WO2020132465A1 - Methods and compositions related to therapeutic peptides for cancer therapy - Google Patents
Methods and compositions related to therapeutic peptides for cancer therapy Download PDFInfo
- Publication number
- WO2020132465A1 WO2020132465A1 PCT/US2019/067890 US2019067890W WO2020132465A1 WO 2020132465 A1 WO2020132465 A1 WO 2020132465A1 US 2019067890 W US2019067890 W US 2019067890W WO 2020132465 A1 WO2020132465 A1 WO 2020132465A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- elane
- cells
- peptide
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1793—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
- A61K38/482—Serine endopeptidases (3.4.21)
- A61K38/486—Elastase (3.4.21.36 or 3.4.21.37)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0025—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21037—Leukocyte elastase (3.4.21.37), i.e. neutrophil-elastase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0693—Tumour cells; Cancer cells
Definitions
- Embodiments of the compositions and methods described herein are directed generally to the fields of molecular biology, medicine, and cancer therapy.
- embodiments are directed to cancer therapy and anticancer peptide compositions.
- Cancer is an expansionist disease of mutations, which exhibits a high degree of spatial and temporal genetic heterogeneity (Stratton et al., Nature , 2009; Vogelstein et al., Science, 2013). In addition to overcoming this heterogeneity, eradicating tumor cells while sparing non-cancer cells remains a daunting task. For these reasons, identifying agents that couple broad efficacy across cancer types while maintaining specificity to limit host toxicity has been challenging.
- TAN accumulation is a poor prognostic marker in many cancer types (Coffelt et al., Nat Rev Cancer , 2016; Shen et al., PLoS One, 2014; Powell et al., Immunol., 2016).
- Embodiments of the current invention provide a solution to the problems associated with balancing patient toxicity with broad efficacy of cancer therapy.
- embodiments are directed to anti-cancer peptides that demonstrate a broad anti-cancer efficacy with a limited toxicity to normal or non-cancer cells.
- ELANE was identified as the major anti-cancer protein released by human PMNs having a mechanism of action that involves cleaving human CD95 (hCD95) at y 220 /A 221 and I 331 /Q 332 to liberate a death domain (DD)-containing proteolytic fragment that selectively kills cancer cells.
- DD death domain
- ELANE has several interesting properties in pre-clinical models. First, its ability to kill a wide range of cancer cells may enable its implementation without knowledge of their genetics. Second, its specificity to cancer versus non-cancer cells may limit potential toxicity. Third, initial studies suggest that it is challenging for cancer cells to acquire resistance to ELANE. Mechanistically, it is proposed that these properties stem from ELANE’ s ability to target CD95. Indeed, the killing program, broad efficacy, specificity, and resistance profiles of ELANE closely mimicked those reported in cancer cells treated with shRNA to lower CD95 levels (L. Chen et al., Nature , 2010), with one important difference.
- CD95 is known to exert both pro- and anti-apoptotic effects depending on physiological context (Martin- Villalba, Liorens-Bobadilla, Wollny. Trends Mol Med, 2013), and studies identify ELANE as a potential therapeutic that capitalizes on its pro-apoptotic function. [0011] The inventors’ studies show that ELANE proteolytically liberates the CD95 DD to selectively kill a wide range of cancer cells.
- transiently over-expressing full length CD95 (aa 1-335) or a C-terminal CD95 peptide containing both cleavage sites (aa. 212-335) accelerated ELANE-mediated killing in human cancer cells, while transiently over-expressing the N-terminal domain (aa 1-209) had no effect.
- transiently over-expressing these hCD95 proteins/peptides were insufficient to kill cancer cells in the absence of ELANE.
- MDA-MB-231 cancer cells stably expressing the CD95 C or Cl-2 peptide under control of a doxycycline-inducible promoter.
- TNBC MDA-MB-231 cancer cells
- MDA-MB-231 cells expressing the doxycycline-inducible Cl-2 peptide were injected into mammary fat of mice and tumors were allowed to grow until ⁇ 100mm 3 in size. At this time, doxycycline was administered to the mice via IP injection or through the food. Results showed that inducing Cl- 2 expression in MDA-MB-231 cells lessened tumor growth and increased the number of CD45 + immune cells in tumors.
- Certain embodiments are directed to a therapeutic or anti-cancer composition including various combinations of anti-cancer peptides or variants thereof, expression vector(s), or expression cassette(s) encoding the same.
- a peptide composition can include one or more peptide comprising, consisting essentially of, or consisting of the amino acid sequence
- Certain embodiments are directed to one or more peptide or variant thereof having an amino acid sequence that is 90, 92, 94, 96, 98, 99, to 100% identical, including all values and ranges there between, over 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
- a functional segment of the anticancer peptide can start at amino acid 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
- an anti-cancer peptide described herein can be modified by chemical modification of amino acid side chains (e.g, crosslinking, glycosylation, etc.) or by including heterologous peptide sequences at the amino or carboxy terminus of the peptide.
- the anticancer peptides can be present in a composition, individually, at a concentration of 1, 50, 100, 150, 200, 250, 300, 350, 400, 450 pg/mL to 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 pg/mL; or 1, 10, 20, 30, 40, 50, 60, 70, 80, 90 mg/mL to 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200 mg/mL, including all ranges and values there between.
- Certain embodiments are directed to one or more anticancer peptide and/or compositions containing the same.
- one or more peptide components have 90 to 100% identity to a peptide selected from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 5 or a functional segment thereof.
- a peptide has an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4.
- the peptide component can be coupled to a substrate.
- the substrate is a delivery vehicle.
- the delivery vehicle can be a nanoparticle ( e.g ., a liposome).
- Certain embodiments are directed to methods for treating cancer comprising administering an effective amount of a therapeutic composition comprising one or more peptide that is 90 to 100% identical to a peptide selected from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, or a functional segment thereof to a subject having cancer.
- the therapeutic composition can be administered by injection.
- the therapeutic composition is administered intratumorally (e.g., by intratumoral injection).
- the cancer can be a bladder, blood, bone, bone marrow, brain/nervous system, breast, colorectal, esophageal, gastrointestinal, head, kidney, liver, lung, nasopharynx, neck, ovarian, pancreatic, prostate, skin, stomach, testicular, tongue, or uterine cancer.
- a peptide is present at a dose of 0.001 mg/kg and 10 mg/kg body weight, preferably between at least, at most, or about 0.1 and 5 mg/kg body weight, most preferably between 0.5 and 1 mg/kg body weight.
- the method can include administering a second anticancer therapy.
- the second anticancer therapy can be a chemotherapy, radiotherapy, immunotherapy (e.g ., checkpoint inhibitor), or anti-hormonal therapy.
- Certain embodiments are directed to methods for inducing apoptosis in a cancer cell comprising contacting the cancer cell with an effective amount of one or more peptide having 90 to 100 % identity to a peptide selected from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, or a functional segment thereof.
- the cancer cell can be a bladder, blood, bone, bone marrow, brain/nervous system, breast, colorectal, esophageal, gastrointestinal, head, kidney, liver, lung, nasopharynx, neck, ovarian, pancreatic, prostate, skin, stomach, testicular, tongue, or uterine tumor.
- the anticancer peptides described herein were discovered as fragments of human CD95, isoform 1, which has an amino acid sequence of MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQ FCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGL EVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR SNLGWLCLLLLPIPLI VWVKRKE V QKT CRKHRKENQGSHESPTLNPET VAINL SD VD L SK YITTI AGVMTL S Q VKGF VRKN GVNE AKIDEIKNDN V QDT AEQK V QLLRNWHQL HGKKE AYDTLIKDLKK ANLCTL AEKIQTIILKDIT SD SEN SNFRNEIQ SL V (SEQ ID NO: l, accession number NP
- Amino acids 1 to 25 are a signal peptide and the mature form comprises amino acids 26 to 335. Certain embodiments are directed to one or more peptide or variant thereof having an amino acid sequence that is 90, 92, 94, 96, 98, 99, to 100% identical, including all values and ranges there between, over 10, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250 or 255 contiguous amino acids, including all values and ranges there between, of SEQ ID NO: l .
- an anti cancer peptide described herein can be modified by chemical modification of amino acid side chains (e.g., crosslinking, glycosylation, etc.) or by including heterologous peptide sequences at the amino or carboxy terminus of the peptide.
- the N terminus as referred to herein is from amino acids 1 to 209 of SEQ ID NO: 1) and the C terminus as referred to herein is from amino acids 212 to 335 of (SEQ ID NO: 1).
- compositions described herein can kill a wide variety of cancer cells, irrespective of cancer cell genetics.
- the cancer is a bladder, blood, bone (e.g, osteosarcoma), bone marrow (e.g, leukemia), brain/nervous system (e.g, neuroblastoma, glioblastoma), breast, colorectal (e.g, colon carcinoma), esophageal, gastrointestinal, head, kidney, liver ( e.g ., hepatocellular carcinoma), lung (e.g., non-small cell lung cancer), nasopharynx, neck, ovarian, pancreatic, prostate, skin (e.g, melanoma), stomach, testicular, tongue, or uterine cancer.
- Compositions described herein are toxic to cancer cells, but are not toxic or have a limited toxicity to non cancer cells.
- Certain embodiments are directed to methods for killing a cancer cell by contacting the cancer cell or tumor with an effective amount of a therapeutic anti-cancer peptide composition.
- the anti-cancer peptide composition is administered to a patient that has cancer.
- the cancer is a bladder, blood, bone, bone marrow, brain, breast, colorectal, esophageal, gastrointestinal, head, kidney, liver, lung, nasopharynx, neck, ovarian, pancreatic, prostate, skin, stomach, testicular, tongue, or uterine cancer.
- the anti-cancer peptide composition can further comprise or be administered in conjunction with additional anti-cancer agents to enhance the effectiveness of the peptide composition.
- these additional anti-cancer agents can be administered before; during; after; before and during; before and after; during and after; or before, during and after administration of the polypeptide composition.
- a composition described herein can be administered before; during; after; before and during; before and after; during and after; or before, during and after administration of an immunotherapy, a chemotherapy, an anti-hormone therapy, or a radiotherapy.
- a peptide composition described herein is administered in combination with a chemotherapy, e.g, doxorubicin and/or paclitaxel.
- Certain embodiments are directed to an expression vector or expression cassette encoding one or more anti-cancer peptides.
- a subject can be administered such a vector or cassette for the purpose of expressing one or more anti-cancer peptide in or in proximity to a target cancer or tumor.
- an effective amount means an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- An“effective amount” of an anti-cancer agent in reference to decreasing cancer cell growth, means an amount capable of decreasing, to some extent, the growth of some cancer or tumor cells.
- the term includes an amount capable of invoking a growth inhibitory, cytostatic and/or cytotoxic effect and/or apoptosis of the cancer or tumor cells.
- A“therapeutically effective amount” in reference to the treatment of cancer means an amount capable of invoking one or more of the following effects: (1) inhibition, to some extent, of cancer or tumor growth, including slowing down growth or complete growth arrest; (2) reduction in the number of cancer or tumor cells; (3) reduction in tumor size; (4) inhibition (i.e., reduction, slowing down, or complete stopping) of cancer or tumor cell infiltration into peripheral organs; (5) inhibition (; i.e ., reduction, slowing down, or complete stopping) of metastasis; (6) enhancement of anti-tumor immune response, which may, but is not required to, result in the regression or rejection of the tumor, or (7) relief, to some extent, of one or more symptoms associated with the cancer or tumor.
- the therapeutically effective amount may vary according to factors such as the disease state, age, sex and weight of the individual and the ability of one or more anti-cancer agents to elicit a desired response in the individual.
- a “therapeutically effective amount” is also one in which any toxic or detrimental effects are outweighed by the therapeutically beneficial effects.
- phrases“treating cancer” and“treatment of cancer” mean to decrease, reduce, or inhibit the replication of cancer cells; decrease, reduce or inhibit the spread (formation of metastases) of cancer; decrease tumor size; decrease the number of tumors (i.e., reduce tumor burden); lessen or reduce the number of cancerous cells in the body; prevent recurrence of cancer after surgical removal or other anti-cancer therapies; or ameliorate or alleviate the symptoms of the disease caused by the cancer.
- expression vector refers to a vector that is suitable for transformation of a host cell and contains nucleic acid sequences that direct and/or control (in conjunction with the host cell) expression of one or more heterologous coding regions operatively linked thereto.
- An expression construct may include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto.
- the term“expression cassette” refers to a nucleotide sequence that contains at least one coding sequence along with sequence elements that direct the initiation and termination of transcription.
- An expression cassette may include additional sequences, including, but not limited to promoters, enhancers, and sequences involved in post-transcriptional or post- translational processes.
- the terms“inhibiting,”“reducing,” or“prevention,” or any variation of these terms, when used in the claims and/or the specification includes any measurable decrease or complete inhibition to achieve a desired result.
- the words“comprising” (and any form of comprising, such as“comprise” and“comprises”),“having” (and any form of having, such as “have” and“has”),“including” (and any form of including, such as“includes” and“include”) or“containing” (and any form of containing, such as“contains” and“contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
- compositions and kits can be used to achieve methods.
- FIGS. 1A-1K ELANE cleaves CD95 to selectively kill cancer cells.
- Heatmap summary of ELANE’ s effects on survival, stress, and apoptosis pathways in cancer cells and healthy cells. See FIG. 2 for quantification.
- B-C Cancer cells were treated with ELANE (100 nM) and CD95 cleavage was assessed by western blotting using anti-N-terminal (B) or anti-C-terminal antibodies (C). *, lower molecular weight CD95 fragment.
- E Cleavage of recombinant human CD95 N- terminal (aa 1-173) or C-terminal (aa 212-335) proteins by ELANE was assessed by SDS- PAGE and Coomassie blue staining.
- F Bands from (E) were digested with trypsin and analyzed by mass spectrometry to identify putative ELANE cleavage sites (i.e., peptides with non-tryptic ends). Major non-tryptic peptides were quantified by ion chromatograms.
- G Schematic of ELANE cleavage sites in CD95.
- Heatmap shows the overlap between the 2 CD95 cleavage sites and ELANE’ s sequence specificity (at URL web.expasy.org).
- H Cleavage of recombinant peptides corresponding to aa 214-231 and aa 317- 335 in CD95 by ELANE was monitored by mass spectrometry.
- I Cancer cells or non-cancer cells were treated with fluorescein-labeled ELANE for 10 min and uptake was visualized by immunofluorescence.
- J ELANE catalytic activity in cancer cell lysates following exposure to ELANE for 30 mins in the presence and absence of Dynasore (60 mM, an endocytosis inhibitor).
- FIGS. 2A-2D Overexpressing CD95 proteins accelerates cancer cell killing by ELANE.
- Polycistronic adenoviral vectors were prepared to express the human and mouse CD95 sequences followed by the Encephalomyocarditis virus (EMCV) internal ribosome entry site and dTomato sequence under the control of the cytomegalovirus (CMV) promoter.
- EMCV Encephalomyocarditis virus
- CMV cytomegalovirus
- Human and murine cancer cells or non-cancer cells were transduced to over-express full-length CD95, N-terminal CD95 (human: aa 1-209; mouse: aa 1-204), or C-terminal CD95 (human: aa 212- 335; mouse: aa 204-327).
- A Transduction efficiency quantified by dTomato (Left). CD95 levels in dTomato- and dTomato+ cells quantified by geometric mean (MFI) (Middle). ANXA5 levels in dTomato- and dTomato+ cells 30min after treatment with ELANE (40nM) (Right). Representative data for A549 cells are shown.
- B-C Quantification of transduction efficiency (B) and relative CD95 overexpression (C) for cancer cells and non-cancer cells.
- D Quantification of ANXA5 levels following ELANE treatment (40 nM, 30 min) for mouse cancer cell lines (E0771, B16F10). *, p ⁇ 0.05 Student’s /-test.
- FIG. 3 Efficacy of Cl-2 peptide. Heatmap of the effects Cl -2 expression on survival, stress, and apoptosis pathways in cancer and non-cancer cells.
- FIG. 4 Inducible Expression System. Scheme of doxycycline inducible Tet-on system to express either C (aa. 157-335) or Cl-2 (aa. 221-331). Cl-2 (DD containing fragment) upon addition of doxycycline (both in vitro and in vivo).
- FIGS. 5A-5C Confirmation of Cl-2 expression and cancer cell selective killing.
- FIGS. 6A-6C In vitro testing MDA-MB-231 cell death post Cl-2 induction.
- FIG. 7A-7C In vivo testing MDA-MB-231 tumor regression post Cl-2 induction.
- A Tumor weight.
- B Tumor cells (millions) count (post-ficoll gradient).
- C Percent immune cells in tumors (mouse CD45+) measurement by flow cytometry.
- ELANE cleaves CD95 to release proteolytic fragments that selectively kill a wide range of cancer cells.
- CD95 degradation (production of CD95 fragments) has been identified as the mechanism of action by which ELANE kills cancer cells, and further shows that a broad range of proteases can mimic ELANE’ s CD95 degradation and cancer cell killing properties. Aspects of the invention are based partially on the following observations. Treating ELANE or neutrophil conditioned media with alpha- 1 -antitrypsin or PMSF, two irreversible non-competitive ELANE inhibitors, protects cancer cells from apoptosis. ELANE degrades the C-terminal domain of purified CD95.
- this cleavage pattern was distinct from that produced by MMP7, which was previously shown to cleave the extracellular N-terminal domain of CD95, resulting in protection of cancer cells from FASL-mediated apoptosis (Strand et al., Oncogene , 2004).
- Certain embodiments are directed to a therapeutic or anti-cancer composition including various combinations of anti-cancer peptides or variants thereof, expression vector(s), or expression cassette(s) encoding the same.
- a peptide composition can include one or more peptide comprising, consisting essentially of, or consisting of the amino acid sequence
- Certain embodiments are directed to one or more peptide or variant thereof having an amino acid sequence that is 90, 92, 94, 96, 98, 99, to 100% identical, including all values and ranges there between, over 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
- a functional segment of the anti-cancer peptide can start at amino acid 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
- an anti-cancer peptide described herein can be modified by chemical modification of amino acid side chains (e.g ., crosslinking, glycosylation, etc.) or by including heterologous peptide sequences at the amino or carboxy terminus of the peptide.
- polypeptides and peptides include polypeptides having an amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, and/or SEQ ID NO:5, and functional segments thereof.
- “Polypeptide” refers to any peptide or protein comprising amino acids joined by peptide bonds or modified peptide bonds.
- “Polypeptide” can include short chain polypeptides, including peptides, oligopeptides or oligomers, and longer chain polypeptides, including proteins.
- Polypeptides may contain amino acids other than the 20 gene-encoded amino acids.
- “Polypeptides” include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification or other synthetic techniques well known in the art. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains, and the amino terminus or the carboxy terminus. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications.
- Modifications include terminal fusion (N- and/or C- terminal), acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethyl ati on, formation of covalent cross-links, formation of cystine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquit
- detectable labels there are a wide variety of detectable labels that can be attached to polypeptides and variants thereof.
- common useful fluorophores can be fluorescein isothiocyanate (FITC), allophycocyanin (APC), R-phycoerythrin (PE), peridinin chlorophyll protein (PerCP), Texas Red, Cy3, Cy5, fluorescence resonance energy tandem fluorophores such as PerCPCy5.5, PE- Cy5, PE-Cy5.5, PE-Cy7, PE-Texas Red, and APC-Cy7.
- fluorophores include, inter alia, Alexa Fluor® 350, Alexa Fluor® 488, Alexa 25 Fluor® 532, Alexa Fluor® 546, Alexa Fluor® 568, Alexa Fluor® 594, Alexa Fluor® 647 (monoclonal antibody labeling kits available from Molecular Probes, Inc., Eugene, OR, USA), BODIPY dyes, such as BODIPY 493/503, BODIPY FL, BODIPY R6G, BODIPY 530/550, BODIPY TMR, BODIPY 558/568, BODIPY 558/568, BODIPY 564/570, BODIPY 576/589, BODIPY 581/591, BODIPY TR, BODIPY 630/650, BODIPY 650/665, Cascade Blue, Cascade Yellow, Dansyl, lissamine rhodamine B, Marina Blue, Oregon Green 488, Oregon Green 514, Pacific Blue, rh
- polypeptides can usefully be labeled with biotin.
- Polypeptides can be labeled with radioisotopes, such as 33 P, 32 P, 35 S, 3 H, and 125 I.
- the label when the polypeptide may be used for targeted radiotherapy, can be 3 ⁇ 4, 228 Th, 227 Ac, 225 Ac, 223 Ra, 213 Bi, 212 Pb, 212 Bi, 211 At, 203 Pb, 194 0s, 188 Re, 186 Re, 153 Sm, 149 Tb, 131 I, 125 I, lu In, 105 Rh, "mTc, 97 Ru, 90 Y, 90 Sr, 88 Y, 72 Se, 67 Cu, or 47 Sc.
- isolated can refer to a nucleic acid or polypeptide that is substantially free of cellular material, bacterial material, viral material, or culture medium (when produced by recombinant DNA techniques) of their source of origin, or chemical precursors or other chemicals (when chemically synthesized).
- an isolated polypeptide refers to one that can be administered to a subject as an isolated polypeptide; in other words, the polypeptide may not simply be considered“isolated” if it is adhered to a column or embedded in a gel.
- an“isolated nucleic acid fragment” or“isolated peptide” is a nucleic acid or protein fragment that is not naturally occurring as a fragment and/or is not typically in the functional state.
- amino acid or“residue” should be understood to mean a compound containing an amino group (NIL ⁇ ), a carboxylic acid group (COOH), and any of various side groups, that have the basic formula NH2CHRCOOH, and that link together by peptide bonds to form proteins.
- Amino acids may, for example, be acidic, basic, aromatic, polar or derivatized. Non-standard amino acids may be referred to as“non-canonical” amino acids. Amino acids are naturally found in the a- and L-form, however, b- and D-form amino acids can also be prepared.
- a one-letter abbreviation system is frequently applied to designate the identities of the twenty“canonical” amino acid residues generally incorporated into naturally occurring peptides and proteins, these designations are well known in the art. Such one-letter abbreviations are entirely interchangeable in meaning with three-letter abbreviations, or non- abbreviated amino acid names.
- the canonical amino acids and their three letter and one letter codes include Alanine (Ala) A, Glutamine (Gin) Q, Leucine (Leu) L, Serine (Ser) S, Arginine (Arg) R, Glutamic Acid (Glu) E, Lysine (Lys) K, Threonine (Thr) T, Asparagine (Asn) N, Glycine (Gly) G, Methionine (Met) M, Tryptophan (Trp) W, Aspartic Acid (Asp) D, Histidine (His) H, Phenylalanine (Phe) F, Tyrosine (Tyr) Y, Cysteine (Cys) C, Isoleucine (lie) I, Proline (Pro) P, and Valine (Val) V.
- Alanine (Ala) A Glutamine (Gin) Q, Leucine (Leu) L, Serine (Ser) S, Arginine (Arg) R, Glutamic Acid (
- Certain embodiments also include variants of the polypeptides described herein.
- Variants of the disclosed polypeptides may be generated by making amino acid additions or insertions, amino acid deletions, amino acid substitutions, and/or chemical derivatives of amino acid residues within the polypeptide sequence. Desired amino acid substitutions (whether conservative or non-conservative) can be determined by those skilled in the art in accordance with guidance provided herein for increasing stability, while maintaining or enhancing potency of the polypeptides.
- conservative amino acid substitutions can encompass non-naturally occurring amino acid residues which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems.
- Conservative modifications can produce peptides having functional, physical, and chemical characteristics similar to those of the peptide from which such modifications are made.
- substantial modifications in the functional and/or chemical characteristics of peptides may be accomplished by selecting substitutions in the amino acid sequence that differ significantly in their effect on maintaining (a) the structure of the molecular backbone in the region of the substitution, for example, as an a-helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the size of the molecule.
- a“conservative amino acid substitution” may involve a substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the polarity or charge of the amino acid residue at that position.
- Recombinant DNA- and/or RNA-mediated protein expression and protein engineering techniques, or any other methods of preparing peptides are applicable to the making of the polypeptides disclosed herein or expressing the polypeptides disclosed herein in a target cell or tissue.
- the term“recombinant” should be understood to mean that the material (e.g ., a nucleic acid or a polypeptide) has been artificially or synthetically (i.e., non-naturally) altered by human intervention. The alteration can be performed on the material within, or removed from, its natural environment or state.
- a“recombinant nucleic acid” is one that is made by recombining nucleic acids, e.g., during cloning, DNA shuffling or other well-known molecular biological procedures. Examples of such molecular biological procedures are found in Maniatis et ak, Molecular Cloning. A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 1982.
- A“recombinant DNA molecule,” is comprised of segments of DNA joined together by means of such molecular biological techniques.
- the term“recombinant protein” or“recombinant polypeptide” as used herein refers to a protein molecule which is expressed using a recombinant DNA molecule.
- A“recombinant host cell” is a cell that contains and/or expresses a recombinant nucleic acid.
- the polypeptides can be made in transformed host cells according to methods known to those of skill in the art. Briefly, a recombinant DNA molecule, or construct, coding for the peptide is prepared. Methods of preparing such DNA molecules are well known in the art. For instance, sequences encoding the peptides can be excised from DNA using suitable restriction enzymes. Any of a large number of available and well-known host cells may be used in the practice of various embodiments. The selection of a particular host is dependent upon a number of factors, which include, for example, compatibility with the chosen expression vector, toxicity of the polypeptides encoded by the DNA molecule, rate of transformation, ease of recovery of the polypeptides, expression characteristics, bio-safety, and costs.
- useful microbial host cells in culture include bacteria (such as Escherichia coli sp.), yeast (such as Saccharomyces sp.) and other fungal cells, insect cells, plant cells, mammalian (including human) cells, e.g ., CHO cells and HEK293 cells. Modifications can be made at the DNA level, as well.
- the peptide-encoding DNA sequence may be changed to codons more compatible with the chosen host cell. For E. coli, optimized codons are known in the art.
- Codons can be substituted to eliminate restriction sites or to include silent restriction sites, which may aid in processing of the DNA in the selected host cell.
- the transformed host is cultured and purified. Host cells may be cultured under conventional fermentation conditions so that the desired polypeptides are expressed.
- the DNA optionally further encode, 5' to the coding region of a fusion protein, a signal peptide sequence (e.g, a secretory signal peptide) operably linked to the expressed polypeptide.
- the polypeptides can also be made by synthetic methods.
- Solid phase synthesis can be used as a technique of making individual polypeptides since it is the most cost-effective method of making small peptides.
- well known solid phase synthesis techniques include the use of protecting groups, linkers, and solid phase supports, as well as specific protection and deprotection reaction conditions, linker cleavage conditions, use of scavengers, and other aspects of solid phase peptide synthesis. Suitable techniques are well known in the art. See, e.g, Merrifield, Chem. Polypeptides, Katsoyannis and Panayotis eds., pp. 335-361, 1973; Merrifield, J. Am. Chem. Soc.
- Bodanszky Ed., Springer- Verlag, 1993;“The Practice of Peptide Synthesis, 2nd ed.,” M. Bodanszky and A. Bodanszky, Eds., Springer-Verlag, 1994;“Protecting Groups,” P. J. Kocienski, Ed., Georg Thieme Verlag, Stuttgart, Germany, 1994;“Fmoc Solid Phase Peptide Synthesis, A Practical Approach,” W. C. Chan and P. D. White, Eds., Oxford Press, 2000; G. B. Fields et ak, Synthetic Peptides: A User's Guide, 77-183, 1990.
- a composition that includes a polypeptide covalently linked, attached, or bound, either directly or indirectly through a linker moiety, to another peptide, vehicle (e.g., carrier), or a half-life extending moiety is a“conjugate” or“conjugated” molecule, whether conjugated by chemical means (e.g., post-translationally or post-synthetically) or by recombinant fusion.
- Conjugation of the polypeptides can be via the N-terminus and/or C-terminus of the polypeptide, or can be intercalary as to the peptide's primary amino acid sequence.
- the polypeptides can be coupled to other cytotoxic moieties to promote specific delivery to cancer cells and to enhance the cytotoxicity of the polypeptides described herein.
- a linker can be used to create fusion protein(s) that allow introduction of additional moieties to enhance killing or localization of a polypeptide.
- Specific moieties of interest may include chemotherapeutics, pro-apoptotic factors, targeted therapeutics (e.g, kinase inhibitors, etc.), or other agents that promote killing.
- 1, 2, 3, or 4 polypeptides is/are coupled to or encapsulated in the same or different delivery vehicle, such as a carrier (e.g, a particle), or a liposome.
- a carrier e.g, a particle
- coupling of the polypeptide(s) to the carrier includes one or more covalent and/or non-covalent interactions.
- the carrier is a metallic or polymeric particle.
- the carrier is a liposome.
- the particles can be microscopic or nanoscopic in size. In certain aspects a particle has a diameter of from at least, at most, or about 0.1 pm to at least, at most, or about 10 pm.
- the particle has an average diameter of at least, at most, or about 0.3 pm to at least, at most, or about 5 pm, 0.5 pm to at least, at most, or about 3 pm, or 0.2 pm to at least, at most, or about 2 pm.
- the particle can have an average diameter of at least, at most, or about 0.1 pm, or at least, at most, or about 0.2 pm or at least, at most, or about 0.3 pm or at least, at most, or about 0.4 pm or at least, at most, or about 0.5 pm or at least, at most, or about 1.0 pm or at least, at most, or about 1.5 pm or at least, at most, or about 2.0 pm or at least, at most, or about 2.5 pm or at least, at most, or about 3.0 pm or at least, at most, or about 3.5 pm or at least, at most, or about 4.0 mih or at least, at most, or about 4.5 mih or at least, at most, or about 5.0 mih, including all values and ranges there between.
- the charge of a carrier is selected to impart application-specific benefits (e.g., physiological compatibility, beneficial surface-peptide interactions, etc.).
- a carrier has a net neutral or negative charge (e.g, to reduce non-specific binding to cell surfaces which, in general, bear a net negative charge).
- a carrier is coupled to multiple polypeptides and can have 2, 3, 4, 5, 6, 7, 8, 9, 10 . . . 20 . . . 50 . . . 100, or more copies of a certain polypeptide or combinations of polypeptides exposed on the surface.
- a carrier displays a single type of polypeptide.
- a carrier displays multiple different polypeptides on the surface.
- the terms“packaged”,“encapsulation” and“entrapped,” as used herein, refer to the incorporation or association of a polypeptide in or with a liposome or similar vehicle.
- the polypeptide may be associated with the lipid bilayer or present in the aqueous interior of the liposome, or both.
- the liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol.
- the selection of lipids is generally guided by consideration of, e.g, liposome size and stability of the liposomes in the bloodstream.
- Various types of lipids are used to produce liposomes.
- amphipathic lipids that find use are zwitterionic, acidic, or cationic lipids.
- Examples of zwitterionic amphipathic lipids are phosphatidylcholines, phosphatidylethanolamines, sphingomyelins, etc.
- Examples of acidic amphipathic lipids are phosphatidylglycerols, phosphatidyl serines, phosphatidylinositols, phosphatidic acids, etc.
- Examples of cationic amphipathic lipids are diacyl trimethylammonium propanes, diacyl dimethylammonium propanes, stearylamine, etc.
- Examples of neutral lipids include diglycerides, such as diolein, dipalmitolein, and mixed caprylin-caprin; triglycerides, such as triolein, tripalmitolein, trilinolein, tricaprylin, and trilaurin; and combinations thereof.
- cholesterol or plant sterols are used in some embodiments, e.g., to make multivesicular liposomes.
- a variety of methods are available for preparing liposomes as described in, e.g, Szoka et ah, Ann. Rev. Biophys. Bioeng. 9:467 (1980), U.S. Patents 4,235,871; 4,501,728; and 4,837,028, all of which are incorporated herein by reference.
- One method produces multilamellar vesicles of heterogeneous sizes.
- the vesicle-forming lipids are dissolved in a suitable organic solvent or solvent system and dried under vacuum or an inert gas to form a thin lipid film.
- the lipids may be dissolved in a suitable solvent, such as tertiary butanol, and then lyophilized to form a more homogeneous lipid mixture that is in a more easily hydrated powder-like form.
- a suitable solvent such as tertiary butanol
- This film or powder is covered with an aqueous buffered solution and allowed to hydrate, typically over a 15-60 minute period with agitation.
- the size distribution of the resulting multilamellar vesicles can be shifted toward smaller sizes by hydrating the lipids under more vigorous agitation conditions or by adding solubilizing detergents such as deoxycholate.
- Multilamellar liposomes are formed, e.g ., by agitation of the dispersion, preferably through the use of a thin-film evaporator apparatus or through shaking or vortex mixing.
- Unilamellar vesicles are formed by the application of a shearing force to an aqueous dispersion of the lipid solid phase, e.g. , by sonication or the use of a microfluidizing apparatus such as a homogenizer or a French press.
- Shearing force can also be applied using injection, freezing and thawing, dialyzing away a detergent solution from lipids, or other known methods used to prepare liposomes.
- the size of the liposomes can be controlled using a variety of known techniques including controlling the duration of shearing force.
- “Unilamellar liposomes,” also referred to as“single lamellar vesicles,” are spherical vesicles that include one lipid bilayer membrane that defines a single closed aqueous compartment.
- the bilayer membrane includes two layers (or“leaflets”) of lipids; an inner layer and an outer layer.
- the outer layer of the lipid molecules is oriented with the hydrophilic head portions toward the external aqueous environment and the hydrophobic tails pointed downward toward the interior of the liposome.
- the inner layer of the lipid lay directly beneath the outer layer with the lipids oriented with the heads facing the aqueous interior of the liposome and the tails oriented toward the tails of the outer layer of lipid.
- Multilamellar liposomes also referred to as“multilamellar vesicles” or“multiple lamellar vesicles,” include more than one lipid bilayer membrane, which membranes define more than one closed aqueous compartment. The membranes are concentrically arranged so that the different membranes are separated by aqueous compartments, much like an onion.
- Embodiments are related to compositions including 1, 2, 3, 4, or more anti-cancer peptides, or variants or functional segments thereof with one or more of the following: a pharmaceutically acceptable diluent; a carrier; a solubilizer; an emulsifier; and/or a preservative.
- Such compositions may contain an effective amount of at least one anti-cancer agent or complex.
- the use of one or more anti-cancer agents described herein in the preparation of a pharmaceutical composition of a medicament is also included.
- Such compositions can be used in the treatment of a variety of cancers.
- the anti-cancer agents may be formulated into therapeutic compositions in a variety of dosage forms such as, but not limited to, liquid solutions or suspensions, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and injectable or infusible solutions.
- dosage forms such as, but not limited to, liquid solutions or suspensions, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and injectable or infusible solutions.
- the preferred form depends upon the mode of administration and the particular disease targeted.
- the compositions also preferably include pharmaceutically acceptable vehicles, carriers, or adjuvants, well known in the art.
- compositions may contain components for modifying, maintaining, or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption, or penetration of the composition.
- Suitable materials for formulating pharmaceutical compositions include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as acetate, borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethyl enedi amine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and di
- Formulation components are present in concentrations that are acceptable to the site of administration.
- Buffers are advantageously used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from at least, at most, or about 4.0 to at least, at most, or about 8.5, or alternatively, between at least, at most, or about 5.0 to 8.0, including all values and ranges there between.
- Pharmaceutical compositions can comprise TRIS buffer of at least, at most, or about pH 6.5-8.5, including all values and ranges there between, or acetate buffer of at least, at most, or about pH 4.0-5.5, including all values and ranges there between, which may further include sorbitol or a suitable substitute therefor.
- the pharmaceutical composition to be used for in vivo administration is typically sterile. Sterilization may be accomplished by filtration through sterile filtration membranes. If the composition is lyophilized, sterilization may be conducted either prior to or following lyophilization and reconstitution.
- the composition for parenteral administration may be stored in lyophilized form or in a solution. In certain embodiments, parenteral compositions are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle, or a sterile pre-filled syringe ready to use for injection.
- compositions can be administered using conventional modes of delivery including, but not limited to, intravenous, intraperitoneal, oral, intralymphatic, subcutaneous administration, intraarterial, intramuscular, intrapleural, intrathecal, and by perfusion through a regional catheter.
- Local administration to a tumor (e.g ., intratumorally) in question is also contemplated.
- the administration may be by continuous infusion or by single or multiple boluses.
- the anti metastatic agents may be administered in a pyrogen-free, parenterally acceptable aqueous solution comprising the desired anti-cancer agents in a pharmaceutically acceptable vehicle.
- a particularly suitable vehicle for parenteral injection is sterile distilled water in which one or more anti-cancer agents are formulated as a sterile, isotonic solution, properly preserved.
- the pharmaceutical compositions may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. Such formulations may be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
- stabilizers that are conventionally employed in pharmaceutical compositions, such as sucrose, trehalose, or glycine, may be used. Typically, such stabilizers will be added in minor amounts ranging from, for example, at least, at most, or about 0.1% to at least, at most, or about 0.5% (w/v).
- Surfactant stabilizers such as TWEEN®-20 or TWEEN®-80 (ICI Americas, Inc., Bridgewater, N. J., USA), may also be added in conventional amounts.
- compositions intended for in vivo use are usually sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents.
- compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
- such doses are between at least, at most, or about 0.001 mg/kg and 10 mg/kg body weight, preferably between at least, at most, or about 1 and 5 mg/kg body weight, most preferably between 0.5 and 1 mg/kg body weight, including all values and ranges there between.
- Therapeutically effective doses will be easily determined by one of skill in the art and will depend on the severity and course of the disease, the patient’s health and response to treatment, the patient’s age, weight, height, sex, previous medical history and the judgment of the treating physician.
- the cancer cell is a tumor cell.
- the cancer cell may be in a patient.
- the patient may have a solid tumor.
- embodiments may further involve performing surgery on the patient, such as by resecting all or part of the tumor.
- Compositions may be administered to the patient before, after, or at the same time as surgery.
- patients may also be administered directly, endoscopically, intratracheally, intratumorally, intravenously, intralesionally, intramuscularly, intraperitoneally, regionally, percutaneously, topically, intrarterially, intravesically, or subcutaneously.
- compositions may be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more times, and they may be administered every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, or 1, 2, 3, 4, 5, 6, 7 days, or 1, 2, 3, 4, 5 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months.
- the method may further comprise administering to subject a second cancer therapy selected from chemotherapy, radiotherapy, immunotherapy, hormonal therapy, or gene therapy.
- the method may further comprise administering 1, 2, 3, 4, or all 5 polypeptides or variants thereof to the subject more than once.
- a second cancer therapy can be the administration of an ELANE, or similar protease in combination with the anti-cancer peptides described herein.
- Methods of treating cancer may further include administering to the patient chemotherapy or radiotherapy, which may be administered more than one time.
- Chemotherapy includes, but is not limited to, cisplatin (CDDP), carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, ifosfamide, melphalan, chlorambucil, bisulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide (VP 16), tamoxifen, taxotere, taxol, transplatinum, 5-fluorouracil, methotrexate, gemcitabine, oxaliplatin, irinotecan, topotecan, or any analog or derivative variant thereof.
- CDDP cisplatin
- carboplatin carboplatin
- procarbazine mechlorethamine
- Radiation therapy includes, but is not limited to, X-ray irradiation, UV-irradiation, g-irradiation, electron-beam radiation, or microwaves.
- a cell or a patient may be administered a microtubule stabilizing agent, including, but not limited to, taxane, as part of methods. It is specifically contemplated that any of the compounds or derivatives or analogs, can be used with these combination therapies.
- anti-angiogenic agents include anti-angiogenic agents.
- anti-angiogenic agents include TNP-470, platelet factor 4, thrombospondin- 1, tissue inhibitors of metalloproteases (TEMPI and TEMP2), prolactin (16- Kd fragment), angiostatin (38-Kd fragment of plasminogen), endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, soluble KDR and FLT-1 receptors, placental proliferin-related protein, as well as those listed by Carmeliet and Jain (2000).
- the inhibitors can be used in combination with a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of VEGFR tyrosine kinases and any combinations thereof (e.g, anti- hVEGF antibody A4.6.1, bevacizumab or ranibizumab).
- a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of VEGFR tyrosine kinases and any combinations thereof (e.g, anti- hVEGF antibody A4.6.1, bevacizumab or ranibizumab).
- Immunotherapy or biological response modifier therapy can be used in combination with the therapies described herein. These treatments use the immune system to fight disease. Immunotherapy can help the immune system recognize cancer cells, or enhance a response against cancer cells. Immunotherapies include active and passive immunotherapies. Active immunotherapies stimulate the body’s own immune system while passive immunotherapies generally use immune system components created outside of the body.
- active immunotherapies include, but are not limited to vaccines including cancer vaccines, tumor cell vaccines (autologous or allogeneic), viral vaccines, dendritic cell vaccines, antigen vaccines, anti-idiotype vaccines, DNA vaccines, or Tumor- Infiltrating Lymphocyte (TIL) Vaccine with Interleukin-2 (IL-2) or Lymphokine-Activated Killer (LAK) Cell Therapy.
- vaccines including cancer vaccines, tumor cell vaccines (autologous or allogeneic), viral vaccines, dendritic cell vaccines, antigen vaccines, anti-idiotype vaccines, DNA vaccines, or Tumor- Infiltrating Lymphocyte (TIL) Vaccine with Interleukin-2 (IL-2) or Lymphokine-Activated Killer (LAK) Cell Therapy.
- TIL Tumor- Infiltrating Lymphocyte
- IL-2 Interleukin-2
- LAK Lymphokine-Activated Killer
- Examples of passive immunotherapies include but are not limited to monoclonal antibodies and targeted therapies containing toxins.
- Monoclonal antibodies include naked antibodies and conjugated antibodies (also called tagged, labeled, or loaded antibodies). Naked monoclonal antibodies do not have a drug or radioactive material attached whereas conjugated monoclonal antibodies are joined to, for example, a chemotherapy drug (chemolabeled), a radioactive particle (radiolabeled), or a toxin (immunotoxin).
- passive immunotherapies such as, naked monoclonal antibody drugs can be used in combination with the polypeptide compositions described herein to treat cancer.
- these naked monoclonal antibody drugs include, but are not limited to Rituximab (Rittman), an antibody against the CD20 antigen used to treat, for example, B cell non-Hodgkin lymphoma; Trastuzumab (Herceptin), an antibody against the HER2 protein used to treat, for example, advanced breast cancer; Alemtuzumab (Campath), an antibody against the CD52 antigen used to treat, for example, B cell chronic lymphocytic leukemia (B- CLL); Cetuximab (Erbitux), an antibody against the EGFR protein used, for example, in combination with irinotecan to treat, for example, advanced colorectal cancer and head and neck cancers; and Bevacizumab (Avastin) which is an anti-angiogenesis therapy that works against the VEGF protein and
- HERCEPTIN® Trastuzumab
- Genentech, CA which is a humanized anti-HER2 monoclonal antibody for the treatment of patients with metastatic breast cancer
- REOPRO® abciximab
- Ceentocor which is an anti-glycoprotein Ilb/IIIa receptor on the platelets for the prevention of clot formation
- ZENAPAX® (daclizumab) (Roche Pharmaceuticals, Switzerland) which is an immunosuppressive, humanized anti-CD25 monoclonal antibody for the prevention of acute renal allograft rejection
- PANOREXTM which is a murine anti-17-IA cell surface antigen IgG2a antibody (Glaxo Wellcome/Centocor)
- BEC2 which is a murine anti-idiotype (GD3 epitope) IgG antibody (ImClone System)
- IMC-C225 which is a chimeric anti-EGFR IgG antibody
- passive immunotherapies such as, conjugated monoclonal antibodies can be used in combination with the polypeptide compositions described herein to treat cancer.
- conjugated monoclonal antibodies include, but are not limited to radiolabeled antibody Ibritumomab tiuxetan (Zevalin) which delivers radioactivity directly to cancerous B lymphocytes and is used to treat, for example, B cell non-Hodgkin lymphoma; radiolabeled antibody Tositumomab (Bexxar) which is used to treat, for example, certain types of non-Hodgkin lymphoma; and immunotoxin Gemtuzumab ozogamicin (Mylotarg) which contains calicheamicin and is used to treat, for example, acute myelogenous leukemia (AML).
- AML acute myelogenous leukemia
- BL22 is a conjugated monoclonal antibody for treating, for example, hairy cell leukemia, immunotoxins for treating, for example, leukemias, lymphomas, and brain tumors, and radiolabeled antibodies such as OncoScint for example, for colorectal and ovarian cancers and ProstaScint for example, for prostate cancers.
- targeted therapies containing toxins can be used in combination with the polypeptide compositions described herein to treat cancer.
- Targeted therapies containing toxins are toxins linked to growth factors, or in particular embodiments the polypeptides described herein, and do not contain antibodies
- Some embodiments also include the use of adjuvant immunotherapies in combination with the polypeptide compositions described herein, such adjuvant immunotherapies include, but are not limited to, cytokines, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), granulocyte-colony stimulating factor (G-CSF), macrophage inflammatory protein (MIP)-l -alpha, interleukins (including IL-1, IL-2, IL-4, IL- 6, IL-7, IL-12, IL-15, IL-18, IL-21, and IL-27), tumor necrosis factors (including TNF-alpha), and interferons (including IFN-alpha, IFN-beta, and IFN-gamma); aluminum hydroxide (alum); Bacille Calmette-Guerin (BCG); Keyhole limpet hemocyanin (KLH); Incomplete Freund’s adjuvant (IFA); QS-21; DETOX; Levamitriptact
- Anti-hormonal agents include, but are not limited to agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX® tamoxifen), raloxifene, droloxifene, 4- hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTON toremifene; aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® megestrol acetate, AROMASIN® exemestane, formestanie, fadrozole, RIVISOR® vorozole
- SERMs selective estrogen receptor modulators
- the cancer that is administered the composition(s) described herein may be a bladder, blood, bone, bone marrow, brain, breast, colorectal, esophagus, gastrointestine, head, kidney, liver, lung, nasopharynx, neck, ovary, pancreas, prostate, skin, stomach, testicular, tongue, or uterus cell.
- nucleic acids encoding any polypeptide(s) can be inserted into or employed with any suitable expression system.
- Recombinant expression can be accomplished using a vector, such as a plasmid, virus, etc.
- the vector can include a promoter operably linked to nucleic acid encoding one or more polypeptides.
- the vector can also include other elements required for transcription and translation.
- vector refers to any carrier containing exogenous DNA.
- vectors are agents that transport the exogenous nucleic acid into a cell without degradation and include a promoter yielding expression of the nucleic acid in the cells into which it is delivered.
- Vectors include but are not limited to plasmids, viral nucleic acids, viruses, phage nucleic acids, phages, cosmids, and artificial chromosomes.
- a variety of prokaryotic and eukaryotic expression vectors suitable for carrying, encoding and/or expressing nucleic acids encoding proteases can be produced.
- Such expression vectors include, for example, pET, pET3d, pCR2.1, pBAD, pUC, and yeast vectors.
- the vectors can be used, for example, in a variety of in vivo and in vitro situations.
- the vector may be a gene therapy vector, for example an adenovirus vector, a lentivirus vector or a CRISP- R vector.
- the expression cassette, expression vector, and sequences in the cassette or vector can be heterologous.
- heterologous when used in reference to an expression cassette, expression vector, regulatory sequence, promoter, or nucleic acid refers to an expression cassette, expression vector, regulatory sequence, or nucleic acid that has been manipulated in some way.
- a heterologous promoter can be a promoter that is not naturally linked to a nucleic acid to be expressed, or that has been introduced into cells by cell transformation procedures.
- a heterologous nucleic acid or promoter also includes a nucleic acid or promoter that is native to an organism but that has been altered in some way (e.g., placed in a different chromosomal location, mutated, added in multiple copies, linked to a non native promoter or enhancer sequence, etc.).
- Heterologous nucleic acids may comprise sequences that comprise cDNA.
- Heterologous coding regions can be distinguished from endogenous coding regions, for example, when the heterologous coding regions are joined to nucleotide sequences comprising regulatory elements such as promoters that are not found naturally associated with the coding region, or when the heterologous coding regions are associated with portions of a chromosome not found in nature (e.g ., genes expressed in loci where the protein encoded by the coding region is not normally expressed).
- heterologous promoters can be promoters that are linked to a coding region to which they are not linked in nature.
- Viral vectors that can be employed include those relating to lentivirus, adenovirus, adeno-associated virus, herpes virus, vaccinia virus, polio virus, AIDS virus, neuronal trophic virus, Sindbis and other viruses. Also useful are any viral families which share the properties of these viruses which make them suitable for use as vectors. Retroviral vectors that can be employed include those described in by Verma, I. M., Retroviral vectors for gene transfer. In Microbiology- 1985, American Society for Microbiology, pp. 229-232, Washington, (1985). For example, such retroviral vectors can include Murine Maloney Leukemia virus, MMLV, and other retroviruses that express desirable properties.
- viral vectors typically contain, nonstructural early genes, structural late genes, an RNA polymerase III transcript, inverted terminal repeats necessary for replication and encapsidation, and promoters to control the transcription and replication of the viral genome.
- viruses typically have one or more of the early genes removed and a gene or gene/promoter cassette is inserted into the viral genome in place of the removed viral nucleic acid.
- a variety of regulatory elements can be included in the expression cassettes and/or expression vectors, including promoters, enhancers, translational initiation sequences, transcription termination sequences and other elements.
- A“promoter” is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription start site.
- the promoter can be upstream of the nucleic acid segment encoding a protease.
- A“promoter” contains core elements required for basic interaction of RNA polymerase and transcription factors and can contain upstream elements and response elements.
- “Enhancer” generally refers to a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5' or 3' to the transcription unit.
- enhancers can be within an intron as well as within the coding sequence itself. They are usually between 10 and 300 nucleotides in length, and they function in cis. Enhancers function to increase transcription from nearby promoters. Enhancers, like promoters, also often contain response elements that mediate the regulation of transcription. Enhancers often determine the regulation of expression.
- Expression vectors used in eukaryotic host cells can also contain sequences necessary for the termination of transcription which can affect mRNA expression. These regions are transcribed as polyadenylated segments in the untranslated portion of the mRNA encoding tissue factor protein. The 3' untranslated regions also include transcription termination sites. It is preferred that the transcription unit also contains a polyadenylation region. One benefit of this region is that it increases the likelihood that the transcribed unit will be processed and transported like mRNA.
- the identification and use of polyadenylation signals in expression constructs is well established. It is preferred that homologous polyadenylation signals be used in the expression constructs.
- the expression of one or more protease from an expression cassette or expression vector can be controlled by any promoter capable of expression in prokaryotic cells or eukaryotic cells.
- prokaryotic promoters include, but are not limited to, SP6, T7, T5, tac, bla, trp, gal, lac, or maltose promoters.
- eukaryotic promoters include, but are not limited to, constitutive promoters, e.g ., viral promoters such as CMV, SV40 and RSV promoters, as well as regulatable promoters, e.g.
- an inducible or repressible promoter such as the tet promoter, the hsp70 promoter and a synthetic promoter regulated by CRE.
- Vectors for bacterial expression include pGEX-5X-3, and for eukaryotic expression include pCIneo-CMV.
- the expression cassette or vector can include nucleic acid sequence encoding a marker product.
- This marker product is used to determine if the gene has been delivered to the cell and once delivered is being expressed.
- Preferred marker genes are the E. coli lacZ gene which encodes b-galactosidase and green fluorescent protein.
- the marker can be a selectable marker. When such selectable markers are successfully transferred into a host cell, the transformed host cell can survive if placed under selective pressure. There are two widely used distinct categories of selective regimes. The first category is based on a cell's metabolism and the use of a mutant cell line which lacks the ability to grow independent of a supplemented media.
- the second category is dominant selection which refers to a selection scheme used in any cell type and does not require the use of a mutant cell line. These schemes typically use a drug to arrest growth of a host cell. Those cells which have a novel gene would express a protein conveying drug resistance and would survive the selection. Examples of such dominant selection use the drugs neomycin (Southern P. and Berg, P., J. Molec. Appl. Genet. 1 : 327 (1982)), mycophenolic acid, (Mulligan, R. C. and Berg, P. Science 209: 1422 (1980)) or hygromycin, (Sugden, B. et al., Mol. Cell. Biol. 5: 410-413 (1985)).
- Gene transfer can be obtained using direct transfer of genetic material, in but not limited to, plasmids, viral vectors, viral nucleic acids, phage nucleic acids, phages, cosmids, and artificial chromosomes, or via transfer of genetic material in cells or carriers such as cationic liposomes or viruses.
- Transfer vectors can be any nucleotide construction used to deliver genes into cells (e.g. , a plasmid), or as part of a general strategy to deliver genes, e.g. , as part of recombinant retrovirus or adenovirus (Ram et al. Cancer Res.
- the nucleic acid molecule, expression cassette and/or vector encoding a protease can be introduced to a cell by any method including, but not limited to, calcium- mediated transformation, electroporation, microinjection, lipofection, particle bombardment and the like.
- the cells can be expanded in culture and then administered to a subject, e.g, a mammal such as a human.
- the amount or number of cells administered can vary but amounts in the range of about 10 6 to about 10 9 cells can be used.
- the cells are generally delivered in a physiological solution such as saline or buffered saline.
- the cells can also be delivered in a vehicle such as a population of liposomes, exosomes or microvesicles.
- the protease can be produced by a transgenic cell that produces exosomes or microvesicles that contain the protease.
- Exosomes and microvesicles mediate the secretion of a wide variety of proteins, lipids, mRNAs, and micro RNAs, interact with neighboring cells, and can thereby transmit signals, proteins, lipids, and nucleic acids from cell to cell (see, e.g., Shen et al., JBiol Chem. 286(16): 14383-14395 (2011); Hu et al., Frontiers in Genetics 3 (April 2012); Pegtel et al., Proc.
- transgenic cells with a heterologous expression cassette or expression vector that expresses one or more protease can be administered to a subject and the exosomes produced by the transgenic cells deliver the protease to a tumor and/or cancer cells in the subject.
- the present disclosure relates to methods to derive vectors, particularly plasmids, cosmids, viruses and bacteriophages used conventionally in genetic engineering and in gene therapy that comprise a nucleic acid molecule encoding the polypeptide sequence of a protease defined herein.
- the vector is an expression vector and/or a gene transfer or targeting vector.
- Expression vectors derived from viruses such as retroviruses, vaccinia virus, adeno-associated virus, herpes viruses, or bovine papilloma virus, may be used for delivery of the recited polynucleotides or vector into targeted cell populations.
- nucleic acid molecules and vectors can be reconstituted into liposomes for delivery to target cells.
- the vectors containing the nucleic acid molecules of the disclosure can be transferred into the host cell by well-known methods, which vary depending on the type of cellular host.
- Gene therapy vectors are known in the art and include, but are not limited to, lentiviral vectors, adenoviral vectors, adeno-associated viral vectors, plasmids and the like. Construction of a gene therapy vector of the invention can be done by methods known in the art.
- a gene therapy vector can be administered in an amount of about, at most, or at least 10, 100, 1000, lxlO 4 , lxlO 5 , lxlO 6 , lxlO 7 , lxlO 8 , lxlO 9 , lxlO 10 , lxlO 11 , lxlO 12 viral particles (VP) or colony forming units (CFU), including all values and ranges there between.
- VP viral particles
- CFU colony forming units
- an expression cassette can be included in a lentiviral vector.
- the therapeutic vector can be transduced into cells ex vivo and the cells are delivered to the patient.
- a therapeutic vector of the invention can be delivered directly to the patient.
- PMNs Human peripheral polymorphonuclear neutrophils
- ⁇ 8h Human peripheral polymorphonuclear neutrophils
- apoptosis To determine if apoptotic neutrophils also release factors that kill cancer cells, 35 different human/murine cancer cells were treated with serum-free media conditioned by purified PMNs cycled to apoptosis (PMN media).
- PMN media effectively killed all cancer cell lines tested within 24h.
- PMN media did not kill any of the 6 human/mouse normal or non-cancer cells tested.
- Conditioned media from omental neutrophils (ONs) isolated from healthy subjects also selectively killed cancer cells.
- murine neutrophils from a variety of sources and activation states lacked this cancer cell killing capability.
- mice were injected with a variety of cancer cells in syngeneic models (E0771, LLC1, B16F10) and a PDX model of triple-negative breast cancer (TNBC, 4195) to create tumors of -100 mm 3 in size. Because serum antagonized the cancer killing capability of PMN media in vitro , PMN media was delivered intra-tumorally (IT). Tumors were injected daily with human serum albumin (HSA) or PMN media once/day for 5 days, and apoptosis was examined by TUNEL, cleaved PARP (cPARP), and cleaved CASP3 (cCASP3) staining. PMN media attenuated tumor growth and induced cancer cell apoptosis in every model tested.
- HSA human serum albumin
- cPARP cleaved PARP
- cCASP3 cleaved CASP3
- ELANE is the major anti-cancer protein released by human PMNs. Findings suggest that PMNs release factor(s) that selectively kill a wide range of cancer cells in vitro and in vivo. To identify the factor(s) responsible, a quantitative cancer cell killing assay was developed to track the bioactive factor(s), and used boiling, dialysis, and centricon experiments to justify searching for a protein. Next, studies were performed to purify the protein(s) responsible. PMN media was prepared for fractionation by clarifying it through a 0 22pm filter. Surprisingly, this step eliminated the cancer killing activity of PMN media from 2 independent donors without lowering total protein levels, suggesting a selective depletion of the bioactive protein(s).
- ELANE neutrophil elastase
- ECP eosinophil cationic protein
- ELANE and/or ECP were responsible for the selective cancer killing activity of PMN media.
- ELANE or ECP was immune- depleted from PMN media and found that depleting either protein attenuated the ability of PMN media to kill MDA-MB-231 cells.
- cancer cells or normal or non-cancer cells were treated with purified ELANE or ECP and cell viability was monitored.
- ELANE killed MDA- MB-231 cells in a dose-dependent manner, and this effect was selective since it did not kill Human monocyte-derived macrophages (HMDMs).
- HMDMs Human monocyte-derived macrophages
- ECP killed MDA-MB-231 cells only at doses that were also toxic to HMDMs.
- MDA-MB-231 cells were treated with concentrations of ELANE (0.25 pg/mL) and ECP (0.05 pg/mL) that were present in PMN media. Although PMN media levels of ECP could not kill these cells alone, they significantly enhanced the selective killing capability of ELANE, suggesting a synergy between these two proteins.
- ELANE influences biological pathways by proteolysis (Pham, Nat Rev Immunol ., 2006) it was hypothesized that its anti-cancer function may require catalytic activity, and that ECP might enhance this activity to support synergistic killing.
- ELANE was treated with PMSF or alpha- 1 -anti -trypsin (A1AT), inactivation was confirmed with a chromogenic substrate activity assay, and it was found that catalytically inactive ELANE could no longer kill cancer cells.
- PMSF or A1AT treatment also eliminated the ability of PMN media to kill cancer cells in vitro and in vivo.
- ECP could enhance ELANE’ s catalytic activity.
- KD 17nM
- k cat catalytic turnover
- ECP has a high affinity for biological membranes (Young et ah, Nature , 1986), these findings may help to explain why filtration through a 0.22pm filter selectively depleted ECP (and ELANE by association) from PMN media.
- ELANE was the focus because it is both efficacious and safe in vitro , and ECP’s ability to enhance its catalytic activity could be mimicked by raising the concentration of ELANE.
- ELANE 3 mg/ml
- ELANE selectively kills cancer cells by cleaving CD95. How does ELANE selectively kill cancer cells? Studies focused on the CD95 pathway because it is essential for the survival of a wide range of cancer cells, but largely dispensable for normal or non-cancer cell survival (Chen et ah, Nature, 2010), unique properties that mirrored ELANE’ s broad anti cancer and low toxicity profile. Moreover, CD95 function can be modulated by proteolysis (Strand et ah, Oncogene , 2004).
- ELANE treatment (/) suppressed at least one survival pathway (phosphorylation (p) of ERK, NFKB, or JNK), (//) induced DNA damage (gH2AC), (in) increased MT ROS, and (iv) activated pro-apoptotic pathways (cCASP3 and cPARP) in all 6 cancer cell lines tested (FIG. la). Consistent with its lack of toxicity to normal or non-cancer cells, ELANE did not induce this program in all normal or non-cancer cells tested (FIG. la).
- CD95 is a plasma membrane protein and its C-terminal domain is intracellular, it was reasoned that ELANE internalization should be required for its anti-cancer function. Indeed, cancer cells rapidly internalized fluorescein-labeled ELANE, and internalized ELANE retained its catalytic activity (FIG. li-lj). Treatment with the endocytosis inhibitor Dynasore attenuated ELANE uptake and protected cancer cells from apoptosis (FIG. lj). Dynasore also protected cancer cells from PMN media-mediated killing. Moreover, overexpressing a C-terminal domain of CD95 containing both cleavage sites (aa.
- C-terminal hCD95 proteins that mimicked ELANE cleavage at site 1 (aa. 221-335 of SEQ ID NO: 1), site 2 (aa. 212-331 of SEQ ID NO: 1), or both sites (aa. 221-331 of SEQ ID NO: 1) were overexpressed and found that expressing any of these proteins induced cancer cell death in the absence of ELANE (FIG. Ik).
- FIG. Ik over expressing these same C-terminal hCD95 proteins in MCF10A cells or human omental adipose tissue fibroblasts from healthy subjects did not induce toxicity (FIG. Ik).
- IT-delivered ELANE attenuates tumorigenesis. Having shown that ELANE selectively kills cancer cells in vitro , it was investigated whether IT-delivered ELANE could attenuate tumor progression in vivo. To establish treatment conditions, various doses of ELANE were injected in an E0771 TNBC model and found that 12 pg/day gave a good therapeutic benefit that was reproducible. It was confirmed that inactivating ELANE with PMSF eliminated this therapeutic benefit, and that PMSF-ELANE did not produce unexpected worsening. Finally, it was shown that injecting ELANE (12 mg/day) into mammary fat pads of non-tumor-bearing C57BL6 mice did not produce evident side effects.
- ELANE the therapeutic potential of ELANE was explored in models of TNBC, lung cancer, and melanoma.
- Athymic nude mice were injected with MDA-MB-231, A549, or MEL888 cells (xenograft models); SCID mice with Ml or 4195 tumors (TNBC PDX models), and C57BL/6 mice with E0771, LLC1, or B 16F10 cells (syngeneic models) to create tumors of -100 mm 3 size.
- PMSF-ELANE or ELANE (12 pg/day) were injected IT and effects on tumor growth were monitored.
- ELANE attenuated tumor growth in all models tested. Immunohistochemistry showed an increase in staining for TUNEL, cPARP, and cCASP3 in all ELANE-treated tumors, suggesting that ELANE induced cancer cell apoptosis in vivo. In sharp contrast, no evidence of apoptosis was found when ELANE was injected into tumor-free C57BL/6 mice. These findings are consistent with the in vitro mechanistic work, suggesting that the anti -tumor action of ELANE is both on-target and safe.
- ELANE induces CD8+ T cells to attack distant tumors.
- ELANE increased the number of dendritic cells (DCs), CD8 + T cells, and CD8 + T effector cells (CD8 + T eff ) in all three immunocompetent models tested. Immune cell increases were not observed if ELANE was injected into mammary fat pads of tumor-free mice, nor were they observed if ELANE was inj ected into the contralateral site (/. e. , opposite the tumor) of tumor-bearing mice, where it failed to attenuate tumorigenesis. Thus, ELANE increased innate and adaptive immune cells in tumors, and this effect was not due to an immune reaction to human ELANE.
- DCs dendritic cells
- CD8 + T cells CD8 + T effector cells
- ELANE therapy produced a “crater” in -40% of tumors in all immunocompetent models tested. Craters were not observed in tumor-free mice, nor were they observed in any immunocompromised cancer model, including C57BL/6 mice where CD8 + T cells were depleted. These data suggest that ELANE-mediated cancer cell killing and the subsequent adaptive immune response, combine to create a“crater” in the tumor. However, mechanisms underlying crater development and its importance for therapeutic efficacy require further investigation.
- FIG. 3 illustrates effects Cl -2 expression on survival, stress, and apoptosis pathways in cancer (e.g., MDA-MB-231, MEL888, and A549) and non-cancer cells (MCF10A and Fibroblasts).
- FIG. 4 illustrates a scheme of doxycycline inducible Tet-on system to express either C (aa. 157-335) or Cl-2 (aa. 221-331).
- Cl -2 DD containing fragment
- Cl- 2 expression can selectively kill cancer cells (FIG. 5A-5C).
- In vitro testing confirms Cl-2 induction of cell death in MDA-MB-231 cells (FIG. 6A-6C).
- In vivo testing demonstrates Cl- 2 induced MDA-MB-231 tumor regression (FIG. 7A-7C).
- the ovarian cancer cell lines - CAOV3, OVCAR3, OVCAR4, OVCAR5, A2780, A2780/CP70, HeyA8, TykNu, SKOV3, ID8, and ID8p53-/- were a gift from Dr. Ernst Lengyel, University of Chicago.
- the breast cancer cell lines - MDA-MB-231, MDA-MB- 231.BM1, MCF-7, M6C, E0771, and E0771.LMB were a gift from Dr. Marsha Rosner, University of Chicago.
- the colon carcinoma cell line RKO, glioblastoma cancer cell line T98G, osteosarcoma cell lines U-20S and Saos-2, and the hepatocellular carcinoma cell line HepG2 were a gift from Dr. Kay McLeod, University of Chicago.
- the lung cancer cell line NCI-H552 was a gift from Dr. Stephanie Huang, University of Chicago, and A549 and LLC1 cells were purchased from ATTC.
- the melanoma cell lines - B16F10, Mel888, Mell 106, and SK-MEL- 28 cells were a gift from Dr. Thomas Gajewski, University of Chicago.
- the pancreatic cancer cell line PANC1 was a gift from Dr. Yamuna Krishnan, University of Chicago.
- the leukemia cell line K562 was a gift from Dr. Amittha Wickrema, University of Chicago. Cells were cultured in Dubecco’s Modified Eagles Medium (DMEM; HyClone) containing 10% heat- inactivated FBS (Gemini Bio Products) and 1% penicillin/streptomycin (Gibco).
- DMEM Modified Eagles Medium
- FBS heat- inactivated FBS
- penicillin/streptomycin Gibco
- the prostate cancer cell lines - CWR22Rvl, LAPC4, and LNCaP were a gift from Dr. Donald Vander Griend, University of Chicago.
- the neuroblastoma cell lines - SK-N-BE(2) and NBL-WN cells were a gift from Dr. Lucy Godley, University of Chicago.
- Cells were cultured in RPMI 1640 media (Hyclone) containing 10% heat-inactivated FBS (Gemini Bio Products) and 1% penicillin/streptomycin (Gibco).
- the mammary gland epithelial cell line MCF10A was a gift from Dr. Marsha Rosner, University of Chicago. Cells were cultured in DMEM (HyClone) containing 10% heat- inactivated FBS (Gemini Bio Products), 20 ng/mL EGF (Peprotech), 0.5 mg/ml hydrocortisone (Sigma), 100 ng/mL cholera toxin (Sigma), 10pg/mL insulin (Sigma), 1% penicillin/streptomycin (Gibco).
- HMDMs - Monocytes were purified from the buffy coat using CD 14 microbeads (MiltenylBiotec), and differentiated into HMDMs using human M-CSF (125 ng/mL, R&D Systems) as previously described (Kratz et al., CellMetab., 2014).
- Human Lymphocytes - Human lymphocytes were isolated from the buffy coat by collecting the flow through from CD14 and CD16 microbeads (Miltenyi Biotec). The resulting cell population was compromised of -90% T cells and -10% B cells.
- Human omental fibroblasts Human primary fibroblasts were isolated from omental adipose tissue and cultured in DMEM (HyClone) containing 20% heat-inactivated FBS (Gemini Bio Products) and 1% penicillin/streptomycin (Gibco) as previously described (Kenny at al., Int J Cancer , 2007).
- BMDMs Murine bone marrow-derived macrophages
- BMDMs Murine bone marrow-derived macrophages
- Mouse splenocytes Mouse splenocytes were isolated from as previously described (Reardon et al., Cell Rep, 2018). Resulting cells were comprised of -5% neutrophils, -2% monocytes, - 38% T cells, -53% B cells.
- Mouse primary keratinocytes Mouse primary keratinocytes were isolated and cultured in E low Calcein media containing 15% heat-inactivated FBS and 1% penicillin/streptomycin as previously described (Wu et al., Cell, 2008).
- Murine bone marrow-derived neutrophils (BMDNs) - BMDNs were purified using Histopaque 1119 (Sigma) and Histopaque 10771 (Sigma) density gradient centrifugation as previously described (Swamydas et al., Curr Protoc Immunol., 2015).
- PMA activation BMDNs were treated with PMA (100 nM, Abeam) for 15 min, washed, and cultured for conditioned media collection.
- Murine thioglycolate-elicited peritoneal neutrophils (PNs) - PNs were isolated from the peritoneal cavity 7 h after 4% thioglycolate injection (3 mL/mouse, Sigma) as previously described (Swamydas et al., Curr Protoc Immunol., 2015).
- Murine tumor-associated neutrophils (TANs) - E0771 cells were injected into the mammary fat pad of C57BL/6 mice.
- tumors were digested with Type 4 Collagenase (Worthington, 3 mg/mL) and hyaluronidases (Sigma, 1.5 mg/mL) at 37 °C with shaking at 200 rpm for 45 min.
- TANs were purified with the Ly6G Microbeads (Miltenyi Biotec) according to the manufacturer’s protocol.
- Murine lung neutrophils (LNs) - Murine LNs were isolated from 8-9-week-old MMTV-PyMT mice, a time point prior to metastatic dissemination.
- Lungs were digested with Liberase TL (Roche, 200 pg/mL) and DNase I (Sigma, 0.1 mg/mL) as previously described (Swamydas et ah, Curr Protoc Immunol ., 2015).
- Murine LNs were purified with Ly6G Microbeads (Miltenyi Biotec) according to the manufacturer’s protocol.
- Neutrophil media collections Freshly isolated human or murine neutrophils were plated in serum-free DMEM for 24 h. Conditioned media was collected, spun at 500 x g for 5 min, and media protein levels were determined with a Bradford assay (Biorad).
- PMN media manipulations For boiling, PMN media was boiled at 95 °C for 5 min and spun at 15,000 x g for 10 min to remove precipitated proteins. For dialysis, PMN media was placed into a Slide-a-LyzerTM cassette (3.5 kDa cutoff, ThermoFisher Scientific) and dialyzed against 2 x 4L of PBS at 4 °C for 4 h.
- PMSF-inactivation PMN media was treated with PMSF (1 mM, Sigma) or A1 AT (42 nM, Athens Research & Technology) and incubated at room temperature for up to 2 h. Residual PMSF was eliminated with a PD- 10 desalting column (GE Healthcare Life).
- ELANE catalytic activity was confirmed using a chromogenic substrate activity assay (see below).
- human, mouse, or fetal bovine serum 1% or 10% was added to PMN media prior to or after exposing cancer cells.
- ELANE or ECP were immunoprecipitated using anti-ELANE (N2C3, GeneTx) or anti-ECP (MBS2535165, MyBioSource) coupled to PierceTM Protein A/G Magnetic Beads (ThermoFisher Scientific).
- CASP3 activity assay Cell-associated CASP3 activity was measured 6 h after treatment using the Caspase-Glo® 3/7 Assay Systems (Promega). Luminescence was measured using a Victor X3 luminometer (PerkinElmer). ANXA5 staining - 30 min - 6 h after treatment, cells were stained with the FITC Annexin V Apoptosis Detection Kit (BD PharmingenTM) according to the manufacturer’s protocol. Samples were analyzed using a FACSCantoTM II flow cytometer (BD PharmingenTM).
- Antibodies - Antibodies against pERK (4370), ERK (4695), pNFxB (3033), NFKB (8242), pJNK (4668), JNK (9252), CASP3 (9662), PARP (9542), H2AX (2595), TUBB (2125) were from Cell Signaling Technology.
- CD95 overexpression studies Polycistronic adenoviral vectors were prepared to express the human and mouse CD95 sequences followed by the Encephalomyocarditis virus (EMCV) internal ribosome entry site and dTomato sequence under the control of the cytomegalovirus (CMV) promoter (VectorBuilder).
- EMCV Encephalomyocarditis virus
- CMV cytomegalovirus
- Human and murine cancer cells or normal or non-cancer cells were transduced to over-express full-length CD95, N-terminal CD95 (human: aa 1-209; mouse: aa 1-204), C-terminal CD95 (human: aa 212-335; mouse: aa 204- 327), or C-terminal CD95 that mimicked ELANE cleavage at site 1 (human: aa 221-335), site 2 (human: aa 212-331), or both sites (aa 221-331).
- Cancer cells or normal or non-cancer cells were transduced with adenoviruses at an MOI of 50-250 depending on cell type, and expression of dTomato and CD95 (human: 558814; mouse, mouse: 565130, BD Biosciences) were confirmed by flow cytometry.
- a vector encoding GFP Vector Builders was used as a control.
- ELANE activity assays Catalytic activity was measured using the chromogenic substrate N-Methoxysuccinyl-Ala-Ala-Pro-Val p-nitroanilide (Sigma, 100 pg/mL) according to manufacturer’s protocol. Absorbance was measured at 405 nm using an accuSkan GO UV/Vis microplate spectrophotometer (ThermoFisher Scientific). For inactivation, ELANE was incubated with PMSF (1 mM, Sigma) or A1 AT (42 nM, Athens Research & Technology) for 2 h. Residual PMSF was eliminated with a PD- 10 desalting column (GE Healthcare Life). To monitor the effect of ECP on ELANE activity, ELANE (10 nM) was incubated with various doses of ECP (0-180 nM) at various substrate concentrations (0-1.7 mM).
- Recombinant mouse ELANE activation Recombinant mouse ELANE (50 mg/mL) was activated with CTSC (50mg/mL) according to the manufacturer’s protocol (R&D Systems).
- Recombinant human C-terminal CD95 (aa 212-335, MyBioSource, 10 pg) or recombinant N- terminal CD95 (aa 1-173, ThermoFisher Scientific, 10 pg) were digested with human ELANE (0.1 pg) for 2 h at 37 °C, and reactions were stopped with SDS-PAGE loading buffer. Proteins were run on 20% SDS-PAGE gels, stained with Coomassie Blue (ThermoFisher Scientific), and bands were excised for mass spectrometric analyses. Proteins were extracted from excised bands.
- Recombinant peptides (10 pM) corresponding to aa 214-(TLNPETVAINLSDVDLSK)-231 (SEQ ID NO:6) or 317- (DIT SD SEN SNFRNEIQ SL V)-335 (SEQ ID NO:7) of human CD95 (ThermoFisher Scientific) were incubated with ELANE (0.1-0.2 pM) at 37 °C for 15-30 min. Reactions were stopped with 0.1% formic acid.
- MDA-MB-231 cells (2xl0 6 ), A549 cells (2xl0 6 ) with Matrix Type 3), or MEL888 cells (2xl0 6 with Matrix Type 3) were injected into athymic nude mice (Charles River); Ml or 4195 cells (50,000) were injected into NOD.SCID mice (JAX); and E0771 cells (0.5xl0 6 ), LLC1 cells (0.5xl0 6 ), or B16F10 cells (lxlO 6 ), were injected into C57BL/6 mice (JAX).
- TNBC models MDA-MB-231, E0771, Ml, 4195
- cells were injected into the 4 th mammary fat pad of the right ventral side.
- all other models A549, LLC1, MEL888, B 16F10
- cells were injected into the flank.
- ELANE or PMSF-ELANE (11.6 pg/100 pL)
- neutrophil medias or HSA 50 pg/100 pL
- Tumor volume was assessed by calipers, and experiments were terminated when tumor volume in control mice reached > 1000 mm 3 . [0144] Tumor immunohistochemistry.
- Tumors were fixed in 4% paraformaldehyde in PBS for 24 h, embedded in paraffin blocks, and sectioned (5 pm). Slides were stained with cCASP3 (9661) and cPARP (9625) antibodies from Cell Signaling Technology. Signals were developed using the VECTASTAIN ABC kit (Vector Laboratories) or fluorescently-labeled secondary antibodies (melanoma models). For the TUNEL assay, staining was performed with the DeadEndTM colorimetric or fluorometric TUNEL systems (Promega). Cell nuclei were labeled with haematoxylin or Hoechst 33342 (ThermoFisher Scientific). Images were obtained with a Nikon Eclipse Ti2 microscope and analyzed using NIS-Elements software.
- Tumor immune cell analysis Tumors were digested with Type 4 Collagenase (Worthington, 3 mg/mL) and hyaluronidases (Sigma, 1.5 mg/mL) at 37 °C with shaking at 200 rpm for 45 mins (E0771) or 30 min (LLC1 and B16F10). Cells were labeled with various antibodies and analyzed by flow cytometry. Data were quantified by FlowJo v.10.4.1.
- 0.2xl0 6 cells were injected into the lateral tail vein to create 2° lung metastases.
- ELANE or PMSF-ELANE (11.6 pg/100 pL) were injected IT into the 1° tumor once/day for 5 days, and the 1° tumor volume was measured by calipers. Lungs were excised 10 days after the final ELANE treatment, and 2° lung metastases were counted.
- CD8 + T cell depletion For CD8 + T cell depletion, anti-mouse CD8a (clone 2.43, Bio X Cells) or rat IgG2b (isotype control, Bio X Cells) were injected IV (200 pg/injection) 3 days before the first ELANE treatment, and once/week after the last ELANE treatment. CD8 + T cell depletion was confirmed by flow cytometry.
- E0771 cells were injected into the 4 th mammary fat pad of the left ventral side (2° tumor).
- ELANE or PMSF-ELANE (11.6 pg/100 pL) were injected into the tumor-free 4 th mammary fat pad of the right ventral side pad once/day for 5 days, and 2° tumor volume was measured by calipers.
- ELANE or PMSF-ELANE (11.6 pg/100 pL) were injected into the 4 th mammary fat pad of the right ventral side pad of tumor-free C57BL/6 mice once/day for 5 days. One day after the last injection, mice were studied for potential side- effects. Body weight and spleen weight were measured. Apoptosis at the injection site was studied by isolating, fixing, and staining mammary adipose tissue for TUNEL, cCASP3, and cPARP using identical methods described for tumors above. Mammary adipose tissue immune cell populations at the injection site were determined by flow cytometry using identical methods described for tumors above. Liver function was assessed by measuring plasma ALT activity with the Alanine Transaminase Colorimetric Activity Assays Kit (Cayman Chemical).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Dispersion Chemistry (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19899959.1A EP3897669A4 (en) | 2018-12-20 | 2019-12-20 | METHODS AND COMPOSITIONS RELATING TO THERAPEUTIC PEPTIDES FOR CANCER THERAPY |
| CN202411342304.6A CN119015448A (zh) | 2018-12-20 | 2019-12-20 | 与用于癌症疗法的治疗肽相关的方法和组合物 |
| CA3123853A CA3123853A1 (en) | 2018-12-20 | 2019-12-20 | Methods and compositions related to therapeutic peptides for cancer therapy |
| JP2021535554A JP7773195B2 (ja) | 2018-12-20 | 2019-12-20 | がん治療のための治療用ペプチドに関する方法および組成物 |
| AU2019403393A AU2019403393B2 (en) | 2018-12-20 | 2019-12-20 | Methods and compositions related to therapeutic peptides for cancer therapy |
| CN201980092976.7A CN113677351B (zh) | 2018-12-20 | 2019-12-20 | 与用于癌症疗法的治疗肽相关的方法和组合物 |
| US17/346,480 US12611443B2 (en) | 2018-12-20 | 2021-06-14 | Methods and compositions related to therapeutic peptides for cancer therapy |
| JP2025183107A JP2026021440A (ja) | 2018-12-20 | 2025-10-30 | がん治療のための治療用ペプチドに関する方法および組成物 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862782690P | 2018-12-20 | 2018-12-20 | |
| US62/782,690 | 2018-12-20 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/346,480 Continuation US12611443B2 (en) | 2018-12-20 | 2021-06-14 | Methods and compositions related to therapeutic peptides for cancer therapy |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020132465A1 true WO2020132465A1 (en) | 2020-06-25 |
Family
ID=71101609
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/067890 Ceased WO2020132465A1 (en) | 2018-12-20 | 2019-12-20 | Methods and compositions related to therapeutic peptides for cancer therapy |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US12611443B2 (https=) |
| EP (1) | EP3897669A4 (https=) |
| JP (2) | JP7773195B2 (https=) |
| CN (2) | CN113677351B (https=) |
| AU (1) | AU2019403393B2 (https=) |
| CA (1) | CA3123853A1 (https=) |
| WO (1) | WO2020132465A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022056488A1 (en) * | 2020-09-14 | 2022-03-17 | Genprex, Inc. | Nonviral vectors for increasing fas expression in cancer cells and methods of use thereof |
| US12516307B2 (en) | 2020-08-18 | 2026-01-06 | Onchilles Pharma, Inc. | Modified porcine pancreatic elastase proteins |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000069897A2 (en) * | 1999-05-14 | 2000-11-23 | Arbor Vita Corporation | Modulation of glgf motif (dhr/pdz) containing proteins interaction with cd3n in t lymphocytes |
| US20120183552A1 (en) * | 2005-03-25 | 2012-07-19 | Celera Corporation | Kidney disease targets and uses thereof |
| US20160121001A1 (en) * | 2013-02-04 | 2016-05-05 | Vascular Biogenics Ltd. | Methods of inducing responsiveness to anti-angiogenic agent |
| US9850308B2 (en) * | 2006-12-28 | 2017-12-26 | Deutsches Krebsforschungszentrum Stiftung Des Oeffentlichen Rechts | Neutralization of CD95 activity blocks invasion of glioblastoma cells in vivo |
| WO2019051001A1 (en) * | 2017-09-06 | 2019-03-14 | California Institute Of Technology | SIGNALING AND BIFUNCTIONAL RECEPTORS HAVING ANTIGENS (SABR) |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3941763A (en) | 1975-03-28 | 1976-03-02 | American Home Products Corporation | PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| WO2008067305A2 (en) * | 2006-11-28 | 2008-06-05 | Giic Research Development Corporation | Polypeptides comprising intracytoplasmic death domain and nkg2d ligand domain |
| WO2013036201A1 (en) * | 2011-09-06 | 2013-03-14 | Agency For Science, Technology And Research | Polypeptide vaccine |
| GB201121070D0 (en) | 2011-12-07 | 2012-01-18 | Isis Innovation | composition for delivery of biotherapeutics |
| PL2908865T3 (pl) * | 2012-10-17 | 2019-08-30 | Vascular Biogenics Ltd. | Adenowirus wykazujący ekspresję chimery Fas i jego zastosowanie w sposobach leczenia raka |
| GB201506223D0 (en) * | 2015-04-13 | 2015-05-27 | Ucl Business Plc | Chimeric protein |
| WO2018073394A1 (en) * | 2016-10-19 | 2018-04-26 | Cellectis | Cell death inducing chimeric antigen receptors |
| CA3066738A1 (en) * | 2017-06-15 | 2018-12-20 | The University Of Chicago | Methods and compositions for treating cancer |
-
2019
- 2019-12-20 AU AU2019403393A patent/AU2019403393B2/en active Active
- 2019-12-20 WO PCT/US2019/067890 patent/WO2020132465A1/en not_active Ceased
- 2019-12-20 CA CA3123853A patent/CA3123853A1/en active Pending
- 2019-12-20 CN CN201980092976.7A patent/CN113677351B/zh active Active
- 2019-12-20 CN CN202411342304.6A patent/CN119015448A/zh active Pending
- 2019-12-20 JP JP2021535554A patent/JP7773195B2/ja active Active
- 2019-12-20 EP EP19899959.1A patent/EP3897669A4/en active Pending
-
2021
- 2021-06-14 US US17/346,480 patent/US12611443B2/en active Active
-
2025
- 2025-10-30 JP JP2025183107A patent/JP2026021440A/ja active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000069897A2 (en) * | 1999-05-14 | 2000-11-23 | Arbor Vita Corporation | Modulation of glgf motif (dhr/pdz) containing proteins interaction with cd3n in t lymphocytes |
| US20120183552A1 (en) * | 2005-03-25 | 2012-07-19 | Celera Corporation | Kidney disease targets and uses thereof |
| US9850308B2 (en) * | 2006-12-28 | 2017-12-26 | Deutsches Krebsforschungszentrum Stiftung Des Oeffentlichen Rechts | Neutralization of CD95 activity blocks invasion of glioblastoma cells in vivo |
| US20160121001A1 (en) * | 2013-02-04 | 2016-05-05 | Vascular Biogenics Ltd. | Methods of inducing responsiveness to anti-angiogenic agent |
| WO2019051001A1 (en) * | 2017-09-06 | 2019-03-14 | California Institute Of Technology | SIGNALING AND BIFUNCTIONAL RECEPTORS HAVING ANTIGENS (SABR) |
Non-Patent Citations (2)
| Title |
|---|
| PETER , HADJI A, MURMANN A E, BROCKWAY S, PUTZBACH W, PATTANAYAK A, CEPPI P: "The role of CD 95 and CD 95 ligand in cancer", CELL DEATH & DIFFERENTIATION, vol. 22, no. 4, 6 February 2015 (2015-02-06), pages 549 - 559, XP055721394 * |
| See also references of EP3897669A1 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12516307B2 (en) | 2020-08-18 | 2026-01-06 | Onchilles Pharma, Inc. | Modified porcine pancreatic elastase proteins |
| WO2022056488A1 (en) * | 2020-09-14 | 2022-03-17 | Genprex, Inc. | Nonviral vectors for increasing fas expression in cancer cells and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022514354A (ja) | 2022-02-10 |
| AU2019403393A1 (en) | 2021-08-05 |
| AU2019403393B2 (en) | 2026-04-16 |
| CN113677351B (zh) | 2024-09-27 |
| JP2026021440A (ja) | 2026-02-10 |
| CA3123853A1 (en) | 2020-06-25 |
| US20220000977A1 (en) | 2022-01-06 |
| CN113677351A (zh) | 2021-11-19 |
| EP3897669A1 (en) | 2021-10-27 |
| US12611443B2 (en) | 2026-04-28 |
| JP7773195B2 (ja) | 2025-11-19 |
| CN119015448A (zh) | 2024-11-26 |
| EP3897669A4 (en) | 2022-08-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7529754B2 (ja) | がんを処置するための方法および組成物 | |
| Guo et al. | Life after death: targeting high mobility group box 1 in emergent cancer therapies | |
| JP2026021440A (ja) | がん治療のための治療用ペプチドに関する方法および組成物 | |
| WO2020056304A1 (en) | Methods and compositions for treating cancer using mrna therapeutics | |
| AU2015264114A1 (en) | Methods for treating cancer with anti BiP or anti MICA antibodies | |
| WO2017100125A1 (en) | Compositions and methods for treating or ameliorating neuroinflammation, neurodegeneration, neuropathic pain, and migraine | |
| ES2781673T3 (es) | Tratamientos y composiciones de inmunoterapia | |
| HK40119649A (zh) | 与用於癌症疗法的治疗肽相关的方法和组合物 | |
| WO2013009165A1 (en) | A peptide capable of binding with a human leukocyte antigen (hla) molecule, a cancer vaccine derived from said peptide and use of said cancer vaccine | |
| HK40102823B (en) | Compositions for treating cancer | |
| HK40102823A (en) | Compositions for treating cancer | |
| Orsolic | Possible molecular targets of bee venom in the treatment of cancer: application and perspectives | |
| HK40029045A (en) | Compositions for treating cancer | |
| HK40029045B (en) | Compositions for treating cancer | |
| CA3071217A1 (en) | Hsp70 based combination therapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19899959 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3123853 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021535554 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019899959 Country of ref document: EP Effective date: 20210720 |
|
| ENP | Entry into the national phase |
Ref document number: 2019403393 Country of ref document: AU Date of ref document: 20191220 Kind code of ref document: A |