCCAATGCCGAAAAACAAACCGGGGAXIGGXGA
ArrAGCAGtAGGTGCAGTAATGTTCGGAGCTAGTAAGAGAGTGtTAAATGGCAAC
CATGACGATGTCTATTTCAAGGGGATGCCCAGATI/AAATOGTGAGGICTTACG'IX;
GrCAGGGGGACAXTTTCGA^rTAACGiGlAArGGGT'A'rrATGAGGCIGAGGGGCG
AGCGGATGACAGGATGAAGATeGGAGGGATTAAAATCAGTTCCATCGAAATTGA
GCGTGTGTGGAAXGAGGTAGACGATeGGGTATTCGAGACAACGGCCATCGGGGT
GGCGCCGGTCGGAGGGGGACCCGAAGAATI'GGTAATrTTn'TTGTCCTGAAGGAl'
TCCAACGATACCAGAATGGAGTTGAATeAGTTGCGCCTCAGCTTCAAGTTAGGCT
TGCAGAAGAAGGtAAACCCACTCTTCAAGGfTACGGGGGTTGTAGGACTGTCTAG
GCTeCCTCGGACTGCTACGAATAAAATCATOCGCCGAGTACTCCGCCAACAATTe
AGTCAGTTGGAATAAgtiaattaggaggtraatlaaATGAAXCAGTTGCGAGCGGAAGGTCCC
GCTAGTGTACTCGCTATTGGGACTGCGAACCCAGAAAATATTrTACTCCAGGATG
AGTTCCCGGATrAXrAGTrCCGAGTCACAAAGAGGGAACACA' GACGCAGTiAA
AAGAGAAGTTCCGCAAAAtGTGTGACAAGtCTATGATTCGCAAACGCAATTGCTT
TTTGAATGAAGAACAXCTGAAGGAGAATCCACGTGTGGTTGAGCAGGAGATGCA
GAGTTTAGACGCTCGACAGGACATGCTAGTeGTGGAAGreCGGAAACXGGGTAA
AGACGGGTGTGGCAAGGCCATIAAGGAAXGGGGTCAACCTAAGAGTAAGATCAC
CGAXCTCATXTXTAGGAGXGCGTCCACGAGAGACATGGCTGGAGCTGAGTACCAT
TGTGCCAAGCnGeTAGGACTATCIGCATCTGTGAAACGGGTAATGAIGXATCAGC
TAGGAXGTXATGGTGGGGGGACTGTGXTACGTATCGCAAAGGATATCGCGGAGA
ATAAGAAGGGGGCTGGCGTCCXAGCCGXXXGCXGCGAGATTAXGGCGXGCCXCIT
TeGGGGACCCTCCGAGAGCGAerrGGAGCXATl AGTAGGCCAAGCGATCTXrGG
AG Al'GGGGCeGCTGCXGXTAX'XGTXGGeGG i'GAACCCGAXG AGAGTGXAGGXG A
GCGCCCAATTTXCGAGTTGGXGXGCACGGGTCA ACAATXCTCGeCAACAGTGAA
GGCACAATXGGGGGACAXAXeCGGGAGGCAGGACTGAlGTXTGACGTACAlAAG
GACGTCGGGATGCTGATTTCTAACAACATrGAAAAGTGCGXGATTGAAGCGTTCA
GCCCAATCGGCATTAGXGAXTGGAATAGXAXCXTCTGGAXTACTCATCCeGGAGG
TAAAGCCAXrCXAGAlAAGGTGGAAGAAAAGlTACACiXAAAGXCCGACAAG IT
TGrCGAXAGTeGTGACGrGGXGAGCGAGCATGGGAAXA GAGIAGClCmCCK rr
XTGTTCGXTATGGACGAATXAeGAAAGCGCAGCXTGGAGGAGGGAAAAAGCAC
ACAGGGGATGGATTTGAGXGGGGAGTTCTCTXTGGAXXTGGXCCCGGGCXGACAG
XAGAGOGCGTGGl'GGTGCGCTCCGTGCCGAl AAGTGAggaattaggaggttaataaATGG
CCGTAAAGCACCTGATTGTAXTGAAATTCAAAGAXGAGATCAC'GGAGGCGCAGA AGGAGGAGXTXTXCAAGACGXAeGTGAACCTAGTGAATATCATCeCGGCGAXGA
AGGATGtCTATTGGGGTAAAGATGTAACTGAGAAAAACAAGGAAGAAGGTTACA
CCCATATrGTIGAAGTeACATTCGAAAG!GTAGAGACGA!CCAAGATrATATTAT
TeATCCGGCTCACGTTGGATTTGGAGACGTGTATCGTTCTTTTTGGGAGAAGTTGT
TAATCTTCGAClACACCCCCCGCAAATAGggaatteggaggitaatteaATGGGCTTAAGCTG
TGlATGCACTrTCAGTTTCGAAACCAArrATCATACGCrCGTAAACCGCCACAAT
AACAACCCAAAAACATeCTTGTTGTGGTATCGAGACCCTAAAACGCCAATCAAGT
ATTCTTATAACAATTTTCGCTCCAAACACTGCTCCAGTAAGAGCTtCCACCTACAA
AACAAATGTAGeGAA/rCCiXGTCCATCGCCAAGAACl'CGASTeGAGCAGCAACG
ACCAATGAGACAGAGCXACGTGAGAGCGACAATCATAGGGTGGCGACTAAGATC
CTAAATTTCGGGAAAGCATGCTGGAAAGTACAACGACCATAGAC ATCATCGCG
TTCACCAGTTGCGCTXGCGGrTTATTTGGTAAGGAATTGCXCGAXAATAOCAACCT
GATTTeCTGGAGTCTGATGTTCAAAGCATTTTTTTTCTTGGTGGCGATCeTATGTA
TCGCGTCTTnACAACAACCATCAATCAGATCTATGACCTCCACATCGATCGCAT
"!AAGAAGCGA ACCrCCCATTAGCGTGTGGTGAAATCTCTGTCAAGACCGCCTGG
ATTATGAGCAXTAITG IAGCACTGTTTGGGCTAAX'CATTACAATCAAGAXGAAG
GTGGACCCCTCTACATTXTTGGCTATrGGXTCQGAATCTTXGGTGGCATTGTTTAG
AGCGTACCAeCGITrCGGTGGAAGCAGAA1'CCCAG1'ACGGCrnXeTA i:TGAACT
TTCTCGGGCACATCATCACCAACTTTACGXTTTACtACGCAAGTGGGGCGGCACT
GGGCCTCCCAr CGAGCTGCGACGCAGrnTAGGiT CTGTTAGCGTrCATGAAA
AGGAX GGGAAGGGC iCTCGCCCTGAl TAAGGATGCG rCCGAGGTGGAAGGCGAC
ACAAAGTTCGGTATTTCTACATTAGGAAGGAAGTATGGtTGCCGTAAeCTAACAC
TCTTTTGTTCTGGAATTeTGXTACTAAGTTATGTAGCAGCTATTCTGGCAGGTATC
AlTrGGCCGGAGGGCTTCAATAGCAAlGn'ATGGTGTTAIGTCATGGGATGCTCGG
CTTCtGGTTAATOCTAGAGACACGGGACTXTGCCGTCACTAATTACGATGCCGAG
GCGGGeCGACGTTTTTAGGAGTTCATGTGC AAGCTAIACTATQCAGAGTACCrrCG
XGIACGXGXTXATrTAAggaattaggaggttaattaaATGAAGTGTAGCGCATTlAGTTTCXG
GTTCGTGTGTAAGATCATTTTTXTCTTTTTATGTTTTCACAXTCAGATTTCTAXCGG
TAATCCGCGGGAAAATTTCCTCAAATGCTTTAGTAAGCACATCCCAAACAACGTT
GCGAATCCCAAACIGGTCIACACGCAGCAGGATGAGCI'CTAGAIGTGIATCCTGA
AtAGCAGAATCCAGAACTTACGGTTGATCTGTGATACAACGCGAAAGCGTTTAGt
GATTGTTAeAGGGAGCAAGAAtTGTCATATCCAAGCCACAATTTTGTGGAGTAAA
AAGGTTGGGTTGCAAATCCGAACGeGGAGCGGGGGAGACGACGCAGAGGGTATG
AGTTACATTTCTCAGGTCGCCTTCGTTGTTGTGGATGTACGGAAXATGCACTGGAT
CAAGATTGACGTACACAGTCAGAGGGCTTGGGTCGAAGCCGGAGCAAGCTTAGG
CGAGGTCTAC'IATrGGATrAATGAGAAAAAGGAGAACC'l'CTCTXTCGCTGGTGGA
XAtTGTC€TA€TGtAGGXGTCGGAGGG€ATTTCAGTGGC(iGAGGGTATGGGGCtC
TGATGCGCAAiTATGGCTTGGCeGCGGACAATATCAtTGAGGCtGATCTCGXGAA
CGXGGAGGGTAAGGrAGrCGAX CGTAAAAGCATGGGXGAGGATCTOTCrGQGCT
A rXCGAGGTGGrGGAGGAGAGAACTXCGGAA l'tAXCGCAGCCXGGAAAATlAAG
XTAGXTGCGGTCCCCAGTAAAAGCAGAATeXTtAGCGTCAAAAAGAACAXGGAA
ATTCATGGACXCGTAAAGCTCTTTAATAAATGGCAGAACATIGCATACAAATATG
ACAAAGACCXAGrGTTGAXGACeCAXTriATTACXAAAAATATTACGGAXAACCA
CGGGAAGAACAAGACAACAGTACAXGGTTACTTTAGCAGCATCTTCGACGGTGG
GGXCGAT'rCTCTAGTAGACC'rGAXGAATAAGTGGTXTCGGGAAaAGGCArCAAG
AAAAGTGACTGCAAAGAAXX'XTCCTGGAX CGACACGACXATCXTGiAJAGTGGAG
TAGXAAACTTXAATACAGCAAAGTTCAAAAAAGAAATGCTGCXAGATCGATCCGC
GGGGAAGAAGACXGCAXrrAGCAXTAAGCTGGACTAIGTAAAGAAACCGATXCC
GGAGACAGCCATGGTXAAAAXTTTGGAGAAATTGXACGAAGAGGACGTCGGAGC
CGGCATGTACGTCCTCTAXCCXTAXGGCGGGAXTATGGAGGAAATCAGTGAGTCC GCXATCCCTTTCCCCCAGCGTGCGGGXATCAXGTACGAGXXATGGTACACCGCGT
CCXGGGAAAAGCAGGAGGACAACQAGAAACACATCAACTGGGXCCGTXCCGTGT
ACAAXrrrACCACCCCTX XGXTXCTCAAAAXCCGCGACTCGCCTAXTXAAACXAX
CGTGACeTGGACCTGGGGAAAACAAACCACGCGAeTCCCAATAACTACACGCAA
GCACGAATCTGGGGTGAAAAGTACTTTGGTAAGAATTTCAATCGACTGGTTAAA
GTlAAGACAAAAGTCGATCGXAACAA'rrXCTTCCGAAATGAGCAATCTATrCCGC
CCTTGCCTCCTCATCACCACTAGgga tta gaggtiaatiaaATGGAGAAAAAAATCACTG
GATATACCAGCGTTGATA ATCCCAAtGGCATCGTAAAGAAGATTTTGAGGCAt
TCAGI/CAGTTGGlGAA GTACCIAl ACCAGACCGTrcAGCXGGATATXAGGGCG
TTXTXAAAGACGGTAAAGAAAAAXAAGGACAAGTXTXATGGGGCCTXTAXTCAGA
TTCXTGCCeGGCTGAXGAAXGCTCAXCCGGAAXXCGGTAXGGGAAXGAAAGACGG
TGAGCTQGXGA'lAXGGGATAGTGTTCAGCGTTGTTACACCGTrn'CGATGAGCAA
ACXGAAACGXT TCAXeGCXCTGGAGTGAATACeACGACGATTXeCGGCAGTXTC
TACAGAXATAXTCGCAAGATGXGGGGXGTXAGGGTGAAAAGCtGGCCXAtXtCeC tAAAGGGTTTATOAGAA/rAXGTXrrTCGTC CAGCGAAXGCCXGGGXGAGTTTCA
CCAGTITXGAXTrAAACGTGGCGAAXA'rGGACAAGTTCTXCGCGGGCGiT ItCACC
AXGGGCAAAI'AlTAIACGCAAGGGGAGAAGGXGCTGATGCCGCTGGGGATrCAG
GTrCATCAIGeCGXGTGTGAlGGCrxeCAXGTCGGCAGAAlGCXTAAIGAATrAG
AACAGTACTGGGAXGAGXGGCAGGG€G6GG€GT0ATTXXTXTAAGGCAGTXA1T
GCJTGCCCTni&AACGCCTGQGmtcczctaWtgttaatia mtgagetms!&i aaai cctkiettactema
MSc t uciaacmiaacmimctMiteteitt tg ttga etccameimmiis ecatcMeim&ecatiaett mt amttitftcccstttiiuggcimtcctircagsacgaci!ggtwcfMa&cct c sct etggstTc !taataattttctaa attgci-g cc:uts^c^cc ak'£ccm c^aae t(sml& tmacamMsi tiicct tit£cccmt :cit2ta i M2tis g £ ^ SMmlsgi i t m ggmeMi £gs g tisg££S SMM ;£MMe£Mcmsgi
SEQ ID N(k I 4
UPPER CASE ITALICS, cpe us opefon upstream sequence for homologous recombhiation (Nucleotides 1-556)
UPPER CASE SOLD? Pire promoter (Nucleotides 5S7-6t5)
Lower ease: RBS {Nucleotides 616-635)
UPPER CASE, 1- M|1: Acyl Activating Enzyme; 1 (Nucleotides 636-2798)
Lower ease; RBS {Nucleotides 2799-2818)
UPPER CASE, 2 - OLS: Oii tol synthase (Nucleotides 281 -3973)
Lower case: RBS (Nucleotides 3974-3993)
UPPER CASE, 3 - PAG: Ollvetolic acid cyclase (Nucleotides 3994-4299)
Lower esse: RBS (Nucleotides 4390-4319)
UPPER CASE, 4 - CBGAS: Canaabkeroiic acid synthase (Nucleotides 4320-5507)
Lower case; RBS {Nucleotides 5508-5527)
UPPER CASE, 5 - CRCAS; Cannabiehromenie acid synthase {Nucleotides 5528-7120) Lower case: RBS (Nueleo tides 7121-7140)
UPPER CASE, chloramphenicol resistance cassette (both starting and stop codons were underlined) (Nucleotides 7141-7839)
Lo r case underlined tialicC the- epc ls operon downstream sequence for homologous recombination (Nise leotides 7840-8400)
CTCGA GAA GA GTCCCTGAA TATCAAAATGGTGGGA TAAAAA GCTCAAAAA GGAAAGTA G GCTGTGGTTCCCTAGGCAA CA G TCTTCCCTA CCCCA.CTGGAAACTAAAAAAA CGAGAAA AGITCGCACCGAA CA TCAJnGCATAAJTlTA GCCCTAAAACATAAGCTGAACGAA4GT GGlTGmiTCCCTTCCCAATCCAGGACAATCTGAGAATCCCCTGCAACATTAClJAACA AAAAA GCAOGAA lAAAA nAACAAGATGmACAGACA TAA GTCCCA WACCGITGTATAA A GTTAACTG TGGG TTGCAAAAGCA TTCAAGCCTA GGCGCTGAGCIVTTTGAGCA ICC CGGTGGCCCTTGTCGCWCCTCCGTGITTCTCCCIGGA TGGATΪΊΆO TAATA TCTCTC
A 7AAATCCCCGGGTAG7TAACGAAAGTTAATGGAGATCAG1AJCAA ACTCIAGGCTC A TTA:ClTTGGAaVCCTCAGT77A TCCGGGGGAAlTGTGTlTAA GAAAA TCCCAACWAT AAA GIGAAGTAGGAGAITA A r?C4GAGCtGTTGACAATTAATCATCCGGCTC€TA AA 'GTGTGGAAAT GTGAGCG€ATAA€ggaattaggaggttsiattaaAXGGGA. AAAC TATAAATCCGTCKiACAGTGTCGTCGCGTCTGATTTTATTGGATTGGGCATTACeA
GTGAAGTAGCAGAGACGCXGGATGGGCGACTAGCTGAAATGG TTQXAAXXAC
GAGGAGCGACi:ceAGAAACQTGGATCAACATGGCGAAJCAi:ArGTTAAGTCCAG
AXCXGCCTTTCICCXTGCAGCAGATGTTGTTTTACGGA GTXATAAGGAXTTTGGG
CCCGCGGGTCCTGCTTGGATGCCAGAGCCXGAGAAGGTAAAAAGCACGAAGTXG
GGAGCA fAGTGGAGAAGCGI GGCAAAGAGTICTTAGGAGIAAAGrACAAAGAC
CCAATTOTAGCXiTAGTCAeTTTGAAGAATITAGTGITCGGAATCCTGAAGTGTA
TXGGCGI'AGAGXATTAATGGAXGAAAXGAAGAXeAGXTTXXCTAAGGACeCAGAA
TG XCCXACGXCGAGATGATAXCAACAAXCCAGGAGGTAGTGAAIGGCXACGXG
GAGGTTAGTTGAACAGTGCmAGAAGtGTTTAAAXGTCAACTGTAATAAAAAGTT
GAACGACACTATCArCGTCTGGCGCGACGAAGGCAACGAI GAXTIAGGATTGAA
CAAACTGACGl AGATCAGl ACGGAAACGXGTGTGCT-rAGTTGGGXAGGGArTA
GAAGAGATGGGTXTGGAGAAAOQTTGTGCCAXXGCTAXXGACAXGCCAAXGGAC
GXCGACGGGGXCGTXATCXATTTGGCTATCGXAGTAGGCGGAXAXGXAGXXGTGTe
TAXCGCGGACnGXXXCAGXGCCCCCGAGATGAGXACTCGTCTGCGACTATCCAAG
GGGAAGGCXATCTTGACGCAGGATCACATCATTCGGGGGAAAAAACGAATXCCTT
TGXACTG CGCGXGGTTGAGGCGAAAAGCGCTAXGGCXATCGTGATTCCGTGCAG
CGGAAGCAAXArTGGXGCAGAAG ACGAGAXGGAGACATCAGTXGGGACXAI r
CXTAGAACGAGCTAAAGAGTXGAAAAATXGTGAAXTCACAGCGCGAGAAGAACG
AGTGGACGCTXATAeAAACATCXXATTXTCXAGTGGAACAACAGGAGAAGGXAAA
GCAAXCCCTTGGAGX'GAAGCGAGCCCIGXAAAAGCTGCGGCGGAIGGATGGAGC
CAXCTAGACATTGGTAAGGGTGATGTCATTGTXTGGCCGACGAATCXGGGTTGGA
TGATGGGTCCTrGGCXAGTTTACGCAXCXCTeCTAAACGGCGGCAGTAXCGCTCTe
TAGAAGGGGXGrGCTCXGG iTAGCGGAXTCGCAAAAXXCGXGCAGGACGCXAAAG
TGAC rAXGCXAGGAGTGGXCCCTTCTAtCGXGCGXAGCTGGAAGAGCACAAACTG
CGXCTCTGGATAXGAXTGGTCTAGCAXCCGGTGCXXXAGTXCXXCGGGAGAAGCC
AGCAATGITGAl'GAG'l'ACCXGiGGTTAATGGGCCGGGGAAAlTACAAAGGAGrr
AXTGAGAXGTGXGGAGGAACAGAAATTGGGGGAGCGTXCXCTGCGGGGAGTTTC
TTGCAAGCeCAATCCCTGXCCAGTTTTAGCAGTCAAXGIAXGGGCXGCACTTTAXA
GAlT ITGGACAAGAACGGWACCCAATGCCGAAAAACAAACCGGGCArTGGXGA
AXXAGCACXAGGXCGAGTAAXGXTCGGAGCXAGXAAGACACTGrXAA TGGCAAC
CAXGACGAXGXCXAXTTCAAGGGGAXGCCGAGAXTAAAXGGTGAGGxeXTACGXG
GXCACGGGGACATXTTCGAGX ACGXGXAAXGGGTA lTAXGACGGXCACGGGCG
AGCGGAXGACACGATGAACAlCGGAGGGArrAAAA rCAGXICCATCGAAAITGA
GCGTGTGXGCAATGAGGTAGACGAXCGGGTAXXCGAGACAACCiGCCAtCGGGGT
GCCGCCCCTCGGAGGGGGAGCCGAAGAA'rrGGXAATTn'XXTTGXGCXGAAGGAX
TCCAACGAXACGACAATCGAGXTGAATCAGTTGCGCCTCAGCTTCAACXXAGGCT
TGCAGAAGAAGCTAAACCCACXCTTCAAGGTTACGCGGGTTGXACCACTGXCTA
CCXCCGXCGGACTGCXACGAAXAAAAXCArGCGCCGAGTACXCGGCCAACAATTC
AGTCAClTCGAATAAggaattaafgaggttaattaaATGAATCACTTGCGAGCGGAAGGTCCC
GCXAGXGTACTCGCTAXTGGGACTGCCAACCCAGAAAAXATXTXACXCCAGGATG AGTTCCCGGAXTAXTAexTGCGAGTCACAAAGAGCGAAGACAXGACGCACiXTAA
AAGAGAAGTTCCGCAAAATCTGTGACAAGTCTATGATTCGCAAACGCAATTGCTT
TTTGAAI'GAAGAACATCTGAAGCAGAAl'CCACGTCTGGr GAGCACGAGAl'GCA
GACTTTAGACGCTCGACAGGACATGCTAGTGGTGGAAGTCCCGAAACTGGGTAA
AGACGCGTGTGCCAAGGCCATTAAGGAATGGGGTCAACCTAAGAGTAAGATCAC
CCATCTCAITTTTACCAGTGCG'rCCACGACAGACATGCCTGGAGCTGACXACCAT
TGTGCCAAGCTCCTAGGACTATCTCCATCTGTGAAACGGGTAATGATGTATCAGC
tAGGATGTTATGGTGGGGGGACTGTGTTACGTATCGCAAAGGATATCGCGGAGA
A AACAAGGGGGCrCGCGTCGtAGeCGTTTGCTGCGAGATrATGGGGTGGCXGlT
TCGGGGACCCTCCGAGAGC ACTTGGAGCTATTAGTAGGCCAAGCGATCTTTGG
AGATGGGGCGGCTGCTGTIATTGTTGGGGGTGAAGCCGAI AGAGTGTAGGTGA
GCGCCCAATTrTCGAGrTGGTCTCCACGGGrCAGACAAITCTCCCCAACAGTGAA
GGCACAAXTGGGGGAOAXATCCGGGAGGCAGGACTGATCTTTGACCTACATAAG
GACGtCGGGATGCTeATTTGTAACAACATTGAAAAGTGCCTGATTGAAGCGTTCA
CCCCAAXCGGCA n AGTGATTGGAAXAGXATCXTCXGGATTACTCAXCCCGGAGG
TAAAGCCAXl'CrAGATAAGGTGGAAGAAAAG I ACAG r'rAAAGXGGGACAAGI'T
TGXCGA GTCGTCACGTGeTGAGCGAGCAXGGGAAXAXGAGiAGCXCTACGGTr
TtGXTCGTTAXGGACGAATTACGAAAGCGCAGCTTGGAGGAGGGAAAAAGCACG
ACAGGGGAXGCiAXTXGAGTGGGGAGXTCXexTXGOAXtTGGTCCCGGGCXGAGAG
XAGAGCGCGTGGI GGXGCGCTCCGXGCCGAXX AGTGAggaattaggaggttaattaaATGG
CCGXAAAGCACCTGA/rXGTAXIOAAATOAAAGAXGAGAXCAGGGAGGCGCAGA
AGGAGGAGTTTTXCAAGACGTAGGXGAACCTAGXGAATAXGAXCCCGGeGATGA
AGGAXGXGTATTGGGGXAAAGATGTAACXGAGAAAAACAAGGAAGAAGGTTACA
GCCAXAITGTrGAAGXeACATTCGAAAGXGXAGAGACGAXCCAAG TrAXArXAI'
TCAXCCGGCtCACGTTGGAXXXGGAGAeGTGXATCGXTCXTTTTGGGAGAAGtXGT
TAAXCTTCGACTAGACCGCCCGCAAAXAGggaatag aggttaattaaATGGGCXTAAGCTG
TGIATGCACXrreAGXTrCCAAACCAAXTATCAXACGCXCCIAAACCCCCACAAr
AACAAGCCAAAAACATCCXXGXTGTGCTAXCGAGAGCCTAAAACGCCAAXGAAGT
AXTC'TTATAACAATTTXCCCXGCAAACACTGCTCCACTAAGAGGTTCCACCTACAA
AAGAAArGXAGCGAAXCCTtGrGCAXCGCCAAGAACTCGAITGGAGCAGCAACC
ACCAATCAGAGAGAGCCACCTGAGAGCGAGAAXCAIAGCGTCGGGAGXAAGATC
CTAAATXTCGGGAAAGCATGCXGGAAACXACAACGACCATACACGAXCATCGCG
TTCACCAGXTGCGCITGGGOXITAXTTGGTAAGGAATXGCTCCAXAATAGCAACCX
GATTTCCXGGAGXCXGAXGTTCAAAGCAXTTTXTXTCTTGOXGGCCATCCTATGXA
TCGCGTCTTXTACAAGAACCAXCAATCAGAXCTATGACCTGCACAXCGAXCGCA
lAACAAGCCAGAGCXCCGATTAGCGrCTGGrGAAAIGTCXGTCAACACCGCCtGG
AXXAXGAGCATTAXTGXAGGAGTGTTTGGGGXAATGAXXAGAAtCAAGATGAAGG
GXGGACGCGTCXACATTTTTGGCXATXGGTXCGGAAXCTTTGGTGGCATXGTTXAC
AGCGXACCAGCGXTfCGGTGGAAGGAGAATCCCAGIACCGCTXTCCXAXTGAACT
TTCXGGCeGAGA CArcACCAACXIXACGTXrXACTACGCAAGXGGGGCGGCAC
GGGGCXCCCAXTCGAGGXGCGACGGAGiXtXTACGXTTGXGTTAGGGTTGAXGAAA GCAXGGGAAGCGGTCTCGCCCTCATTAAGGAXGCCXCCGACGTCGAAGGCGAC
ACAAAGTrCGGXATrrCXACAITAGCAAGCAAGTAXGGtTGGCGXAAGCIAACAC
TGXTTTGXTCTGGAATTGXGTTACTAAGTTATGXAGCAGCTATXCTGGCAGGTAXC
A lTrGGCCCGAGGCCrXGAATAGCAAXGTrAXGCTGXiAXGTCAXGeGATCCXCGC
CrrGrGGTlAAXCCTACAGAGAGGGGACTXTGCCCTCAeXAAl ACGArCCCGAG
GCGGGCGGAGGXXXXXACGAGTTCAXGTGGAAGCXATACXATGCAGAGXACCTCG
TGXACGI'GTTTArrTAAggaattaggaggttaatiaaAXGAAXIGXAGCACGTrCAGCXTCI'G
GXTCGXATGTAAAAT'rATCTTTTTTTTCCrCAGXITTAAXAXCCAAAXCTCXA ITGC
TAAGCCCCAGGAGAAXTTCCXCAAGTGTXTCAGCGAGTACATTCCTAACAACCCX GCXCCAAAATXXAXCTACACGCAAGACGAXCAATTGXAXAXGAGXGTXTXAAAXX
CCAGCATCCAAAACTTGCGTTTTACCTCTGACAGTACACCAAAGCCTCTCGTCATT
GTGACGCCi½.GTAAXGTTACTCATAXS'CAGG€GAGTATTCTCTGCTCTAAACirS'G
GACTCCAAAXCCGCACGCGTAGCGGCGGTCACGATGCGGAAGGGTTATCCTACA
XTAGCCAGGXGCCTXTCGCTAXXGXXGACTXGCGTAAXAXGCATACAGTAGXAGA
CAXTCAXTCCCAGACGGCCGXGGAGGCAGG GCGACGGTGGGGGAAGTTTACTA
CTGGATTAATGAAATGAATGAAAATTTCAGTtTCCCTGGAGGTTACTGtCCAACT
GTtGGAGTTGGAGGTCATTTTTCCGGAGGAGGATACGGAGCGTtAATGCGGAATT
ACGGAXTAGGAGGAGAXAAXAXCAXCGACGGTGAXCXAGXAAAXGrAGACGGAA
AAGTAXTGGACCGAAAGAGTATGGGTGAGGAGTXGTTGTGGGCTArxCGAGGGG
GCGGGGeeGAAAACTTCGGXATCATGGCAGCCTGTAXCAAGCTCTGGGXACCeA
GIAAGGCCACTAXIXTCI'CTGTCAAAAAGAACATGGAGATTCACGGTCICGTGAA
GXTAXTXAACAAAXGGCAAAAXAXXGCCXAexACGAXAAAGACXTGAXGXTGACG
ACGCAXXXGCGCACACGCAACA XACCGAGAACCATGGGAATAAAACAACTGTA
CACGGCXAXXXXXCXAGXAXCXXCCXCGGGGGCGXAGACTCCCXCGXCGATXiGAX
GAAlAAAAGXTXCeGAGAACXGGGXATCAAAACTGACXGrAAAGAAGXGX'CCTG
GAXTGATAGCACGAXTITCTArrCCGGCTGGTATAATACAGCCTITAAGAAAGAA
ATlTlACTGGAXGGCTCIGCGGCjTAAAAAGACGGCXTXCAGCAXCAAACXGGACT
AOGXXAAAAAGCXCAXXCCGGAAAGCGCXAXGGXTAAAATCCXAGAGXXATACGA
AGAAGAGGXXGGCGXAGGCAXGrAXGXAGXCTACCCAXACGG GGXAXXAXGGAX
GAAAXCTGCGAAXeCGCAArrCCAXTrCCCCAXCGeGCGGGTAXCAXGXATGAAC
XGTAXACGGCGACXGAGAAACAGGAAGACAACGAAAAGGACAXCAACXGCGTGC
GGXCCGXCXATAACTXTACGACCGCXTAXGXAAGTCAGAACCCGCGGCXGGCAXA
XCXAAA'iTAICGGGACCTGGAXCXAGGCAAAACGAAGCCCGAGXCTCCGAA iAA
GXAXAGXGAGGCGCGGATCXGGGGGGAGAAAXACXXXGGGAAAAAGXfXAACGG
ACTCCiXAAAGGXAAAAAGCAAGGCCGACCCGAAGAAGXTCXXCCGCAACGAACA
AXGXATXCCGCGAGXCCCCCCAGGCCATCACIAGagaattaggagattaattaaATGGAGAAA
AAAAXCACXGGAXATACCACGGXTGAXATATGCCAATGGCAXCGXAAAGAACAXT
XTGAGGCAXTXCAGXCAGXXGCTCAAXGTAeCTATAACCAGACGGXTCAGCXGGA
TAXrACGGGCITITTAAAGAGCGrAAAGAAAAATAAGCACAAGTlXlAXCCGGCG
XXTAXXCAGAXXGTTG€CCGGCTGAXGAAXGCX€ATCCGGAAXXCCGXATGGCAAX
GAAAGACGGXGAGCTGGXGAXATGGGAXAGXGXTCAGCCXXGTXACACGGXXXXC
CAXGAGCAAAGXGAAACGXTXXCAXCGCXC IGGAGTCAATACCACGACGAXTXGG
GGCAGXTXCTACACAXATAXtCGCAAGATGXGGCGXGTXACGGXGAAAACCTGGC
CXATXXGGCTAAAGGGXTXATXGAGAAXAXGTXTXTCGXCTCAGCGAAXCCCTGGG
XGAGXrFCACCAGI XXGATTXAAACGXGGCCAAXAXGGAGAACXrCTTCGCCCCC
GXTrtCACGAXGGGCAAAXAXXATAGGCAAGGCGACAACiGXGGXGAXGGGGCXGG
GGAXXCAGGXTCATCATGCCGTGXGXGAXGGCXTCGATOTCGGCAGAAXGCtXAA
XGAAIXAC AAC AGXACTGGGAXG AGXGGC AGGGGGGGGCG GAXlXrXT XA GG
CACmAtl &Tt&CCnAAACGCC CK mictxct t mtacta m &as i ima: ttacttactcaaaagcattuactaaccataa at aGtimictctttttt attgaactccaaactaiiaatasccatciiagtcaglcc attM tteaiMit tmcmgm cgi!tsg ttaicciittsiataiiaccacc mtigtitg catia tMtemm utgcag ta ezaafgtiggcwgm^getfgga tcgtg&mgttiigmcmetggaaMtkxeggtaggtgmgecgatgg aec ^t^cmei eta^&^^ct iceaaimtx&iaatca c^gtacaia ficcaccacims!cic

Claims

WHAT IS CLAIMED IS;
L A method of producing a carmabinoid in a pbotosynthetie microorganism, the method comprising::
(a) introducing into the microorganism:
a polynucleotide encoding a GPPS polypeptide; and
one or more polynucleotides encoding AABL OLS, OAC, CBGAS polypeptides, and moxidocyclase selected from the group consisting of CBDAS, THCAS, and CBGAS; wherein
(i) tlid polynucleotide encoding the GPPS polypeptide is opetably linked to a frrst promoter; and
(ii> the one or more polynucleotides encoding the AAEl , OLS- OAC, CBGAS polypeptides and the oxMocyclase are operably linked to one or more additional promoters; an
(b) culturing the microorganism under conditions in which GPPS, AABί,. OLS, OAC, CBGAS, and the oxidocydase are expressed and wherein cannabinoid biosynthesis rakes place. 2. The method of claim I, wherein the photosynlhetie microorganism i cyanobacteria, 3, The method of claim 2, -wherein the GPPS polypepti de is a fusion protein encoded by a polynucleotide encoding GPPS fused to the 3’ end of a leader nncieie acid sequence encoding a protein that is expresse in cyanobacteria at a le vel of at least 1% of the total cellul ar protein, 4, The method of clai 3, wherein the GPPS polypeptide is an npt GPPS fusion protein. 5. The method of claim 4» wherein the GPPS polypepti de comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID O:2. 6. The method of claim 5, wherein the GPPS polypepti e comprises the amino acid sequence of SEQ ID NO:2. 1 7, The method of any one of claims 4-6, wherein the polynucleotide encoding the GPP S polypeptide comprises a nucleotide sequence that is at least 90% or 95%
3 i dentieal to SHQ ID NO: 1.
1 8. The method of claim 7, wherein the polynucleotide encoding the GPPS polypeptide comprises the nucleotide sequence of SEQ II) NO: 1
1 9, The method of claim 1, wherein the AAEl polypeptide comprise an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:4,
1 10. The method of claim 9, wherein the AAEl polypeptide Comprises the amino acid sequence ofSEQ ID NO :4.
1 1 1. The method of claim 9 or 10, wherein the polynuc leotide encoding the AAEl polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 636-2798 of SEQ ID NO:3.
I: 12. The method of claim 11, wherem the polynucleotide encoding the
2 AAEl polypeptide comprises nucleotides 636-2798 of SEQ ID NO:3,
1 13, The method of claim 1, wherein the OLS polypeptide comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:5.
1: 14. The method of claim 13 , wherein the OES polypeptide comprises the
2 amino acid sequence of SEQ ID NO:5,
1 15. The method of clai 13 or 14, wherein the polynucleotide encoding the OLS polypeptide comprises a nucleotide sequence that is at least 99% or 95% identical to
3 nucleotides 281 -3973 of SEQ ID NO:3. 1 16. The method of claim 15, wherein the polynucleotide encoding the OL polypeptide comprises nucleotides 2819-3973 of SEQ ID NG:3„
1 17. The method of claim 1 , wherein the OAC polypeptide comprises an amino acid se uence that is at least 90% or 95% identical to SEQ ID NQi6,
1 18. The method of claim 17, wherein the OAC polypeptide comprises the amino acid sequence of SEQ ID NO:6. 19 The method of claim 17 or 18, wherein the polynucleotide encoding the OAC polypeptide comprises a nucleotide sequence that is at least 0% or 95% identical to nucleotides 3994-4299 of SEQ ID NO:3. 20. Hie method of claim 19, wherein the polynucleotide encoding the OA.C polypeptide comprises nucleotides 3994-429 of SEQ ID NO/J. 21. The method of clai L wherein the QBOAS polypeptide comprises an amino aci sequence that is at least 90'% or 95% identical to SEQ ID NO:?, 22. The method ofelaim 21, wherein the CBGAS polypeptide comprises the amino acid sequence of SEQ iD NO:7. 23. The method ofelaim 21 or 22, wherein the polynucleotide encoding the GBG S polypeptide comprises a nucleotide equence that is at least 90% or 95% identical to nucleotides 4320-5507 of SEQ; ID O:3. 24. The method of elaim 21 or 22, wherein the polynucleotide encoding the GBGAS comprises nucleotides 4320-5507 of SEQ ID NO: 3·, 25, The method of claim 1, wherein the oxidocyelase is CBDAS, and wherein the CBDAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO:8. 26. The method of claim 25, wherein the CBDAS comprises the amino acid sequence of SEQ ID NO: . 27. The method of claim 25 or 26, wherein the polymucieotide encoding tire CBDAS comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 5528-7362 of SEQ ID NQ:3. 28< The, method ofelaim 27, wherein the polynucleotide encoding the CBDAS comprises nucleotides 5528-71 2 of SEQ ID NQ:3, 29, The method of claim 1, wherein the oxidocyelase is THCAS, and wherein die TBCAS comprises an amino acid sequence that is a least 90% or 95% identieal to SEQ ID NO: 10.
30. The method of claim 1, wherein die oxidoeyclase is THCAS, and wherein the THCAS comprises the amino acid sequence of SEQ ID NO:.10. 31 , The method of claim 29 or 30, wherein the polynucleotide encoding the THCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO:9. 32. The method of claim 31 , wherein the polynucl eotkle encodmg the THCAS comprises the nucleotide sequence of SEQ ID NO: 9. 33. The method of claim 1 , wherein the oxidoeyclase is CBCAS. and wherein the CBCAS comprises an a ino ac d sequence that is at least 90% or 95% identical to SEQ ID NO:12. 34. The method of claim 33 » wherein the oxidoeyclase is C BCAS , and wherein the CBCAS comprises the amino acid sequence of SEQ IP NQ;i2. 35, The method of claim -33 or 34, wherein the polynucleotide encoding the CBCAS comprises a nucleotide sequence that is at least 90% or 9590 identical to SEQ ID NO:i i. 36. The method of clai 35 , wherehr the polynucleotide encoding the CBCAS comprises the nucleotide sequence of SEQ ID NO: 1 1. 37. The metho of claim 1, wherein two or more of the polynucleotides encoding the AAB1 , OLS, OAC, CBCJAS polypeptides and the oxidoeyclase ai¾ -present within a single operon. 3-8. The method of claim 37 , wherein all of the polynucleotides encoding the AAEl , DLS, OAC, CBGAS polypeptides and die oxidoeyclase are present within a single operon, 39. The method of claim 38, wherein the operon is at least 9 33 or 95% identical to SEQ ID NO : 3 , SEQ ID NO : 13 , or SEQ ID NO: 14. 40. he method of claim 38 , wherei the opero comprises SEQ ID; NO:3, SEQ ID NO: 13, or SEQ ID NO: 14,
41. The method of claim 1, wherein the first and/or additional promoters are selected from the group consisting of a epc promoter, a psbA2 promoter, a glgA 1 premotor, a Fire promoter, and a T7 promoter. 42, Hie method of claim 1, wherein one or more of the polynucleotides encoding the GPP$, AAE1, OLS, DAC, CBGAS polypeptides and the oxidocyelase are codon optimized for the photosynthelie microorganism. 43. The method of claim 1, wherein the microorganism is from a genus selected from th group consisting of Syneckocystfe, Syneclutcoccus, Athmspim Atesioe, an An a i. 44. The method of claim 1, wherein one or more of the coding sequences for the C3PFS, AAE1, OLS, OAG, CBGAS polypeptides and the oxidocyelase are preceded by ggaattaggaggttaatiaa ribosome binding site (RBS). 45, The method of claim 1, further comprising a ste
(c) isolating cannabinoids from the microorganism or from the culture medium, 46. The method of claim 45, wherefrntfre cannabinoids are collected from the surface of the liquid culture as floater molecules, 47, Tire method of claim 45 , wherein the cannabinoids are extracted front the interior of the microorganism, 48. The method of claim 47, wherein the cannabinoids are extracted from a disintegrated ceil siispension produced by isolating the microorganism and disintegrating it by forcing it through a French press, subjecting it to sonication, or treating it with glass beads 49 . The method of claim 48, wherein the disintegrated cell suspension is supplemented with FLSCb and 30% (w:v) NaCl at a volume-to-vo!ume ratio of (cellsuspension / I-feSO* / NaCl « .3 / 0:12 / 0,5),
50. The method of claim 49, wherein the cannabioo ids arc extracte from the i-feS0.4 and NaCl-ireated disintegrate cell suspension upon incubation with an organic solvent. 51. The method of claim 50, wherein the organic solvent is hexane or heptane, 52 . The method of claim 50, wherein the organic solvent i ethyl acetate, acetone, methanol, ethanol, or propanol. 53. The method of claim 47 , wherein the microorganism i s fteeze-dried. 54, The met hod of claim 53, wherein the eannabinoids are extracted from die freeze- dried microorganism with an organic solvent 55. The method of claim 54, wherein the organic solvent is methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, or heptane. 56. The method of a ty one of claims 50-52 , 4 or 55, wherein the organic solvent is dried b solvent evaporation, leaving the eannabinoids in pure form 57. A photpsyrrthetie microorganism produced using the method of any of claims 1-44, 58 A photosynthetic microorganism comprising
(a) a polynucleotide encoding a GPPS polyp ptide; and
(b) one or more polynucleotides encoding AAEί, OLS, OAC, CBGAS polypeptides and an oxidoeyclase selected from the group consisting of CBDAS, THGAS, and CBCAS; wherein
(i) the polynucleotide encoding the GPPS polypeptide is eperably linked to a first promoter, : and
(ii) the one or more polynucleotides encoding the AAE1, OLS, OAC, CBGAS polypeptides and the oxidocy elase are operahly linked to one or more additional promoters. 59, The microorganism of claim 58, wherein the microorganism is cyanobacteria.
1 60. The microorganism of claim 58, wherein the GPPS polypeptide is a fusion protein encoded by a polynucleotide encoding GPPS fused to the 31 end of a leader
3 nucleic acid sequence encoding a protein that is expressed in cyanobacteria at a level of at least 1 % of the total cellular protein
1 61. The microorganism of claim 60, wherein the GPPS polypeptide is a nptDGPPS fusion protein.
1 62. The microorganism of claim 61. wherein the GPPS polypeptide
comprises an amino acid sequence that is at least 90% or 93% identical to SEQ ID NO;2.
1 63. The microorganism of claim 61, wherein the GPPS polypeptide
comprises the amino acid sequence of SEQ ID NQ:2,
1 64. The microorganism of any one of claims 61 to 63, wherein the
polynucleotide encoding the GPPS polypeptide comprises a nucleotide sequence that is at
3 least 90% of 95% identical to SEQ ID NO: 1. ί 65. The microorganism of any one of claims 61 to 63, wherein the
polymicieotide encoding the GPPS polypeptide comprises the nucleotide sequence of SEQ ID G:l.
1 66. The microorganism of clai 58, wherein the AAE 1 polypeptide
comprises an a ino acid sequence that is at least 90% or 93% identical to SEQ ID NO:4:
1 67. The microorganism of claim 58, wherein the AAE! polypeptide
c prises the amino add sequence of SEQ ID NO:4.
1 68. The microorganism of claim 66 or 67, wherein the polynucleotide encoding the AAE 1 polypeptide comprises a nucleotide sequence that is at least 90% or 95%
3 idenrieaIto nucleotides 636-2798 of SEQ ID ND:3,
1 69. The microorganism of claim 66 or 67, wherein the polynucleotide encoding the AAEl polypeptide comprises nucleotides 636-2798 of SEQ ID NQ:3.
1 70. The microorganism of claim 58, wherein the OLS polypeptide
2 comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO: 5. 71, The microorganism of claim 58, wherein the GLS polypeptide comprises the amino add sequence of SEQ ID NO:5. 72, The microorganism of claim 70 or 71 , wherein the polynucleotide encoding the OES polypeptide comprises a nucleotide sequence that is at least 90% or 95% identical to nucleotides 2819-3973 of SEQ ID NO;3. 73 The microorganism of claim 70 or 7.1 , wherein the pol ynueieotide encoding the OLS polypeptide comprises nucleotides 2819-3973 of SEQ ID NO:3, 74. The microorganism of claim 58, wherein the OAC polypeptide co rise an ammo acid sequence that is at least 90% or 95% identical to SEQ ID O:6, 75 The microorganism of claim 58, wherein the GAC polypeptide comprises the amino acid sequence of SEQ ID NO:6. 76 The microorganism of clai 74 or 75, wherein the polynucleotide encoding the DAC polypeptide eoaiprises a nucleotide sequence that is at least 99% or 95% identical to nucleotides 3994-4299 of SEQ ID NO :3. 77 The microorganism of claim 74 or 75, wherein the polynucleotide encoding the DAC polypeptide comprises nucleotides 3994-4299 of SEQ ID NO;3. 78. The microorganism of claim 58, wherein die CBGAS polypeptide comprises an amino acid sequence that is at least 90% or 95% identical to SEQ JfD NO: 7 79. The microorganism of claim 58, wherein the CBGAS polypeptide comprises the amino acid sequence of SEQ ID NO:7. 80. The microorganism of claim 78 Or 79, wherein the polynucleotide encoding the CBGAS poljpepiide comprises a nucleotide sequence that is at least 90% or -95% identical to nucleotides 4320-5507 of SEQ ID NO:3, 8Ϊ. The microorganism of claim 78: or 79 wherein the polynucleot de encoding the CBGAS polypeptide comprises nucleotides 4320-5507 of SEQ ID NO:3. : 82. The microorganism of claim 58* wherein the oxidocyclase is CBDAS, and wherein die CBDAS comprises an amino add sequence that is at least 90% or 95% i dedieal to SEQ ID NO : 8. 83. The microorganism of claim 82, wherein the CBDAS comprises SEQ ID NO:8. 84. The microorganism of claim 82 or 83, wherein the polynucleotide encoding the CBDAS comprises a .nucleotide sequence that is at least 90% or 95% identical to nucleotides 5528-7162 of SEQ ID NO:3, 85 The microorganism of claim 84, wherein the polynucleotide encoding the CBDAS comprises nucleotides 5528-7162 of SEQ ID NO; 3, 86. The mieroorganism of claim 58, wherein the oxidocyclase is THCAS, and wherein the THCAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NO: 10: 87. The microorganism of claim 86, wherein the THCAS comprises the amino aci sequence of SEQ ID NO: 10. 88 The microorganism of claim 86; or 87, wherein the polynuc leotide encoding the THCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SEQ ID NO:9, 89. The mi croorganism of claim 88, wherein the -polynucleotide encoding the THCAS comprises the nucleotide se uence of SEQ ID NQ;9. .90. The microorganism of claim 58, wherein the oxidocyclase is CBCAS, and wherein the CBCAS comprises an amino acid sequence that is at least 90% or 95% identical to SEQ ID NQH2. 91 Hie microorganism of claim 90, wherein the CBCAS comprises the amino acid sequence of SEQ ID NO: 12,
92. The microorganism of claim 90 or 91 , wherein the polynucleotide encoding the CBCAS comprises a nucleotide sequence that is at least 90% or 95% identical to SlQ ID NO: 1 1. 93. The microorganism of claim 92, wherein the polynucleotide encoding the CBCAS comprises the amino acid sequence of SEQ ID NO: Ϊ 1. 94. The microorganism of claim 58, wherein two or more of the polynucleotides encoding the AABl , OLS, OAC, CBGAS polypeptides and the oxidoeyclase are present within a single operon, 95, The microorganism of claim 94, wherein all of the polynucleotides encoding the AAE1 , OLS;, OAC, CBGAS polypeptides and the oxidoeyelase are present within a single operon. 96, The mieroorganism of clai 95, wherein the operon is at least 90% or 95% identical to SEQ ID NQ:3, SEQ ID NO: 3, or SEQ ID NO: 14. 97. The microorganism of clai 96, wherein the operon comprises SEQ ID NG:3, SEQ ID NO: 13, or SEQ ID O:14. 98, The microorganism ofpkini 58, wherein the first and/or additional promoters are selected from the group consisting of a epe promoter, a psbA2 promoter, a glgAl promoter, a Ptre promoter, and a 17 promoter. , 99. The microorganism of claim 58, wherein one or mom of the
polynucleotides encoding the CiPPS, AAEl, OLS, OAC, CBGAS polypeptides and the oxidoeyelase are codon optimized forthe photosynthetic microorganism. 100, The mieroorganism of claim 58 , wherein the microorganism is from a genus selected from the group consisting of $ nech(}Cy$tig, Synechococcus, Atkwspim, Na toe, and Anabaena. 1(11 , The rtiieroorganism of claim 58, wherein one or more of the coding sequences for the GPPS, AAEl, OLS, O AC, CBGAS polypeptides and the oxidoeyelase are preceded by a ggaattaggaggttaattaa ribosome binding site (RBS). 102, A polynucleotide encoding CjPPS, A AE 1 , OLS, OAC, CBGAS, CBDAS, THCAS. and/or CBGAS, wherein the polynucleotide is codon optimized for cyanobacteria or another pbotosynthetie microorganism; and wherein the polynucleotide is at least 90-¼ or 95% identical to a sequence selected from the group consisting of SEQ ID NO;l , SEQ ID; NO: 3, SEQ ID NO: 9, SEQ ID NO;! 1 , SEQ ID NO; 13, SEQ ID NO: 14, micleoiides 635-2798 of SEQ ID N0;3, nucleotides 281 -3973 of SEQ ID NO:3, nucleotides 3994-4299 of SEQ ID NO:3, nucleotides 4320-5507 of SEQ ID NOG, and nucleotides 5528- 7162 of SEQ ID NOG, : 103 , The polynucleotid of claim 102, wherein the polynucleotide
comprises a sequence selected from the group consisting of SEQ I'D NO; 1 , SEQ ID NO :3 , SEQ ID NO:9, SEQ 1D N0:1 L SEQ ID NO: 13. SEQ I NO: 14, nucleotides 635-2798 of SEQ ID NO:3, nucleotides 281 -3973 of SEQ ID NO:3, nucleotides 3994-4299 of SEQ ID O 3 , nucleotides 4320-5507 of SEQ ID NO:3, and nucleotides 5528-7162 of SEQ ID NQ 3. 104, Aft expression cassette comprising the polynucleotide of claim 102 or 103, 105. A host ceil comprising die polynucleotide of clai 102 or 103, or the expression cassette of claim 104, 106, A cell culture comprising the microorganism of any of claim 57- 101 or the host cell of claim 105. 107. A method of producing eannahinoids, comprising culturing the photosynthefic microorganism of any one of claims 57- 101 , or tire host cell of claim 105, under conditions in which the CiPPS, AAEl , OLS OAC. CBGAS polypeptides and the oxidocye!ase are expressed and wherein cannahinoid biosynthesis takes place. 108, The method of claim 107, ftuther comprising isolating cannabinoitiS: fro the microorganism or from the culture medium, 109 , The method of claim 108, wherein the cannahinoids arc isolated from the surface of the liquid culture as floater molecules. 1 10, The method of claim 108, wherein the catmabinoids are extracted from the interior of the microorganism. 11.1. The method of claim 1 10, wherein the eannabinoids are extracted from a disintegrated cell suspension produced by isolating the microorganism and disintegrating it b forcing it through a French press, subjecting it to somcation, or treating it with glass beads. 1 12 , The method of claim 11 1 < wherein the disintegrated cell suspension i supplemented with ¾SO« and 30% (w ;v) NaC 1 at a volnme-to-voiume ratio of (cell suspension / ¾S04 / NaCl - 3 / 0.12 / 0,5). 1 13 , The method of claim 112, wherein the catmabinoids are ex tracted from the HJSOJ and NaCl-treated disintegrated cell suspension upon incubation with an organic solvent. 114, The method of claim 1 13 , wherein the organic solvent is hexane or heptane, 1 15 , The method of clai 113, wherein the organic solvent is ethyl acetate, acetone, methanol, ethanol, or propanol. 116. The method of claim 1 10, wherein the microorganism is freexe-dried. 117. The method of claim 116, wherein the catmabinoids are extracted from the freeze-dried microorganism with an organic solvent. 118. The method of claim 1 17, wherein the organic solvent is methanol, acetonitrile, ethyl acetate, acetone, ethanol, propanol, hexane, or heptane. 1 19. The method of any one of claims 113- .1 15, 1 1 7 or 1 18, wherein the organic- solvent is dried by solvent evaporation, leaving the cannahinoids in pure form.
PCT/US2020/020512 2019-03-01 2020-02-28 Production of cannabinoids using genetically engineered photosynthetic microorganisms Ceased WO2020180736A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/435,695 US20220243236A1 (en) 2019-03-01 2020-02-28 Production of cannabinoids using genetically engineered photosynthetic microorganisms

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962812906P 2019-03-01 2019-03-01
US62/812,906 2019-03-01

Publications (3)

Publication Number Publication Date
WO2020180736A2 true WO2020180736A2 (en) 2020-09-10
WO2020180736A3 WO2020180736A3 (en) 2020-10-01
WO2020180736A9 WO2020180736A9 (en) 2020-10-22

Family

ID=72338089

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/020512 Ceased WO2020180736A2 (en) 2019-03-01 2020-02-28 Production of cannabinoids using genetically engineered photosynthetic microorganisms

Country Status (2)

Country Link
US (1) US20220243236A1 (en)
WO (1) WO2020180736A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114410474A (en) * 2021-12-09 2022-04-29 湖北师范大学 Simple and efficient method for preparing nostoc mycosporine amino acid crude product

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX363434B (en) * 2012-08-17 2019-03-22 Evolva Sa INCREASED PRODUCTION OF TERPENES and TERPENOIDS.
US10876124B2 (en) * 2015-06-26 2020-12-29 The Regents Of The University Of California Fusion constructs as protein over-expression vectors
CN110914416B (en) * 2017-04-27 2023-07-21 加州大学董事会 Microorganisms and methods for producing cannabinoids and cannabinoid derivatives
CN108865961B (en) * 2018-06-05 2020-07-14 上海交通大学 Method for synthesizing 3-geranyl-4-hydroxybenzoic acid and xiamenmycin by using escherichia coli

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114410474A (en) * 2021-12-09 2022-04-29 湖北师范大学 Simple and efficient method for preparing nostoc mycosporine amino acid crude product

Also Published As

Publication number Publication date
WO2020180736A9 (en) 2020-10-22
WO2020180736A3 (en) 2020-10-01
US20220243236A1 (en) 2022-08-04

Similar Documents

Publication Publication Date Title
ES2647828T3 (en) Valencene synthase polypeptides, nucleic acid molecules that encode them, and uses thereof
US11952580B2 (en) Heterologous production of psilocybin
US20220259603A1 (en) Methods and cells for microbial production of phytocannabinoids and phytocannabinoid precursors
JP2020503888A (en) Recombinant yeast and use thereof
US10648005B2 (en) Transformed synechococcus elongatus strains having improved productivity of farnesene and use thereof
NL2019473B1 (en) Terpene Synthase producing patchoulol and elemol, and preferably also pogostol
US11512293B2 (en) Use of type III polyketide synthases as phloroglucinol synthases
EP4370683A2 (en) High efficiency production of cannabidiolic acid
US10208326B2 (en) Methods and materials for biosynthesis of manoyl oxide
US20220325290A1 (en) Biosynthesis of eriodictyol
CN117844657B (en) Genetically engineered bacteria with high production of echinocandin B and its application
AU2013217130B2 (en) Production of beta-phellandrene using genetically engineered cyanobacteria
WO2013096863A1 (en) Constructs and methods for improved isoprene biosynthesis
CN112608936A (en) Promoter for regulating and controlling expression of yeast exogenous gene, regulation and control method and application thereof
WO2021081647A1 (en) Engineered microorganism for the production of cannabinoids
US20240228986A1 (en) Engineered cells, enzymes, and methods for producing cannabinoids
WO2020180736A9 (en) Production of cannabinoids using genetically engineered photosynthetic microorganisms
KR101625898B1 (en) Recombinant microorganism with mevalonate or mevalonolactone production ability, and method for preparing mevalonate or mevalonolactone using the same
Zhang et al. A novel high-temperature Kluyveromyces marxianus as a microbial cell factory host for sesquiterpene production
KR102286815B1 (en) Transformed methanotrophs for producing a-humulene production from methane and uses thereof
KR101400274B1 (en) Recombinant vector comprising cytocrome p450 reductase genes, microorganism transformed thereof and method for producing p450 enzyme-derived compounds using the same
CN121628862A (en) Isopentenyl transferase enzyme application in bakuchiol synthesis
JP2013504332A (en) Nucleic acid molecule encoding triterpenoid synthase
CN121518535A (en) A method for promoting the synthesis of carotenoids by Yersinia lipolytica and its engineered strain
CN121006390A (en) A method to promote the synthesis of carotenoids by Yeast Extract

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20765557

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20765557

Country of ref document: EP

Kind code of ref document: A2