WO2020117752A1 - G protein-coupled receptor screening systems - Google Patents
G protein-coupled receptor screening systems Download PDFInfo
- Publication number
- WO2020117752A1 WO2020117752A1 PCT/US2019/064159 US2019064159W WO2020117752A1 WO 2020117752 A1 WO2020117752 A1 WO 2020117752A1 US 2019064159 W US2019064159 W US 2019064159W WO 2020117752 A1 WO2020117752 A1 WO 2020117752A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- gpcr
- receptor
- transducer
- protein subunit
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/566—Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4722—G-proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/723—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1055—Protein x Protein interaction, e.g. two hybrid selection
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/502—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
- G01N33/5041—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects involving analysis of members of signalling pathways
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54313—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
- G01N33/5432—Liposomes or microcapsules
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4719—G-proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/72—Assays involving receptors, cell surface antigens or cell surface determinants for hormones
- G01N2333/726—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/04—Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
Definitions
- G protein-coupled receptors are modulated by 34% of FDA- approved drugs (Hauser AS, et al. Nat Rev Drug Discov. 2017 16(12):829-842), making them the most highly targeted receptors in the clinic.
- Current GPCR drugs have a rather broad mechanism of action— they activate (agonist), block (antagonist), or allosterically modulate numerous signaling pathways downstream of their target receptor.
- Driving much of the recent progress in GPCR molecular pharmacology has been the notion that selective modulation of distinct GPCR pathways (i.e., those associated ONLY with therapeutic effects) will yield safer and more efficacious next- generation biased therapeutics (Kenakin T. Mol Pharmacol. 2015 88(6):1055-61).
- GPCR signal transduction is enormous complex ( ⁇ 350 druggable GPCRs activate any number of 16 different canonical G protein signaling pathways and an untold number of non-canonical pathways), which complicates efforts to 1) understand the individual contributions of each pathway in normal and diseased states and 2) identify and design biased agonists.
- drugs with engineered biased signaling profiles have yet to hit the market, although several are in the (pre)clinical pipeline (Hodune SY, et al. J Cardiovasc Pharmacol. 2016 67(3):193- 202).
- Current drug discovery campaigns are limited when it comes to discovering biased agonists for several reasons.
- GPCR G protein-coupled receptor
- Transducers can exist unfused or fused to the GPCR and can include engineered heterotrimeric G proteins (Ga(Rluc)/GPy-GFP), an engineered Ga(Rluc) subunit, native heterotrimeric G protein, native Go subunit, anrestin, a signaling associated protein, or a protein or protein fragment that through reversible coupling induces active or inactive structural changes in the receptor (e.g., antibodies or nanobodies or similar proteins and peptides). In cases where complex stability and extreme specificity are required, the GPCR and transducer are connected directly or by a flexible linker (see ADSORB method below).
- ADSORB method see ADSORB method below.
- ADSORB Affinity-Directed Selection of Receptor Binders
- receptor- transducer allosteric interactions are broken, thus converting the receptor to a low affinity conformational state that binds agonists with low affinity.
- ligands with significant molecular efficacy e.g. agonists with a large preference for the activated state relative to the inactive state
- This elution strategy is considered a 'functional elution’ as the ligands that are eluted should predominantly be agonists or positive allosteric modulators.
- ADSORB method provides a cleaner elution of target molecules and requires less downstream validation and removal of false positives. If anything, molecules like inverse agonists would be bound tighter as the receptor ensemble shifts towards predominantly inactive states. Such molecules could be eluted subsequent to agonists.
- this in vitro strategy simulates cellular signaling processes at the level of ternary complex interactions to enable 1) screening of ligands in vitro with the same outcome as screening in cells, 2) efficient screening for ligands with a predefined pharmacology, 3) expansion of chemical space for new chemotypes by screening high complexity libraries, and 4) efficient and targeted screening for biased agonists. Therefore, disclosed herein is a method that relies on the real time switching between active and inactive receptor states as a correlate of cellular signaling to confer function to in vitro screens to screen extremely large and complex libraries.
- GPCR G protein coupled receptor
- transducer GPCR-transducer fusion
- ADSORB is a scalable platform involving fusions between any GPCR and any transducer (i.e. at the very least it applies to any GPCR and known transducer combination, totaling >12,800 biological complexes), which are then expressed in membranes (e.g., the active complex, Figure 1A).
- ADSORB also includes yet-to-be discovered signal transducers as well as signaling mimetic proteins or engineered receptors that reversibly alter the receptor conformational ensemble, as described herein.
- the ADSORB GPCR-transducer fusion contains the optimal GPCR- Ga(Rluc) construct determined from TRUPATH screening below.
- the system can also contain Gb and Gy protein subunits as described further herein. Since each unique GPCR-transducer fusion target represents conformational ensembles that activate different signal transduction pathways in the cell, the pharmacology of each screen can be directed by simply changing the type of fused transducer. This provides unprecedented control over both the receptor target and the intended ligand function (i.e. activation of a given transducer signaling pathway).
- a method for identifying ligands with differential affinities toward different transducer complexes wherein the GPCR and the transducer are initially coupled in an active GPCR-transducer complex
- the method can then involve contacting the system with a composition comprising a plurality of candidate agents (Figure 1 B). Those agents with affinity for the GPCR-transducer complex will bind strongly as a ternary complex (ligand-GPCR-transducer), while the rest of the candidate agents can be washed away (Figure 1C).
- the method then involves uncoupling the transducer from the GPCR in real time (i.e. ternary complex dissociation; this also extends to any method that enables quick reversal of receptor conformational stabilization)— a major distinguishing step absent from previous static methodologies that use unliganded receptors, static complexes, irreversible mutant stabilized receptor conformations (e.g. thermostabilization), and/or generic elution strategies (e.g. heat, solvents, or pH).
- This can be accomplished, for example in the case of receptor-G protein ternary complexes, using an effective amount of non-hydrolyzable guanine nucleotide (GPPNHP, Figure 1 D) or other agents as listed below.
- GPPNHP non-hydrolyzable guanine nucleotide
- the method then involves eluting bound candidate agents from the system.
- the eluted candidate agents represent ligands with differential affinity for the GPCR in an active-like vs. inactive-like state (i.e. they bind tightly to transducer- coupled but not the uncoupled GPCR), and thus can activate the same transducer in live cells according to classic receptor theory (Kent et al. Mol Pharmacol 1980 17(1)14-23). Proof-of-concept is shown in Figure 2A-D with full agonists of different opioid receptors (ORs).
- the method can further involve repeating the above steps using the eluted candidate agents to enrich for high efficacy ligands (applies equally to agonists, allosteric modulators, and inverse agonists; thus, it includes activators and inactivators of receptor pathways).
- Wash stringency can be adjusted to select for agents with varying binding affinities as well as increase the ability to direct agent pharmacology.
- Elution times can also be adjusted to enrich for agents with differing pharmacological effects. For example, full agonists or full inverse agonists should elute quickly, whereas ligands with modest efficacy and high affinity for the uncoupled receptor will elute more slowly.
- ADSORB is a selection strategy that relies on the differential affinity of ligands to recognize or interact with different receptor states (e.g. native/unliganded, liganded, active, inactive, mutant, transducer or signaling mimetic-stabilized).
- the candidate agent can be an agonist, antagonist, inverse agonist, or allosteric modulator.
- the candidate agent can be any molecule, such as a small-molecule, biologic (e.g. peptide, protein, antibody, nanobody, nucleic acid, aptamer), or a derivative or combination thereof, with the potential to differentially bind the GPCR depending on the receptor state.
- the composition is a phage displaying the candidate agents, e.g. peptide candidate agents.
- the candidate agent can be from a library (e.g., peptide phage display, macrocycle libraries, DNA-encoded libraries, pooled small molecules, pooled peptides, tissue extracts, natural product extracts, yeast display, or other preparations, Figures 1 and 2).
- each candidate agent is tagged with an identifier, such as a nucleic acid barcode, to identify which of the plurality of candidate agents are present in the eluted fraction.
- each agent can be identified using procedures such as small molecule mass spectrometry and peptide mass spectrometry.
- the GPCR-transducer fusion is preferably integrated into a membrane or similar environment, such as a lipid bilayer.
- the GPCR-transducer fusion is incorporated into the membrane of a cell (microsomes from mammalian, insect, or other systems like virus-like particles, VLPs) in which it was expressed.
- Microsomes can be prepared using standard differential centrifugation techniques, with the potential to control the orientation of the GPCR- transducer fusion as‘right-side-out' or‘inside-out’ for orientation-specific screening.
- the GPCR-transducer fusion is incorporated into a detergent micelle, the membrane of a liposome, or a lipid nanoparticle.
- the liposome can comprise a molecule such as dimyristoylphosphatidylcholine (DMPC).
- the GPCR-transducer fusion is incorporated into lipid nanoparticles stabilized by apolipoproteins or copolymers.
- the GPCR-transducer fusion protein in a membrane or similar environment is immobilized on a bead (e.g. agarose or magnetic beads).
- a bead e.g. agarose or magnetic beads.
- the GPCR-transducer protein can be recovered using centrifugation, filters, or surface immobilization such as on a surface plasmon resonance (SPR) sensor chip or array.
- SPR surface plasmon resonance
- GPCRs have already been targeted by small molecules, proteins, endogenous and exogenous peptides, macrocycle ligands, aptamers, and antibodies; therefore, libraries of these types can yield ligands with novel chemotypes and pharmacology. Because GPCR ligands with large efficacies favor binding to active signaling complexes over the free receptor by several orders of magnitude, library molecules recovered by this system are likely to have considerable‘molecular efficacy' and maximally activate (or inactivate) distinct cellular pathways.
- the disclosed ADSORB strategy allows for isolation of orthosteric and allosteric ligands from a much greater chemical space, with the potential to discover new chemotypes and thus new biology and therapy.
- transducers could also include proteins or their fragments or other engineering methods that reversibly stabilize active and inactive receptor states. In terms of stabilizing inactive states, this could enable preferential isolation of inverse agonists or negative allosteric modulators using the same methodology (i.e. inverse agonists and negative allosteric modulators favor inactive states, just as agonists or positive allosteric modulators favor active states).
- ADSORB assay For this to function as a typical ADSORB assay, it could involve the engineering of domains into the inactive state stabilizers that are sensitive to small molecules or other agents that would alter protein conformation or induce other changes to promote dissociation from the receptor.
- the rather high affinity of inverse agonists for the low affinity uncoupled receptor would likely require additional agents like competitors to enhance dissociation (shown for an agonist in Figure 2G).
- an engineering method that would allow the receptor to switch from inactive to active states e.g. an engineered receptor that could be forced to adopt states with high constitutive activity
- this technology delivers on multiple levels including: 1) the development of new ligands with diverse chemotypes and signaling properties for GPCRs, with the potential to aid computational efforts; 2) the development of biased drug-like molecules; 3) the identification of biased tool molecules that can be used to isolate and study signaling pathways downstream of GPCRs in vivo; 4) the discovery of tool molecules to activate orphan GPCRs to reveal their (patho)physiology; and 5) the discovery of novel allosteric modulators with tailored effects.
- TRUPATH for brevity
- TRansdUcerome Profile Analysis of g protein paTHways can be used to measure G protein pathway activation by an agent.
- the initiating steps for G protein stimulus- response cascades are receptor-mediated guanine nucleotide exchange at the Ga- subunit of the Ga/Gbg heterotrimer and subsequent dissociation or rearrangement of the heterotrimeric complex (see ADSORB Figure 2A). This leads to effector activation (Gether, U. and Kobilka, B. K. J. Biol. Chem. 1998 273, 17979-1798).
- the transducer is the Ga subunit tagged with a luminescent donor or fluorescent acceptor ( Figure 3A).
- Figure 3A if the Ga protein subunit is tagged with a luminescent donor, then either the G probtein subunit or the Gy protein subunit is tagged with a fluorescent acceptor; and if the Ga protein subunit is tagged with a fluorescent acceptor, then either the G probtein subunit or the Gy protein subunit is tagged with a luminescent donor.
- the positional insertion sites or chimeric fusions for each donor/acceptor pair are empirically optimized de novo by iterative testing of all combinations such that the composition of the biosensor has been experimentally determined (e.g.
- the disclosed method can further involve measuring bioluminescence resonance energy transfer in a fused or unfused system (baseline BRET), contacting the system with the agent, and then measuring a second bioluminescence resonance energy transfer in the system. The difference between the first bioluminescence resonance energy transfer and the second
- bioluminescence resonance energy transfer can then be used to calculate G protein pathway activation (NET BRET).
- the disclosed TRUPATH system uses the receptor-transducer fusion used in the ADSORB system for the same advantages conferred (e.g. stoichiometry to establish reliable measurements of pathway bias, trafficking and in some cases folding concerns, and avoiding off-target activation of the sensor by endogenous receptors or systems).
- the receptor and transducer are unfUsed and can be used separately.
- the fusion system allows for a clear measurement of basal activity of the receptor and ensures that all active receptors have available to them a functional sensor.
- the fusion approach increases the dynamic range and reliability of the measurement over the unfused scenario but is not necessary for the improvements described in the TRUPATH biosensor compositions (Figure 29).
- the method involves repeating the above steps for the agent(s) at a plurality of doses and calculating a dose-response curve ( Figures 4C, 7, 13-25, 32C-32J, and 33C-33D).
- Standard logistic regression fitting of dose-response curves enables estimates of common pharmacological parameters such as potency (EC50) and efficacy (Emax). including inverse agonism (Figure 5A).
- EC50 potency
- Emax efficacy
- Figure 5A inverse agonism
- the minimized amplification and receptor reserve inherent to TRUPATH assays produce accurate parameter estimates without the need for data post-processing (Figure 5B-5D).
- the method involves repeating the above steps for the agent at a plurality of kinetic conditions (Figure 6).
- the method involves repeating the above steps for the agent using a plurality of Ga/Ob/Gg transducer combinations ( Figure 3F-3I, 7, 13-25).
- the agent used in the TRUPATH method was first identified by the ADSORB method.
- the advantage to using ADSORB and TRUPATH together as a single platform allows for the initial screening of large libraries and validation of signaling properties using the same engineered complexes (e.g. GPCR- Ga(Rluc), fused or unfused). Additionally, the properties determined from TRUPATH can be compared to non-tagged“native" transducers (unfused) in other standard signaling assays and is therefore cross-platform compatible ( Figure 12). Therefore, in some embodiments, the system comprises a pre-determined GPCR-Ga(Rluc) fusion used in the ADSORB method to identify the agent being tested.
- the GPCR-Ga(Rluc) fusion composition used in the ADSORB method was first identified by the TRUPATH method. This interplay between disclosed systems enables identification of pathway preferences that can then be used to guide the ADSORB screen and target agents with the desired transducer bias. Such agents can then be tool molecules or lead compounds in therapeutic strategies.
- TRUPATH can be used to identify potential pathway coupling by evaluating receptor constitutive activity across all pathways. Given the multi-state model of GPCR function and the assumption that basal active states couple to many signal transducers, variability in baseline BRET responses (i.e. constitutive activity) should be apparent across different G proteins for GPCRs. As shown in Figure 5A, TRUPATH assays report constitutive activity and are sensitive to inverse agonists. When tested across all transducers it is indeed apparent that TRUPATH sensors can identify potential coupling mechanisms in the absence of ligand as demonstrated for the dopamine receptors (Figure 8).
- basal signaling e.g. sodium ions
- Basal activity of GPCRs like mu-opioid receptors are negatively regulated by sodium ( Figure 9).
- Altering the sodium concentration of a buffer or drug solution can therefore alter the basal activity and produce an effect on the basal BRET response at different concentrations.
- Using the disclosed fusion approach is optimal, but not required, as it can eliminate potential effects of endogenous receptor systems on the TRUPATH biosensor.
- changes in basal BRET can be attributed to the fused system by eliminating otherwise interfering partners.
- the unfused format can increase throughput at the potential expense of some of this specificity.
- the GPCR-G ⁇ (Rluc) donor chimera can be used to assess interacting partners via isolation (e.g. immunoprecipitation) and mass spectrometry, and then validated by using a fluorescent acceptor tagged to identified partners.
- isolation e.g. immunoprecipitation
- mass spectrometry e.g. fluorescent acceptor tagged to identified partners.
- the ability for these interacting partners to modulate affinity of the complex can be probed using the ADSORB approach.
- FIG ⁇ 1 is a schematic of an example embodiment of the disclosed ADSORB (Affinity-Directed Selection of Receptor Binders) screening system.
- Various agent libraries can be substituted in place of the nucleic acid-encoded library shown here. Steps including purification and immobilization of the GPCR-transducer complex (A), library binding (B), washing (C), and elution (D) are subject to modification as described herein.
- a major differentiation here is the functional elution step, which consists of dissociating the signaling complex in real time (arrows in D) and effectively shifts the receptor from high to low affinity states.
- Ligands that prefer the high affinity state of the receptor e.g. in complex with a transducer
- Agonists have a large preference for binding the active receptor state that is equivalent to the magnitude of their signaling in cells.
- FIG. 2A is the experimental workflow for screening of an opioid receptor fused to the G ⁇ il protein (OR-GM active complex) expressed in a native membrane microsome.
- a radiolabeled agonist is used as the positive control to assess the performance of the screen in place of a large library (i.e. to quantify agonist binding, washing, and elution).
- FIG. 2B shows quantification of an ADSORB screen at the m-opioid receptor (MOR) fused to G ⁇ it protein (MOR-GM).
- MOR m-opioid receptor
- FIG. 2C shows quantification of an ADSORB screen at the k-opioid receptor (KOR) fused to G ⁇ il protein.
- FIG. 2E and F show quantification of a proof-of-concept ADSORB screen at the unfused MOR (low affinity) and MOR-G ⁇ i1 expressing membranes.
- the tracer is the antagonist pHJNaloxone
- the tracer is the efficacious agonist pH]DAMGO.
- the antagonist pHJNaloxone binds poorly to both the MOR and MOR-G ⁇ M membranes (black segment), and as a result very little antagonist is eluted from both membranes (small red segments) when treated with GPPNHP.
- FIG. 2F shows functional elution with GPPNHP can be enhanced by the addition of sub-saturating concentrations of a competitive ligand.
- the amount of functionally eluted peptide agonist can be doubled by the addition of 100nM naloxone. It is likely that sub-saturating concentrations of competitor enhance elution by keeping the agonist from re-binding the low-affinity state of the receptor. Compared to its weak elution from the coupled/high affinity state of the receptor, naloxone is now more effective at displacing the agonist from the uncoupled receptor.
- FIG. 3A shows TRUPATH biosensor construction and optimization.
- FIG. 3A shows Bioluminescence Resonance Energy Transfer (BRET) between chimeric Ga-RLuc8 donor proteins and Gy-GFP2 acceptor proteins can differentiate between inactive (intact, high BRET) and active (dissociated, low BRET) Gabg heterotrimers. Receptor-mediated rearrangement or dissociation of the Gabg heterotrimer represents the proximal step in signal transduction (black arrow).
- FIG. 3B demonstrates that resonance energy transfer (RET) efficiency between the luminescent and fluorescent proteins depends on both proximity and orientation of their dipole moments.
- RET resonance energy transfer
- FIG. 3C details that to develop next-generation Ga-RLuc8 ⁇ Y-GFP2 BRET biosensors, we first combined information from atomic- level protein structures, previous data, and computer-generated models to identify candidate regions of the Ga-subunit amenable to luciferase insertion.
- FIG. 3D outlines that luciferase chimeras were generated at each position within these defined regions (Gctq insertional sites listed as examples).
- 3E shows how the performance of each Ga-RLuc8 chimera was assessed as the first step in an exhaustive optimization scheme to select optimal Ga-RLuc8 ⁇ Y-GFP2 biosensors.
- first-pass screens of different Ga-Rluc8 chimers using a standardGb g-ORR2 acceptor (e.g., G1b Y2-GFP2) and model GPCR identified the construct with the greatest dynamic range. The top five constructs were confirmed in secondary screens.
- FIG.3G the top-performing Ga-Rluc8 construct was screened against each of 12 GY-GFP2 constructs to identify the optimal acceptor fusion protein.
- FIG. 3F shows how the performance of each Ga-RLuc8 chimera was assessed as the first step in an exhaustive optimization scheme to select optimal Ga-RLuc8 ⁇ Y-GFP2 biosensors.
- FIG. 3F first-pass screens of different Ga-Rluc8 chimers using a standardGb g-ORR2 acceptor (e.g., G1b Y2-GFP2) and
- FIGs. 4A to 4C compares traditional unfused BRET assays (FIG. 4A) and new Receptor-G protein RLuc8 fusion (FIG. 4B) at different stoichiometries of donoracceptor DMA.
- FIG. 4C shows that fusion BRET system (MOR-GaM) can detect partial and superagonists relative to morphine (100%).
- FIG. 5A shows that TRUPATH is sensitive to inverse agonists as concentration-response curves for the constitutively active cannabinoid 1 receptor (CB1 R) at Gai3 show a small full agonist response (WIN 55,212-2) and large effect of the inverse agonist (Rimonabant).
- CB1 R constitutively active cannabinoid 1 receptor
- FIGs. 6A to 6C show the fusion BRET system provides an accurate estimation of the kinetics of receptor activation/equilibration.
- the substrate appears stable > 1 hour and thus kinetics can be measured by staggered addition of drug followed by simultaneous addition of substrate, or through repeated measurements.
- the MOR (FIG. 6A) and HTR1 E (FIG. 6B) receptors show activation kinetics.
- FIG. 6C shows that TRUPATH provides potential leverage for difficult targets like the serotonin-5A receptor (HTR5A) that does not work reproducibly in GloSensor cAMP assays.
- HTR5A-Gai1 RLuc fusion gives a reliable and substantial serotonin response in BRET.
- FIG. 7A uses the exemplar sensor Goq to illustrate how the crystal structure of the inactive GaV/Gb1/g2 heterotrimer (PDB 3AH8) was used to first identify regions within the alpha-helical domain (red tx»0 for RLuc8 insertion that were close to the predicted N-terminus of the Gy-subunit (green box).
- Goq(98)RLuc8 insertion of RLuc8 following the lysine at position 97 in Goq.
- wenty Gaq-RLuc8 fusion proteins were generated at each amino acid spanning the linker regions between oA-aB and between aB-aC helices.
- each chimera was evaluated in a primary concentration-response assay using the Goq-coupled Neurotensin receptor. Performance was evaluated as fold- increase in dynamic range (Net BRET) relative to the reference construct (AA position 98 in Goq).
- the top five insertion positions 119, 122, 123, 125,126 were confirmed in a secondary screen (three biological replicates), identifying position 125 as the optimal Goq-Rluc8 chimera insertion site (FIG. 7C, boxed).
- a‘Gy-GFP2’ screen FIG. 7B
- FIGs. 8A to 8E show constitutive activity of dopamine family receptors (DRD1-5), which reveals unexpected promiscuity.
- FIG. 8A shows relative basal activity (%Basal BRET- Emax of control) at DRD1-5 across all TRUPATH sensors.
- FIG. 9 shows via a GTPy 35 S loading assay using GPCR-transducer fusion constructs (MOR-GM) that GPCRs are responsive to negative allostery by sodium ions (right panel). As described in the summary, this is useful for identifying transducer preferences without a ligand in addition to the method of FIG. 8.
- MOR-GM GPCR-transducer fusion constructs
- FIG. 10 shows how receptor-transducer(RLuc) fusions in
- membranes/microsomes can be used quantify receptor density for ADSORB.
- receptor-Galpha(RLuc8) fusions with known radiolabeled probes that can be used to quantify their expression and then be used as standard curves for receptors with no probes.
- plots of receptor density (e.g. via radiolabeled saturation binding) vs. luciferase activity can quantify the expression levels of understudied receptor-transducer fusion proteins.
- luminescence values from the receptor- transducer-Rluc preparation can be compared to a standard curve and the receptor- density extrapolated due to the 1 :1 receptor/G-alpha-transducer stoichiometry. This ensures equal receptor density for screening in the ADSORB approach.
- FIG. 11 A illustrates that GPCR-transducer fusion proteins are functional for a variety of receptors and pathways and faithful to known GPCR coupling preferences.
- HEK293 cells that endogenously express Gq-coupled purinergic (ATP-activated) and muscarinic (Carbachol-activated) receptors, but not serotonin (5-HT) receptors.
- 5-HT receptor agonists (5-HT, DOI, Lisuride) do not cause calcium release in these cells (left graph).
- FIG. 11 A (right graph) illustrates a fusion approach where the 5-HT2A receptor fused to Gq (red cartoon) is expressed in cells to confer responsiveness to 5-HT agonists.
- FIG. 11 B shows that GPCR-transducer fusions achieve specificity of G protein activation for screening different pathways (Gi vs. Gq vs. Gs, etc.).
- a radiolabeled non-hydrolyzable GTP analogue [ 35 S]GTPyS
- 5-HT full
- Ergometrine partial
- FIG. 11 C illustrates that GPCRs signal through multiple potential transducer pathways (e.g. 16 non-visual G proteins and arrestins, not exhaustive). While classically divided into four effector families (e.g.
- Gi family inhibits adenylyl cyclase production, Gs family stimulates adenylyl cyclase, Gq family stimulates PLC, and G12/13 regulates Rho GEFs), many functional assays of effector activation rely on the expression of intermediary downstream signaling pathway components. The full complement of these signaling components may not be present in every cell type and reconstituting these pathways would require significant a priori knowledge of both the physiology of the cell model as well as the details of the G protein/second-messenger pathway.
- the disclosed TRUPATH platform covers 14 pathways and is proximal to receptor activation, thus
- FIGs. 12A to 12D show Mu opioid receptor (OPRM) signaling at GM and Gz (both Gi class transducers) appears significantly different.
- FIG. 12A to 12B show the findings of enhanced efficacy at Gz for morphine (classic agonist) and surprisingly for naloxone (classic antagonist).
- FIGs. 12C and 12D show partial agonism of naloxone confirmed in a second messenger assay (inhibition of cAMP).
- FIGs. 13A to 13D show workflow and data supporting successful optimization of GaM BRET biosensor.
- FIG. 13A shows results of primary screen of experimental Gai1-RLuc8 fusion constructs (two technical replicates). Top-5 performing chimeras (91 , 93, 95, 98, 99, boxes) were evaluated in a secondary screen (FIG. 13B, three biological replicates), where AA position 91 (box) was selected as the optimal biosensor construct.
- a screen of Gy-GFP2 constructs (FIG 13C, three biological replicates) identified Gy9-GFP2 and Gy13-GFP2 (boxes) as top performing GFP-acceptor proteins.
- FIGs. 14A to 14D show workflow and data supporting successful optimization of Gai2 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 14A shows results of primary screen (two technical replicates), FIG 14B shows top-5 performing chimeras (boxed), FIG. 14C shows screen of Gy-GFP2 constructs, FIG. 14D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 15A to 15D show workflow and data supporting successful optimization of Gai3 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 15A shows results of primary screen (two technical replicates), FIG 15B shows top-5 performing chimeras (boxed), FIG. 15C shows screen of Gy-GFP2 constructs, FIG. 15D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 16A to 16D show workflow and data supporting successful optimization of GaoA BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 16A shows results of primary screen (two technical replicates), FIG 16B shows top-5 performing chimeras (boxed), FIG. 16C shows screen of Gy-GFP2 constructs, FIG. 16D shows results of screen against Gb8 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 17A to 17D show workflow and data supporting successful optimization of GaoB BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 17A shows results of primary screen (two technical replicates), FIG 17B shows top-5 performing chimeras (boxed), FIG. 17C shows screen of Gy-GFP2 constructs, FIG. 17D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 18A to 18D show workflow and data supporting successful optimization of GoZ BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 18A shows results of primary screen (two technical replicates), FIG 18B shows top-5 performing chimeras (boxed), FIG. 18C shows screen of Gy-GFP2 constructs, FIG. 18D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 19A to 19D show workflow and data supporting successful optimization of GaGustdudn BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 19A shows results of primary screen (two technical replicates), FIG 19B shows top-5 performing chimeras (boxed), FIG. 19C shows screen of Gy-GFP2 constructs, FIG. 19D shows results of screen against G$b 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 20A to 20D show workflow and data supporting successful optimization of GosShort BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 20A shows results of primary screen (two technical replicates), FIG 20B shows top-5 performing chimeras (boxed), FIG. 20C shows screen of Gy-GFP2 constructs, FIG. 20D shows results of screen against G$b 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 21 A to 21 D show workflow and data supporting successful optimization of GasLong BRET biosensor. Format follows that of FIG. 13. Briefly,
- FIG. 21 A shows results of primary screen (two technical replicates)
- FIG 21 B shows top-5 performing chimeras (boxed)
- FIG. 21 C shows screen of Gy-GFP2 constructs
- FIG. 21 D shows results of screen against G$b 1-4.
- Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIG.S 22A to 22D show workflow and data supporting successful optimization of Ga11 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 22A shows results of primary screen (two technical replicates), FIG 22B shows top-5 performing chimeras (boxed), FIG. 22C shows screen of Gy-GFP2 constructs, FIG. 22D shows results of screen against Gb8 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 23A to 23D show workflow and data supporting successful optimization of Ga15 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 23A shows results of primary screen (two technical replicates), FIG 23B shows top-5 performing chimeras (boxed), FIG. 23C shows screen of Gy-GFP2 constructs, FIG. 23D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 24A to 24D show workflow and data supporting successful optimization of Ga12 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 24A shows results of primary screen (two technical replicates), FIG 24B shows top-5 performing chimeras (boxed), FIG. 24C shows screen of Gy-GFP2 constructs, FIG. 24D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 25A to 25D show workflow and data supporting successful optimization of Ga13 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 25A shows results of primary screen (two technical replicates), FIG. 25B shows top-5 performing chimeras (boxed), FIG. 25C shows screen of Gy-GFP2 constructs, FIG. 25D shows results of screen against G ⁇ $ 1-4. Top performing biosensor
- compositions are shown in Table 1. Data are presented as mean ⁇ SEM.
- FIGs. 26A to 26C show that Switch III in the G ⁇ -subunit is a novel region for optimal RLuc8 insertion.
- FIG. 26A shows that for difficult to engineer G ⁇ transducers (e.g., G ⁇ 11), a new site for RLuc8 insertion was identified between the b4-5 ⁇ G3h ⁇ and the a3 helix of the Ras-like domain (Switch III, dashed box). The closest residue in the G ⁇ 11 model (a glutamic acid at position 241 , FIG. 26A inset) was first targeted to assess the performance of RLuc8 chimeras generated within this region.
- FIG. 26B delineates the Switch III region within G ⁇ 11 for RLuc8 insertion.
- FIG. 26C compares an optimized alpha helical Gq biosensor and a Switch III version of Gq; note ⁇ 50% enhancement in signal for Switch III. High performance of luciferase insertions within Switch III should extend to all sensors in Table 1.
- FIG. 27 shows that a BRET system at equilibrium not prone to amplification also allows for the measurement of inverse agonism.
- GPCRs possess varying levels of basal activity
- an increase in BRET results from the stabilization of an inactive state.
- the serotonin 2C receptor (HTR2C), which has a moderate level of basal activity)
- the HTR2C receptor is one of the most highly variant receptors in the brain, and the consequences of many of these variants are unknown.
- Some editing variants present a greater risk of suicidality, and as such subtype selective ligands may have substantial therapeutic benefit.
- FIG. 28 shows seven ligands screened at six G ⁇ proteins fused to the m-opioid receptor (MOR). Consistent with classical pharmacology, standard in vitro competition radioligand binding assays report affinity shifts for ligands that correlate with their abilities to activate these pathways in cells, thus supporting the functionality of the fusions.
- the antagonist naloxone does not experience significant affinity shifts, whereas foil agonists (morphine, endomorphins, DAMGO, and Leu-enkephalin) and a partial agonist (TRV130) shift compared to unfosed MOR. Differences in shifts (i.e. molecular efficacy) suggest biased responses at these pathways (Strachan RT et al.
- TRUPATH Gai1-91- RIUC8/GP3Y9-GFP2, p ⁇ 0.0001.
- FIG. 29B (Reference) Gai2-92-Rluc8/Gpiy2-GFP2 ⁇ (TRUPATH) Gai2-91-Rluc8/Gp3y8-GFP2, p ⁇ 0.0001.
- FIG. 29C (Reference) Gai3- 92-Rluc8/Gpiy2-GFP2 ⁇ (TRUPATH) Gai3-99- Rluc8/Gp3y9-GFP2, p ⁇ 0.0001.
- FIG. 29F Reference
- FIG. 29G (Reference) GaGustdudn-92-Rluc8/Gpiy2-GFP2 ⁇ (TRUPATH) GaGustducin-117-Rluc8/Gp3y1 -GFP2, p ⁇ 0.0001.
- FIG. 29H (Reference) GaGustdudn-92-Rluc8/Gpiy2-GFP2 ⁇ (TRUPATH) GaGustducin-117-Rluc8/Gp3y1 -GFP2, p ⁇ 0.0001.
- FIG. 29I (Reference) GasL-114-Rluc8/GplYl-GFP2 ⁇
- FIG. 29K (Reference) Ga11 -98-Rluc8/Gpi g1 -GFP2 ⁇ (TRUPATH) Ga11-246- Rluc8/Gp3Yl3-GFP2, p ⁇ 0.0001.
- FIG. 29L (Reference) Ga15-101- KIuo8/Gb1g2- GFP2 ⁇ (TRUPATH) Ga15-245-RIuo8/Gb3g13-GFP2, p ⁇ 0.0001.
- FIG. 29M (Reference) Ga11 -98-Rluc8/Gpi g1 -GFP2 ⁇ (TRUPATH) Ga11-246- Rluc8/Gp3Yl3-GFP2, p ⁇ 0.0001.
- FIG. 29L (Reference) Ga15-101- KIuo8/Gb1g2- GFP2 ⁇ (TRUPATH) Ga15-245-RIuo8/Gb3g13-GFP2, p ⁇ 0.0001.
- FIG. 29N (Reference) Ga13-107-Rluc8 ⁇ lY2-GFP2 ⁇
- FIGs. 30A to 30C show triple plasmid architecture incorporating all three heterotrimer components (Ga-RIuo8/Gb/Gg-ORR2). Shown in FIG. 30A is the GaI3-99-RIuo8/Gb1 Y2-GFP2 biosensor and in FIG. 30B is the Gai3-99- RIuo8/Gb3g9-ORR2 biosensor. FIG. 30C details the functionality and enhanced response of the GaI3-99-RIuo8/Gb1 Y2-GFP2 triple plasmid vs. the same components transfected as separate plasmids. Shown are concentration-response curves for the MOR activated by DAMGO.
- FIG. 31 shows that the robust signal of TRUPATH biosensors enables miniaturization to 384-well plates.
- the NET BRET response at GoZ was 0.495 for the 96- well plate and 0.625 for the 384-well plate.
- Neurotensin potency was 1 ,85nM and 1 ,68nM for 96- and 384-well plates, respectively.
- FIGs. 32A to 32J demonstrate how a panel of KOR agonists engage Gai/o-class TRUPATH sensors with varying potency (FIG. 32A heat map) and efficacy (FIG. 32B heatmap). Responses were not detected at other G proteins.
- Concentration-response curves for Salvinorin A (FIG. 32C), U69,593 (FIG. 32D), GR89.696 (FIG. 32E), BU74 (FIG. 32F), dynorphin A (FIG. 32G), ML139 (FIG. 32H), diprenorphine (FIG. 32I), and RB64 (FIG. 32J) reveal ligand-dependent shifts in transducer activity. Most ligands exhibit enhanced (GoZ) and diminished
- FIGs. 33A to 33D show dopamine family (D1-5) transducerome profiles for endogenous agonist dopamine.
- FIG. 33A shows efficacy values (% control) for dopamine concentration-response curves for DRD1-5 across the full TRUPATH platform.
- FIG. 33B shows potency values (log EC50) for dopamine concentration-response curves for DRD1-5 across the full TRUPATH platform.
- FIG 33C shows dopamine concentration-response curves for DRD1-5 at Gz.
- FIG 33D shows transducer concentration-response curves for dopamine responses at DRD5.
- FIGs. 34A and 34B show transducerome profiles for prototypic (ADRB2 and neurotensin, NTSR1) and understudied (LPA, LPAR6 and serotonin 7, 5-HT7) receptors to demonstrate the varying degrees of promiscuity of endogenous agonists.
- A Relative amplitude (Emax or efficacy) of agonist-induced stimulation of TRUPATH biosensors is frequently nonuniform for a given receptor-ligand pair.
- B Potency (Log EC50) values across the transducerome are similarly non-uniform for many receptor-ligand pairs. Data presented as mean values ⁇ SEM. Heat map values represent mean value.
- Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of chemistry, biology, and the like, which are within the skill of the art.
- GPCR-Transducer signaling complexes correlates with receptor activation and downstream responses in cells.
- These complexes can consist of native transducer proteins and/or those consisting of a“fusion" or "chimeric * transducer which contains or is fused to a BRET-like donor enzyme (e.g. Renilla luciferase, RLuc) or a BRET or FRET acceptor (e.g. GFP2).
- BRET-like donor enzyme e.g. Renilla luciferase, RLuc
- BRET or FRET acceptor e.g. GFP2
- the disclosed system is distinguished in part by the implementation of real time signaling complex formation and dissociation as a way to recapitulate signaling outside of a cellular context (i.e. in vitro) and measure activation of single pathways within a cell without the requirement for second messenger detection.
- the dynamic signaling complexes claimed may exist unfused or fused. This conceptual framework provides significant advantages detailed herein.
- ADSORB finity Directed Selection of Receptor Binders
- TRUPATH for TRansdUcerome Profile Analysis of g protein paTHways
- polynucleotide barcode or“barcode” or“polynucleotide tag” are used interchangeably and, according to the present disclosure, as used herein refer to a sequence of nucleotides, i.e., an oligonucleotide, an oligomer, or an oligo. According to the present disclosure a barcode is attached to a subject molecule. An attached polynucleotide barcode finds use in tagging or labeling a single
- macromolecule e.g., a polynucleotide, a polypeptide, a ribonucleoprotein, a carbohydrate, a lipid, a complex and the like.
- a single polynucleotide barcode also finds use in tagging or labeling a plurality of macromolecules, e.g., a group of related polynucleotides, a group of related polypeptides, a group of related
- ribonucleoproteins a group of related carbohydrates, a group of related lipids, a group of related complexes, and the like.
- Unique barcodes are used to individually differentiate members of a group from one another, e.g., unique barcodes attached to individual ribonucleoproteins serves to individually differentiate each
- Unique barcodes are also used to differentiate groups of related members, e.g., derived from the same species, derived from the same individual, derived from the same library, derived from the same experiment, derived from the same sample, etc., from other groups. For example, the same unique barcode is attached to a first plurality of related ribonucleoproteins and a second unique barcode is attached to a second plurality of related ribonucleoproteins such that when the first and second pluralities of related ribonucleoproteins are mixed the barcodes serve to indicate the group to which each ribonucleoprotein belongs.
- a polynucleotide barcode may be of any useful length, e.g., about 1-100 nucleotides, about 5-10 nucleotides, about 10-15 nucleotides, about 10-18 nucleotides, about 18-25 nucleotides, or about 25-50 nucleotides, depending on the particular contexts in which the barcode is being used and how many individual members or individual groups are preferably differentiated.
- the barcode is between about 17 to about 22 nucleotides in length, e.g., about 17 nucleotides, about 18 nucleotides, about 19, nucleotides about 20 nucleotides, about 21 nucleotides, or about 22 nucleotides.
- a barcode about 1 nucleotide in length differentiates 4 individual members or groups, about 2 nucleotides in length differentiates 16 individual members or groups, about 3 nucleotides in length differentiates 64 individual members or groups, about 4 nucleotides in length differentiates 256 individual members or groups, about 5 nucleotides in length differentiates 1024 individual members or groups, and so on.
- a barcode over about 9 nucleotides in length differentiates over 1 million unique individual members or groups and a barcode over about 14 nucleotides in length differentiates over 1 billion unique individual members or groups.
- a "fusion protein” refers to a polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide.
- the fusion protein can be formed by the chemical coupling of the constituent polypeptides or it can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein.
- a single chain fusion protein is a fusion protein having a single contiguous polypeptide backbone. Fusion proteins can be prepared using conventional techniques in molecular biology to join the two genes in frame into a single nudeic acid, and then expressing the nucleic acid in an appropriate host cell under conditions in which the fusion protein is produced.
- a "spacer” or "linker” as used herein refers to a peptide that joins the proteins comprising a fusion protein. Generally, a spacer has no specific biological activity other than to join the proteins or to preserve some minimum distance or other spatial relationship between them. However, the constituent amino acids of a spacer may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule. Additionally, linkers may be selected which comport some new functionality to the fusion (e.g. a phosphorylatable region).
- Luciferase here is used as a generic stand-in for any enzyme or protein which can, through chemical or enzymatic reaction, produce light (e.g.
- a luminescent enzyme can be replaced with a fluorescent protein to convert the technique from BRET to FRET.
- GPCRs G protein coupled receptors
- a transducer such as a native or engineered G protein a subunit (Ga), arrestin, or a signaling associated protein (e.g. a scaffolding protein, complex, or a protein or protein fragment that induces inactive or active structural changes in the receptor).
- GPCR and transducer are connected by a flexible linker.
- the system has a 1 :1 local stoichiometry, maintains appropriate membrane trafficking, and has increased fidelity to the expressed receptor/transducer pathway ( Figure 11A,B).
- fusion proteins ensure a stable complex due to high local concentration of tethered transducer.
- G proteins for signaling, resulting in a large diversity of G proteins.
- the human genome encodes roughly 800 GPCRs, 18 different Ga proteins, 4 major G pbroteins, and 12 Gy proteins (Figure 11C). It is understood that the disclosed platform can involve any available combination of these or other mammalian GPCR and suitable transducers from the same or different species. Nucleic acid and amino add sequences for GPCRs and transducer are known and available for use in the disdosed systems.
- the Ga subunit of the disdosed fusion protein can also be tagged with a
- Ga protein subunit is tagged with a fluorescent/luminescent donor, then either a G prbotein subunit or a Gy protein subunit is tagged with a fluorescent acceptor, and if the Ga protein subunit is tagged with a fluorescent acceptor, then either a G prob tein subunit or a Gy protein subunit is tagged with a fluorescent/luminescent donor.
- Fusion proteins also known as chimeric proteins, are proteins created through the joining of two or more genes which originally coded for separate proteins. Translation of this fusion gene results in a single polypeptide with function properties derived from each of the original proteins. Recombinant fusion proteins can be created artificially by recombinant DNA technology for use in biological research or therapeutics. Chimeric mutant proteins occur naturally when a large-scale mutation, typically a chromosomal translocation, creates a novel coding sequence containing parts of the coding sequences from two different genes.
- fusion proteins are made possible by the fact that many protein functional domains are modular. In other words, the linear portion of a polypeptide which corresponds to a given domain, such as a tyrosine kinase domain, may be removed from the rest of the protein without destroying its intrinsic enzymatic capability. Thus, any of the herein disclosed functional domains can be used to design a functional fusion protein or chimera. Function of the GPCR-transducer fusion proteins and select G protein-RLuc8 chimeras disclosed herein is shown in Figures 4, 11 , 12, 27, and 28. [0086] A recombinant fusion protein is a protein created through genetic engineering of a fusion gene.
- the protein can be engineered to include the full sequence of both original proteins, or only a portion of either.
- linker or ‘spacer”) peptides are also added which make it more likely that the proteins fold independently and behave as expected (see below).
- linkers in protein or peptide fusions are sometimes engineered with cleavage sites for proteases or chemical agents which enable the liberation of the two separate proteins.
- This technique is often used for identification and purification of proteins, by fusing a GST protein, FLAG peptide, or a hexa-his peptide (aka: a 6xhis-tag) which can be isolated using nickel or cobalt resins (affinity
- Chimeric proteins can also be manufactured with toxins or antibodies attached to them in order to study disease development.
- Linkers are any flexible amino-acid sequence including but not limited to the following examples:
- IRES internal ribosome entry sites
- IRES elements can be used to create multigene or polycistronic messages. IRES elements are able to bypass the ribosome scanning model of 5' methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988). IRES elements from two members of the picomavirus family (polio and
- IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. By virtue of the IRES element, each open reading frame is accessible to ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (U.S. Pat. Nos. 5,925, 565 and 5,935,819; PCT/US99/05781).
- IRES sequences are known in the art and include those from encephalomycartiitis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell. Biol., 11 :5848-5849 (1991); BIP protein (Macejak and Samow, Nature, 353:91 (1991)); the Antennapedia gene of drosophilia (exons d and e) [Oh et al., Genes & Development, 6:1643-1653 (1992)); those in polio virus [Pelletier and Sonenberg, Nature, 334:320325 (1988); see also Mountford and Smith, TIG, 11 :179-184 (1985)).
- EMCV encephalomycartiitis virus
- ADSORB is a screening strategy that relies on the differential abilities of ligand classes (e.g. agonists, antagonists, inverse agonists, allosteric modulators) to recognize or interact with different receptor states (e.g. native/unliganded, liganded, active, inactive, mutant, transducer or signaling mimetic-stabilized) (Figure 1).
- Ligands here may consist of small-molecules, biologies (e.g. proteins, peptides, antibodies, nanobodies, nudeic adds, aptamers, and derivatives) or chimeras thereof.
- Ligands may or may not be "tagged” by identifiers (barcodes) such as nucleic acids or known protein sequences for subsequent identification (e.g. via deep-sequendng, protein or small molecule mass spectroscopy, phage titering, protein microarrays, etc).
- identifiers such as nucleic acids or known protein sequences for subsequent identification (e.g. via deep-sequendng, protein or small molecule mass spectroscopy, phage titering, protein microarrays, etc).
- the ADSORB method differs from current in vitro and cell-based screening approaches that are limited to only identifying ligands that physically bind static or irreversibly conformationally constrained target proteins.
- these indude static approaches that screen complex library mixtures using i) non-specific elution strategies and unliganded or stabilized receptors, ii) cell sorting to separate ligand stoneses, and iii) biophysical methods.
- These static approaches i.e. the same target receptor does not change affinity states as part of the method) do not differentiate between receptor conformational states that, when modulated in real time as in ADSORB, permit the isolation of ligands with a pre-defined pharmacology.
- ADSORB is a dynamic method that switches between the transducer-coupled receptor and the inadiveAransducer-uncoupled receptor to control the pharmacology of the screened ligands.
- Modulating receptor or target conformational states by dynamic assodation with different transducers enables the first rational method to specifically target biased agonists in vitro.
- allostery is a fundamental aspect of protein function
- ADSORB could be applied to other proteins (e.g. kinases or transcription factors) to find new ligands with predetermined functional effects.
- the utilization of allostery here includes other reversible receptor stabilization approaches that enable on-demand switching of conformational states.
- the general process of ADSORB as it relates to GPCRs is described below:
- Target screening complexes are produced in a biological or in vitro system.
- the target can be prepared by a membrane preparation (e.g. released, separated, or sequestered in microsomes) or by a purification and isolation strategy (e.g. immuno or chemical purification methods, nano- or lipodisc, detergent micelle, liposomal, or lipidomimetic environment, with or without the use of further purification or isolation methods).
- the target preparation may or may not be oriented to expose different receptor surfaces for screening.
- the target complexes may or may not be (depending on requirements of assay) immobilized (e.g. bound to affinity bead resin, magnetic resin, column, plate, flow-cells, SPR chips, arrays) or used in the“raw” or crude form (e.g. collected by standard methods of centrifugation or filtration).
- the tethered transducer may consist of the“tagged” (e.g. Renilla luciferase) or native form and need not be a G protein (transducer here also refers to other proteins and methods to reversibly stabilize receptor states).
- the "tagged" form may be used to quantify expression or target yield against known standards as some targets lack tools or methods to quantify their expression or yield.
- a known tagged-receptor-transducer fusion is expressed and quantified by methods such as radioligand saturation binding. Via titration, this standard is diluted and probed with a substrate for the tagged luciferase to determine the relationship between luminescence and unit of target determined by standard methods. The“unknown" tagged target is similarly titrated in the luciferase assay to determine the relative concentration or yield by interpolation of the standard curve derived from the known standard ( Figure 10).
- Targets are exposed to (i.e. treated or screened with) ligand libraries (collections curated or otherwise, natural product extracts or tissue preparations)— this may consist of incubations of varying duration, washing or otherwise flowing ligands across or through the target preparation.
- the flow-through/un-bound fraction of the library can be collected for further analysis or subsequent screening (e.g. as a negative selection tool).
- The“treated” target may or may not be washed to identify “stronger” or more selective interacting ligands or to create a more stringent selection strategy— all flow-through from wash-stages may be captured for analysis as in the initial eluate.
- ADSORB chemical denaturants such as acids, bases, urea, methanol, or detergents (nonspecific agents) or competing small molecules can elute all remaining binders, an important consideration for elution of conformational state- insensitive ligands (e.g. antagonists).
- the functional elution strategy of ADSORB modulates target conformational states in real time to facilitate target ligand dissociation and detection.
- conformational state modulation mimics receptor-mediated activation of the tethered transducer in cells, thus recapitulating a cellular activation event in a precisely controlled in vitro environment and solving the problem of in vitro assays lacking function.
- Such a novel method dismisses and overcomes the notion that functional screening can only be done in cells.
- the ADSORB method works because GPCRs are allosteric machines that switch between high affinity transducer-coupled states (active) and low affinity uncoupled states (inactive). Balanced and biased signaling is encoded within these state transitions (Strachan RT et ai. J Biol Chem.
- Ligands that elute from different GPCR- transducer complexes will exhibit general or biased activation of those different pathways in cells.
- Ligands that are insensitive to modulation of receptor states can be eluted using nonspecific or biospecific (i.e. a competing ligand) elution techniques after functional elution.
- functional elution with GPPNHP can be enhanced by the addition of sub-saturating concentrations of a competitive ligand.
- functional elution could also include the combined use of state modulation and competitive inhibition.
- Functional analysis of the elution may consist of bulk-screening eluates in signaling assays (e.g. TRUPATH defined in later section, TANGO assay, GTPyS, Promega Glosensor cAMP, FLIPR calcium mobilization assays, radio- labeled inositol trisphosphate accumulation, cAMP accumulation, Ras/Rac/Rho assays, transcriptional reporters, etc.).
- signaling assays e.g. TRUPATH defined in later section, TANGO assay, GTPyS, Promega Glosensor cAMP, FLIPR calcium mobilization assays, radio- labeled inositol trisphosphate accumulation, cAMP accumulation, Ras/Rac/Rho assays, transcriptional reporters, etc.
- the specific contents of the eluates may also be identified by deep sequencing of nucleic acid barcodes, protein microarrays, small molecule or protein mass spectroscopy, phage tittering,
- Contents of eluates can also be amplified to subsequently enrich future ligand libraries for subsequent and iterative screening.
- This multi-round selection strategy is an iterative process to enrich for ligands with preferences for the desired receptor affinity state. Multi-round selection can also be used as mentioned above for negative selection.
- the determined selected components of the library can be compiled into a database for other purposes (e.g. computational analysis and deconvolution, subsequent structure activity relationship analysis, artificial intelligence/machine learning for in silico drug discovery and computational sorting and design, or for further iterative screening purposes involving medicinal chemistry).
- This selection strategy may be used iteratively as needed for as many rounds as required.
- the information set for each transducer-tethered target can be used to identify differential affinities of the same or different ligands for the different states (hereafter referred to as signaling bias).
- GPCR G protein-coupled receptor
- agonists will bind less tightly to the low affinity state of the receptor which involves an increase in ligand dissociation rate (i.e. it functionally elutes).
- panel 1 B under experimental conditions in which an active complex is intact (e.g. immobilized cell membranes expressing a GPCR-G protein fusion), library agents (in this case nucleic acid-tagged small molecules) will bind tightly to the complex and resist washing ( Figure 1C).
- an active complex e.g. immobilized cell membranes expressing a GPCR-G protein fusion
- library agents in this case nucleic acid-tagged small molecules
- GPCRs are also found in other organisms and could be used as targets for other purposes including, for example, agricultural pest control and control of disease vectors (e.g. mosquitoes), and so this approach can extend across species and biological systems and encompass genetic variants to identify selective ligands due to differences in their allostery.
- disease vectors e.g. mosquitoes
- One-shot screening i.e. using only one round of ADSORB
- libraries could be achieved using very stringent wash protocols or using microfluidics such as those common to surface plasmon resonance (SPR) machines or those using magnetic beads.
- SPR surface plasmon resonance
- Automated immobilization of target complexes, library incubation, washing, functional elution, and recovery of eluted library agents would greatly increase the selectivity and efficiency of ADSORB screens.
- TRUPATH is a comprehensive signal transduction profiling assay that correlates heterotrimeric G protein dissociation with downstream signaling. It can be run in unfused or transducer-receptor-fused scenarios and is based on the concept of Ftirster Resonance Energy Transfer.
- the described application herein relies on a bioluminescent donor enzyme, a derivation called Bioluminescence Resonance Energy Transfer (e.g. BRET) ( Figure 3A).
- BRET Bioluminescence Resonance Energy Transfer
- Figure 3A The advances described herein can also be applied to the analogous formulation wherein two fluorescent molecules are used rather than a luminescent donor and fluorescent acceptor (e.g. Fluorescence Resonance Energy Transfer, or FRET).
- BRET Fluorescence Resonance Energy Transfer
- association or dissociation or proximity of two entities (e.g. proteins).
- one interacting partner is tagged or labeled with a luminescent enzyme (a donor, e.g. Renilla luciferase) which can catalyze the breakdown of a substrate that produces light as a byproduct at a desired wavelength.
- the other interacting partner is tagged with a fluorescent protein with appropriate absorption and emission wavelengths (an acceptor, e.g. GFP2). If the acceptor is close enough to the site of chemical reaction the luminescence can exdte the fluorophore producing fluorescence. This is known as resonance energy transfer.
- the relative change in the ratio of these two signals is a measure of the changing association or dissociation of the two partners. Extending this principle to known interacting partners of targets (such as heterotrimeric G proteins) measures the activation of these signaling pathways.
- G protein pathway activation e.g. the dissociation of the GaGbGg complex
- a GPCR is an allosteric machine that catalyzes the exchange of one nucleotide (e.g. GDP) for another (GTP) in the subunit of a physically associated Ga protein.
- the Ga protein when inactive is closely associated with the GGgb subunit (an obligate dimeric complex).
- the complex dissociates when the receptor is active (natively, by mutation, or perturbation by a ligand as defined above) and changes to the rate or magnitude of activation of the receptor can be determined by the changing BRET ratio of these complexes.
- insertion sites for the donor and acceptor within the Ga subunits have been empirically determined and optimized ( Figures 7,13-25, Tablel), and the optimal GGbg subunit complex for each Ga has been empirically identified ( Figures 7, 13-25, Table 1). If required, fusing the Go to the receptor (e.g.
- TRUPATH biosensor compositions are novel as insertion sites for the donor/acceptor within the Ga subunits and GGbg acceptor pairs have been empirically determined and optimized (see below for detailed explanation, Figures 3, 7, 13-25).
- a list of top performing insertion sites is included in Table 1 and their improvements over existing BRET assays are detailed in Figure 29 and Table 2.
- GGbg dimer pairings are relatively equivalent, as are certain GGbg dimer pairings, which is reflected in the top amino acid (AA) positions and GGgb compositions listed for each G protein in Table 1.
- TRUPATH biosensors frequently use atypical GbGg pairings (e.g. 0b30g9 and 0b30g13) (Table 1).
- current standard 0b10g1 and 0b10g2 dimers underperformed at all but one sensor, GsLong, although 0b10g1 was practically indistinguishable from 0b40g1 ( Figure 21 D, Table 1).
- we disclose and claim for each G protein the top five Ga-Rluc chimeras, top five Gy-GFP subunits, and all Gb subunits since they were frequently equivalent Table 1.
- a completely unexplored and non-obvious region for luminescent or fluorescent insertions is disclosed herein. Specifically, we identified a flexible linker region extending from the B4-strand to the a3 helix of the Ras-like domain (Switch III, Figure 26 A). No known chimeric proteins have been generated in this region, likely because mutations within or deletion of the entire Switch III region are thought to negate functional coupling of Ga to its effector. Contrary to this prediction, insertion of RLuc8 into this region (Ga11 (241>RLuc8, Figure 26B) yielded a construct that performed identically to its wildtype counterpart.
- the TRUPATH platform can be enhanced by generating polycistronic triple plasmids' that encode Go, G ⁇ , and Gy subunits under the same promoter using 2A self-deaving peptide and internal ribosome entry site sequences (Figure 30A.B). Here it is shown to work with the TRUPATH G ⁇ i3 biosensor ( Figure 30C). Compared to a quadruple co-transfection protocol, the triple plasmid strategy increases the NET BRET signal ( Figure 30C) and will improve the between- experiment consistency. Preliminary results (Figure 30C) show that there is no difference in the measured ligand pharmacology between approaches.
- TRUPATH can be used to i) assay dose-responses of known ligands or those derived from ADSORB in an effort to determine their efficacies, potencies, or allosteric properties, or ii) assay single point concentrations of ligand across multitudes of conditions (matrix) or large ligand libraries. Conversely, TRUPATH can precede ADSORB to identify transducer preferences that can then be used to screen and isolate new pathway-specific ligands (i.e. tailor ligand pharmacology).
- the GPCR-GaRLuc8 fusion protein corresponding to the signaling pathway activated in TRUPATH will serve as the target complex for uHTS of extremely large ligand libraries in ADSORB. Miniaturizing this platform to 384-well ( Figure 31) or smaller will accommodate larger scale screening as well as simultaneous reading of BRET to enable kinetic data acquisition.
- ADSORB and TRUPATH are complementary technologies, which as a platform enable large scale profiling of all signaling pathways that can facilitate rapid and targeted screening of complex ligand mixtures, and vice versa. Together, these technologies greatly expand the signaling space and chemical space available to GPCRs, thus increasing our understanding of GPCR function in human health and disease and our ability to treat its dysfunction.
- TRUPATH screening has many uses. These include but are not limited to: 1) comprehensive profiling of signaling for any given ligand-GPCR pair, 2) profiling the signaling of receptor mutants and variants (pharmacogenomics), and 3) profiling the signaling of understudied GPCRs and orphan GPCRs (i.e. receptors that lack an endogenous agonist or well-defined physiological function).
- Example 1 Affinity-Directed Selection of Receptor Binders (ADSORB) enables specific Isolation of opioid receptor agonists.
- GPCR-transducer fusions in which the top Ga-RLuc8 chimera from TRUPATH (Table 1) is fused via its N-tenminus to the C-terminus of a GPCR can be generated via standard cloning methodologies such as Gibson assembly. Fusions between proteins can be direct or use any of the linkers detailed above. See the Genbank formatted example of a receptor-Galpha-Rluc fusion protein (Neurotensin-Gq) provided below.
- Microsomal membrane preparation A given GPCR-transducer fusion in a mammalian expression vector is transiently transfected into HEK293 suspension cells (30mg DNA/30ml_ culture) for overexpression. Microsomes are prepared 36-48 hr post-transfection using differential centrifugation. Briefly, cells are collected at 300xg for 10min at RT. Cell pellets are resuspended in 10mL Homogenization Buffer (50mM TrisHCI, 2mM EDTA, 1X protease inhibitors, pH7.4) and dounce
- Lysed cells are centrifuged 500 x g for 10min at 4'C.
- the low speed supernatant is transferred to a 30mL centrifuge tube and microsomes are collected at 35,000 x g for 60min at 4°C.
- the high-speed pellet (P2) is resuspended in 1 mL of Resuspension Buffer (50mM TrisHCI, 2mM EDTA, 10mM MgCh, 5% glycerol, 1X protease inhibitors, pH7.4) and aliquoted into 1.5mL tubes.
- Membranes pellets are collected at max speed in a table top centrifuge (14000 x g for 30min) at 4°C. The supernatant is removed and pellets are frozen and stored at -80oC until use.
- the membrane pellet is recovered at 18000 x g for 10min at 4 e C.
- Microsomes are resuspended in a library surrogate (KD concentration of [ 3 H]agonist radiotracers like pH]DAMGO or pHJUegSOS, or pHJantagonist radiotracer like pHJNaloxone) and incubated for 2hr at RT with end-over-end mixing.
- the membrane pellet is recovered at 18000 x g for 10min at 4°C. Supernatant is removed and membrane pellet washed by resuspension in 1 mL cold binding buffer.
- Membranes are recovered at 18000 x g for 10min at 4°C.
- This step is repeated four times for a total of 5 washes, with the last wash split according to the different elution conditions (e.g. buffer or GPPNHP).
- the final wash is removed and the pellet is resuspended in 500pL of binding buffer or GPPNHP elution buffer. Incubate at RT for various times (typically 1 to 5 min). High speed centrifugation is used to pellet the membrane and the supernatant containing the eluted ligands is saved for downstream processing. In the case of a radiotracer we performed scintillation counting to detect the number of ligands at each step. Elution steps can be repeated as needed to recover the ligand. Functional elution can be followed with general elution (e.g. 0.2M Glycine, pH 2.2) for recovery of all other binders.
- general elution e.g. 0.2M Glycine, pH 2.2
- FIG. 2B shows quantification of ADSORB screen at the mu-opioid receptor (MOR) fused to G ⁇ il protein.
- MOR mu-opioid receptor
- FIG. 2C shows quantification of ADSORB screen at the kappa-opioid receptor (KOR) fused to G ⁇ M protein.
- KOR kappa-opioid receptor
- FIG. 2D shows quantification of ADSORB screen at the mu-opioid receptor unfused (MOR) and fused to GCBI-RLUC8 chimera (MOR-GM RLuc).
- the radiotracer in this experiment is the antagonist [3H]-Naloxone.
- FIG. 2E shows the same experimental setup as in FIG. 2D but instead uses an agonist radiotracer ([3H]DAMGO), low affinity MOR membranes, and high affinity MOR-GM RLuc complexes. Quantification of counts per minute (cpm) shows high preferential adsorption of the agonist to the MOR-GM RLuc complex (23% unbound tracer) compared to unfused MOR (67% unbound tracer).
- cpm counts per minute
- ADSORB preferentially binds and elutes agonist ligands from GPCR-transducer complexes.
- high efficacy agonists should predominate in the functionally eluted fractions of later rounds.
- GPCRs G Protein Coupled Receptors
- the luminescent donor and fluorescent acceptor can be exchanged (i.e. it is not necessary that the luminescent donor be on the Ga, and could for the intended purposes be located on the Gb or Gy subunit).
- Peptide sequences for Ga subunits are used to generate maps of known or putative flexible or disordered domains. This can be done either by using published structures or through modeling of amino acid sequences for less well understood Ga subunits against known structures with high similarity (Table 3). Plasmids containing human Ga, Gb, and Gy constructs were obtained from public resources, except for Ga12 and Gagustducin, which were synthesized as gene blocks. All constructs were subcloned into pcDNAS/FRT/TO.
- Chimeric constmcts (e.g. G ⁇ -RLuc8 and Gy-GFP2 constructs) were generated via Gibson assembly-type methods.
- Gy-GFP2 constructs were generated by amplification of the backbone construct (e.g. pcDNA-Gy) from the N-terminal start codon and adding homology to the C-terminus of GFP flanked by a short flexible linker sequence (GSAGT).
- GFP2 sequences were amplified by PCR, adding homology to the pcDNA backbone at the 5’ end, and homology to the N-terminus of the Gy sequence at the 3’ end.
- Backbone and insert constructs were co-incubated with Gibson-assembly master mix and transformed into competent E. coli.
- G ⁇ -RLuc8 constructs were generated by linearizing a single backbone template for each region (e.g. oA-aB linker region, aB-aC helical region, Switch III), amplifying outwards from the 5’ and 3‘ ends of the beginning of those respective regions— producing a linearized construct lacking that sequence.
- These deleted codons were filled in with RLuc8 insertion sequences by overhang PCR while adding a flexible SGGGS linker, the missing codon sequences flanking the appropriate insertion site, and homology to the 5’ and 3' end of the linearized backbone. These were incubated with Gibson- assembly master mix to assemble G ⁇ -RLuc8 chimeric constructs containing a fully intact Go with an RLuc8 sequence, one for each amino-acid position within the targeted region.
- the optimal G ⁇ -RLuc8 chimera is fused via its N-terminus to the C-terminus of a GPCR using standard cloning methods. See the Genbank formatted example of a receptor-G ⁇ lpha-Rluc fusion protein (Neurotensin + Gq) provided below.
- Biosensor optimization can be performed as follows using either a co- transfection of receptor and G ⁇ Rluc variants or an N-terminally fused GPCR-G ⁇ Rluc chimera (Figure 3).
- Figure 3 The following text describes optimization in the context of a GPCR-G ⁇ fusion but can be applied to a“non-fused” Go construct. First identify a suitable prototype GPCR if not using one already fused to the Go’s N-terminus.
- the standard G ⁇ 1 Gy2-GFP2 dimer is a good starting point. Any combination can be tried at first (including switching the fluorescent protein from the Gy to the G ⁇ subunit) if little BRET is observed.
- cells can be plated in a plate suitable for use in a luminescence/ fluorescence plate reader (or read right away if transfected directly in such a plate). Treatment of wells with luminescent substrate and a known agonist (either at single points or to produce a dose-response curve) can be used to observe the relative change in BRET from basal conditions.
- the top 5 insertion sites based on NET BRET (number can be modified based on needs) can then be retested to be confident that the optimal insertion site has been identified (Figure 3F). All Gb subunits can then be co-precipitated and the optimal construct transfected in parallel with each fluoresce ntly-tagged Gy subunit (separate transfections for each Gy subunit, Figure 3G). Alternately this can be done without co-precipitating by running a large matrix. The order of this can be reversed if/when tagging the Gb subunit with the fluorescent acceptor. A dose-response assay may be performed to determine the optimal donor/acceptor pair.
- the optimal Ga-RLuc (or GPCR-GaRLuc fusion) and the optimal acceptor construct can be taken, and then each of the untagged Gb or Gy substituents can then be separately transfected (Figure 3H).
- a concentration response experiment can be performed to verify the optimal heterotrimeric substituents.
- gaggaggata tcgccctgat caagagcgaa gagggogaga aaatggtgct tgagaataac 2401 tlcttcgtcg agaccgtgct cccaagcaag atcatgcgga aactggagcc tgaggagttc
- a mammalian expression vector containing any GPCR can be used to screen the complete set of TRUPATH G protein sensors (Table 1) for any number of ligands.
- a single expression vector utilizing multiple promoter regions or IRES (or similar sites) can be employed to express the entire system from a single plasmid (described here as a triple plasmid or polycistronic vector ( Figure 30A,B).
- a suitable plate for the instrument/plate-reader e.g. a 96-well plate, 384, 1536, etc. This step is unnecessary if the cells are transfected directly in such a plate.
- cell media is aspirated off and washed with an assay buffer (e.g. a buffered saline solution).
- an assay buffer e.g. a buffered saline solution
- ligands or substrate can be determined by the experimenter, but in a general experiment a substrate for the luminescent enzyme is added and allowed to equilibrate in solution with the cells (optional). Test ligands are then added (single point or dose response) and either read in the plate-reader right away or after a pre-determined amount of time.
- Dose response curves can be analyzed using conventional pharmacological methods (e.g. three parameter logistic model) to estimate parameters such as efficacy (Ema)0 and potency (EC50) ( Figure 32).
- Ema efficacy
- EC50 potency
- Bias at each transducer can be calculated using published standard pharmacological formulas (e.g. Onaran HO et al. Sci Rep. 2017 Mar14;7:44247) or other model free methods.
- the relative efficacies can be measured by comparing the net BRET values from the experiment above against a standard receptor/alpha/ligand (e.g. Neurotensin for most G proteins except for Gs isoforms (beta2-adrenergic receptor) or GaGustducin (KOR)).
- a standard receptor/alpha/ligand e.g. Neurotensin for most G proteins except for Gs isoforms (beta2-adrenergic receptor) or GaGustducin (KOR)
- the basal activities of the receptor can be evaluated relative to a receptor with known low constitutive activity, or in the case of Gai class proteins, pertussis toxin can be used.
- Other toxins and inhibitors for G proteins can be similarly used.
- toxins such as cholera or Pasteurella multodda toxin can be used to irreversibly activate G proteins, thus providing a theoretical“maximum” response for the assay.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- Toxicology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Plant Pathology (AREA)
- Endocrinology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Mycology (AREA)
Abstract
Disclosed herein is a G protein-coupled receptor (GPCR) assay platform comprised of two complementary systems that equate dynamic intermolecular interactions between a receptor and transducer with more complex stimulus-response cascades in living cells. In the disclosed in vitro ADSoRB method, the forced dissociation of transducers like G protein heterotrimers from receptors alters receptor conformations and ligand interactions to simulate pathway activation in a cell. In the disclosed TRUPATH method, measuring the extent of engineered G protein heterotrimer complex dissociation provides single transducer resolution in a cell.
Description
G PROTEIN-COUPLED RECEPTOR SCREENING SYSTEMS
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims benefit of U.S. Provisional Application No. 62/775.045, filed December 4, 2018, and U.S. Provisional Application No.
62/886,452, filed August 14, 2019, which are hereby incorporated herein by reference in their entireties.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR
DEVELOPMENT
[0002] This invention was made with government support under Grant Numbers MH 109943, NS093917, MH104974, MH112205, and DA045657 awarded by the National Institutes of Health. The government has certain rights in the invent.
SEQUENCE LISTING
[0003] This application contains a sequence listing filed in electronic form as an ASCII.txt file entitled‘921404-2050 Sequence Listing_ST25‘ created on
November 25, 2019. The content of the sequence listing is incorporated herein in its entirety.
BACKGROUND
G protein-coupled receptors (GPCRs) are modulated by 34% of FDA- approved drugs (Hauser AS, et al. Nat Rev Drug Discov. 2017 16(12):829-842), making them the most highly targeted receptors in the clinic. Current GPCR drugs have a rather broad mechanism of action— they activate (agonist), block (antagonist), or allosterically modulate numerous signaling pathways downstream of their target receptor. Driving much of the recent progress in GPCR molecular pharmacology has been the notion that selective modulation of distinct GPCR pathways (i.e., those associated ONLY with therapeutic effects) will yield safer and more efficacious next- generation biased therapeutics (Kenakin T. Mol Pharmacol. 2015 88(6):1055-61). However, GPCR signal transduction is immensely complex (~350 druggable GPCRs activate any number of 16 different canonical G protein signaling pathways and an untold number of non-canonical pathways), which complicates efforts to 1) understand the individual contributions of each pathway in normal and diseased states and 2) identify and design biased agonists. As a result, drugs with engineered biased signaling profiles have yet to hit the market, although several are in the (pre)clinical pipeline (Hodavance SY, et al. J Cardiovasc Pharmacol. 2016 67(3):193- 202).
[0004] Current drug discovery campaigns are limited when it comes to discovering biased agonists for several reasons. First, most screening strategies exploit cell-based assays that are highly amplified, inefficient, and have low fidelity to the actual pathway under study. Second, good assays exist for only a small fraction of the 16 non-visual G protein signaling pathways in humans, thereby limiting therapeutic intervention to only the best studied pathways. Third, little is known about which pathways to target for a desired therapeutic effect (Michel MC, et al. Mol Pharmacol. 2018 93(4):259-265). Fourth, current physical screening approaches are unable to isolate ligands with a desired pharmacology from chemically diverse and complex ligand mixtures (e.g. mixtures of >1x109 unique small molecules or peptides). Clearly, GPCR drug discovery needs alternate screening approaches. Disclosed herein is a complete drug discovery platform for i) isolating new chemical matter with predefined pharmacology from complex libraries and ii) comprehensive profiling of signaling pathways to uncover biased signaling.
SUMMARY
[0005] Disclosed herein is a G protein-coupled receptor (GPCR) assay platform comprised of two complementary systems that equate dynamic
intermolecular interactions between a receptor and transducer with more complex stimulus-response cascades in living cells. In the disclosed in vitro ADSORB method, the forced dissociation of transducers like G protein heterotrimers alters receptor conformations and ligand interactions to simulate pathway activation in a cell. This conceptual framework enables isolation of ligands with a defined pharmacology from complex library mixtures in vitro. In the disclosed TRUPATH method, measuring the extent of engineered G protein heterotrimer complex dissociation provides single transducer resolution in a cell. Transducers can exist unfused or fused to the GPCR and can include engineered heterotrimeric G proteins (Ga(Rluc)/GPy-GFP), an engineered Ga(Rluc) subunit, native heterotrimeric G protein, native Go subunit, anrestin, a signaling associated protein, or a protein or protein fragment that through reversible coupling induces active or inactive structural changes in the receptor (e.g., antibodies or nanobodies or similar proteins and peptides). In cases where complex stability and extreme specificity are required, the GPCR and transducer are connected directly or by a flexible linker (see ADSORB method below). By fusing transducers to the receptor, the system constitutes a biologically relevant complex, has a 1 :1 local stoichiometry, maintains appropriate membrane trafficking, and has fidelity to the fused transducer pathway. The two screening systems are disclosed below.
[0006] The first in vitro screening system using the disclosed modulation of receptor-transducer interactions, referred to herein as ADSORB (Affinity-Directed Selection of Receptor Binders), leverages the differential affinity that ligands display toward distinct receptor conformational states (known as molecular efficacy;
Strachan RT et al. J Biol Chem. 2014:289(20):14211-24) to enable rapid isolation of GPCR ligands with a defined pharmacology (Figure 1). In terms of G protein transducers, signaling complex formation involves intermolecular interactions between the receptor and G protein that alter receptor and transducer conformations, which is accompanied by increased binding affinity of activating ligands (i.e. agonists; De Lean A et al. J Biol Chem. 1980 Aug 10;255(15):7108-17). Upon signaling complex uncoupling or dissociation concomitant with transducer activation, receptor- transducer allosteric interactions are broken, thus converting the receptor to a low affinity conformational state that binds agonists with low affinity. By virtue of lowering ligand affinity and thus increasing the dissociation rate, ligands with significant molecular efficacy (e.g. agonists with a large preference for the activated state relative to the inactive state) are specifically eluted (Figure 1). This elution strategy is considered a 'functional elution’ as the ligands that are eluted should predominantly be agonists or positive allosteric modulators. Other methodologies use unliganded receptors, static complexes, stabilized receptor conformations, and/or non-specific elution strategies that provide little control over ligand pharmacology. Unlike in these other methodologies, antagonists and other non-specifically bound molecules remain bound in the ADSORB method as their affinity is not modulated by transducer- mediated allosteric effects. Consequently, the ADSORB method provides a cleaner elution of target molecules and requires less downstream validation and removal of false positives. If anything, molecules like inverse agonists would be bound tighter as the receptor ensemble shifts towards predominantly inactive states. Such molecules could be eluted subsequent to agonists. As described herein, quickly switching between high and low affinity states for the same target receptor enables the binding and recovery of different ligand classes (e.g. agonists vs. antagonists). Notably, this in vitro strategy (i.e. switching affinity states) simulates cellular signaling processes at the level of ternary complex interactions to enable 1) screening of ligands in vitro with the same outcome as screening in cells, 2) efficient screening for ligands with a predefined pharmacology, 3) expansion of chemical space for new chemotypes by screening high complexity libraries, and 4) efficient and targeted screening for biased agonists. Therefore, disclosed herein is a method that relies on the real time switching between active and inactive receptor states as a correlate of cellular
signaling to confer function to in vitro screens to screen extremely large and complex libraries.
[0007] Therefore, disclosed herein is a system comprising a G protein coupled receptor (GPCR) fused to a transducer (GPCR-transducer fusion) and incorporated into a membrane or nanodisk/lipodiso-type environment. Broadly, ADSORB is a scalable platform involving fusions between any GPCR and any transducer (i.e. at the very least it applies to any GPCR and known transducer combination, totaling >12,800 biological complexes), which are then expressed in membranes (e.g., the active complex, Figure 1A). In addition to known signal transducers, ADSORB also includes yet-to-be discovered signal transducers as well as signaling mimetic proteins or engineered receptors that reversibly alter the receptor conformational ensemble, as described herein. In its most common embodiment, the ADSORB GPCR-transducer fusion contains the optimal GPCR- Ga(Rluc) construct determined from TRUPATH screening below. The system can also contain Gb and Gy protein subunits as described further herein. Since each unique GPCR-transducer fusion target represents conformational ensembles that activate different signal transduction pathways in the cell, the pharmacology of each screen can be directed by simply changing the type of fused transducer. This provides unprecedented control over both the receptor target and the intended ligand function (i.e. activation of a given transducer signaling pathway).
[0008] Also disclosed is a method for identifying ligands with differential affinities toward different transducer complexes, wherein the GPCR and the transducer are initially coupled in an active GPCR-transducer complex The method can then involve contacting the system with a composition comprising a plurality of candidate agents (Figure 1 B). Those agents with affinity for the GPCR-transducer complex will bind strongly as a ternary complex (ligand-GPCR-transducer), while the rest of the candidate agents can be washed away (Figure 1C).
[0009] The method then involves uncoupling the transducer from the GPCR in real time (i.e. ternary complex dissociation; this also extends to any method that enables quick reversal of receptor conformational stabilization)— a major distinguishing step absent from previous static methodologies that use unliganded receptors, static complexes, irreversible mutant stabilized receptor conformations (e.g. thermostabilization), and/or generic elution strategies (e.g. heat, solvents, or pH). This can be accomplished, for example in the case of receptor-G protein ternary complexes, using an effective amount of non-hydrolyzable guanine nucleotide (GPPNHP, Figure 1 D) or other agents as listed below.
[0010] The method then involves eluting bound candidate agents from the system. The eluted candidate agents represent ligands with differential affinity for the GPCR in an active-like vs. inactive-like state (i.e. they bind tightly to transducer- coupled but not the uncoupled GPCR), and thus can activate the same transducer in live cells according to classic receptor theory (Kent et al. Mol Pharmacol 1980 17(1)14-23). Proof-of-concept is shown in Figure 2A-D with full agonists of different opioid receptors (ORs). Of note, the data in Figure 2E and 2F show the ability to bind and elute an agonist (DAMGO) that signals efficaciously through the mu-opioid receptor, whereas the antagonist (naloxone) fails to bind and elute from the complex
[0011] The method can further involve repeating the above steps using the eluted candidate agents to enrich for high efficacy ligands (applies equally to agonists, allosteric modulators, and inverse agonists; thus, it includes activators and inactivators of receptor pathways). Wash stringency can be adjusted to select for agents with varying binding affinities as well as increase the ability to direct agent pharmacology. Elution times can also be adjusted to enrich for agents with differing pharmacological effects. For example, full agonists or full inverse agonists should elute quickly, whereas ligands with modest efficacy and high affinity for the uncoupled receptor will elute more slowly. The combined use of switching receptor affinity states and applying a competitive ligand increases ADSORB functional elution (Figure 2G). Modifying the stabilization strategy and elution conditions can also yield dominant negative ligands that stabilize the receptor-transducer complex and inhibit signaling.
[0012] ADSORB is a selection strategy that relies on the differential affinity of ligands to recognize or interact with different receptor states (e.g. native/unliganded, liganded, active, inactive, mutant, transducer or signaling mimetic-stabilized). In some embodiments, the candidate agent can be an agonist, antagonist, inverse agonist, or allosteric modulator. The candidate agent can be any molecule, such as a small-molecule, biologic (e.g. peptide, protein, antibody, nanobody, nucleic acid, aptamer), or a derivative or combination thereof, with the potential to differentially bind the GPCR depending on the receptor state. In some embodiments, the composition is a phage displaying the candidate agents, e.g. peptide candidate agents. The candidate agent can be from a library (e.g., peptide phage display, macrocycle libraries, DNA-encoded libraries, pooled small molecules, pooled peptides, tissue extracts, natural product extracts, yeast display, or other preparations, Figures 1 and 2).
[0013] In some embodiments, each candidate agent is tagged with an identifier, such as a nucleic acid barcode, to identify which of the plurality of candidate agents are present in the eluted fraction. In other embodiments, each agent can be identified using procedures such as small molecule mass spectrometry and peptide mass spectrometry.
[0014] The GPCR-transducer fusion is preferably integrated into a membrane or similar environment, such as a lipid bilayer. In the simplest embodiment, the GPCR-transducer fusion is incorporated into the membrane of a cell (microsomes from mammalian, insect, or other systems like virus-like particles, VLPs) in which it was expressed. Microsomes can be prepared using standard differential centrifugation techniques, with the potential to control the orientation of the GPCR- transducer fusion as‘right-side-out' or‘inside-out’ for orientation-specific screening.
In some embodiments, the GPCR-transducer fusion is incorporated into a detergent micelle, the membrane of a liposome, or a lipid nanoparticle. For example, the liposome can comprise a molecule such as dimyristoylphosphatidylcholine (DMPC).
In others, the GPCR-transducer fusion is incorporated into lipid nanoparticles stabilized by apolipoproteins or copolymers.
[0015] In some embodiments, the GPCR-transducer fusion protein in a membrane or similar environment is immobilized on a bead (e.g. agarose or magnetic beads). In others, the GPCR-transducer protein can be recovered using centrifugation, filters, or surface immobilization such as on a surface plasmon resonance (SPR) sensor chip or array.
[0016] GPCRs have already been targeted by small molecules, proteins, endogenous and exogenous peptides, macrocycle ligands, aptamers, and antibodies; therefore, libraries of these types can yield ligands with novel chemotypes and pharmacology. Because GPCR ligands with large efficacies favor binding to active signaling complexes over the free receptor by several orders of magnitude, library molecules recovered by this system are likely to have considerable‘molecular efficacy' and maximally activate (or inactivate) distinct cellular pathways. The disclosed ADSORB strategy allows for isolation of orthosteric and allosteric ligands from a much greater chemical space, with the potential to discover new chemotypes and thus new biology and therapy. Notably, given the allosteric basis for ADSORB (i.e. the positive cooperativity between a ligand and given transducer), transducers could also include proteins or their fragments or other engineering methods that reversibly stabilize active and inactive receptor states. In terms of stabilizing inactive states, this could enable preferential isolation of inverse agonists or negative
allosteric modulators using the same methodology (i.e. inverse agonists and negative allosteric modulators favor inactive states, just as agonists or positive allosteric modulators favor active states). For this to function as a typical ADSORB assay, it could involve the engineering of domains into the inactive state stabilizers that are sensitive to small molecules or other agents that would alter protein conformation or induce other changes to promote dissociation from the receptor. The rather high affinity of inverse agonists for the low affinity uncoupled receptor would likely require additional agents like competitors to enhance dissociation (shown for an agonist in Figure 2G). Alternatively, an engineering method that would allow the receptor to switch from inactive to active states (e.g. an engineered receptor that could be forced to adopt states with high constitutive activity) would similarly elute inverse agonists by way of negative cooperativity. By mimicking cellular signaling in vitro to provide control over ligand pharmacology (i.e. it overcomes the problem of in vitro assays lacking biological function), this technology delivers on multiple levels including: 1) the development of new ligands with diverse chemotypes and signaling properties for GPCRs, with the potential to aid computational efforts; 2) the development of biased drug-like molecules; 3) the identification of biased tool molecules that can be used to isolate and study signaling pathways downstream of GPCRs in vivo; 4) the discovery of tool molecules to activate orphan GPCRs to reveal their (patho)physiology; and 5) the discovery of novel allosteric modulators with tailored effects.
[0017] The second in vitro screening system using the disclosed modulation of GPCR-transducer complexes, referred to herein as TRUPATH (for
TRansdUcerome Profile Analysis of g protein paTHways), can be used to measure G protein pathway activation by an agent. The initiating steps for G protein stimulus- response cascades are receptor-mediated guanine nucleotide exchange at the Ga- subunit of the Ga/Gbg heterotrimer and subsequent dissociation or rearrangement of the heterotrimeric complex (see ADSORB Figure 2A). This leads to effector activation (Gether, U. and Kobilka, B. K. J. Biol. Chem. 1998 273, 17979-1798). A change in the resonance energy transfer between fluorescently (FRET) or luminescently (BRET) labeled G protein subunits correlates with this activation event and has been used as a proxy for direct measurements of ligand-receptor-transducer coupling (Janetopoulos, C et al. 2001 Science 291 , 2408-2411)(Sauli6re, A. et al. 2012 Nat. Chem. Biol. 8, 622-630)(Mastop, M. et al. 2018 PLOS ONE) (Figure 3A). Because optimal FRET and BRET probe pairs depend upon both the proximity of the donor and acceptor proteins as well as the orientation of their transition dipole moments (Figure 3B), the do novo design of high performing Ga/Gbg sensors is challenging
and non-obvious. As described herein, we designed new high-performing Ga/Gbg BRET pairs (Tables 1 and 2, Figure 29) using a purely empirical approach.
[0018] In these embodiments, the transducer is the Ga subunit tagged with a luminescent donor or fluorescent acceptor (Figure 3A). In these embodiments, if the Ga protein subunit is tagged with a luminescent donor, then either the G probtein subunit or the Gy protein subunit is tagged with a fluorescent acceptor; and if the Ga protein subunit is tagged with a fluorescent acceptor, then either the G probtein subunit or the Gy protein subunit is tagged with a luminescent donor. The positional insertion sites or chimeric fusions for each donor/acceptor pair are empirically optimized de novo by iterative testing of all combinations such that the composition of the biosensor has been experimentally determined (e.g. multiple points of insertion of the luminescent donor or fluorescent acceptor paneled against all possible bg dimer complexes with a fluorescent or luminescent donor to identify novel optimal constructs) (Figure 3C-3I). The disclosed method can further involve measuring bioluminescence resonance energy transfer in a fused or unfused system (baseline BRET), contacting the system with the agent, and then measuring a second bioluminescence resonance energy transfer in the system. The difference between the first bioluminescence resonance energy transfer and the second
bioluminescence resonance energy transfer can then be used to calculate G protein pathway activation (NET BRET).
[0019] In some embodiments, the disclosed TRUPATH system uses the receptor-transducer fusion used in the ADSORB system for the same advantages conferred (e.g. stoichiometry to establish reliable measurements of pathway bias, trafficking and in some cases folding concerns, and avoiding off-target activation of the sensor by endogenous receptors or systems). In other embodiments such as during heterotrimer optimization (Figures 3. 7, 13-25), the receptor and transducer are unfUsed and can be used separately. Notably, the fusion system allows for a clear measurement of basal activity of the receptor and ensures that all active receptors have available to them a functional sensor. As shown in Figure 4A and 4B, the fusion approach increases the dynamic range and reliability of the measurement over the unfused scenario but is not necessary for the improvements described in the TRUPATH biosensor compositions (Figure 29).
[0020] In some embodiments, the method involves repeating the above steps for the agent(s) at a plurality of doses and calculating a dose-response curve (Figures 4C, 7, 13-25, 32C-32J, and 33C-33D). Standard logistic regression fitting of dose-response curves enables estimates of common pharmacological parameters
such as potency (EC50) and efficacy (Emax). including inverse agonism (Figure 5A). In contrast to conventional functional assays, the minimized amplification and receptor reserve inherent to TRUPATH assays produce accurate parameter estimates without the need for data post-processing (Figure 5B-5D).
[0021] In some embodiments, the method involves repeating the above steps for the agent at a plurality of kinetic conditions (Figure 6).
[0022] In some embodiments, the method involves repeating the above steps for the agent using a plurality of Ga/Ob/Gg transducer combinations (Figure 3F-3I, 7, 13-25).
[0023] In some cases, the agent used in the TRUPATH method was first identified by the ADSORB method. The advantage to using ADSORB and TRUPATH together as a single platform allows for the initial screening of large libraries and validation of signaling properties using the same engineered complexes (e.g. GPCR- Ga(Rluc), fused or unfused). Additionally, the properties determined from TRUPATH can be compared to non-tagged“native" transducers (unfused) in other standard signaling assays and is therefore cross-platform compatible (Figure 12). Therefore, in some embodiments, the system comprises a pre-determined GPCR-Ga(Rluc) fusion used in the ADSORB method to identify the agent being tested. In other cases, the GPCR-Ga(Rluc) fusion composition used in the ADSORB method was first identified by the TRUPATH method. This interplay between disclosed systems enables identification of pathway preferences that can then be used to guide the ADSORB screen and target agents with the desired transducer bias. Such agents can then be tool molecules or lead compounds in therapeutic strategies.
[0024] In some cases where no chemical matter or information on potential transducer pathways is available (e.g. understudied and orphan GPCRs), TRUPATH can be used to identify potential pathway coupling by evaluating receptor constitutive activity across all pathways. Given the multi-state model of GPCR function and the assumption that basal active states couple to many signal transducers, variability in baseline BRET responses (i.e. constitutive activity) should be apparent across different G proteins for GPCRs. As shown in Figure 5A, TRUPATH assays report constitutive activity and are sensitive to inverse agonists. When tested across all transducers it is indeed apparent that TRUPATH sensors can identify potential coupling mechanisms in the absence of ligand as demonstrated for the dopamine receptors (Figure 8). Another option would be to use known regulators of basal signaling (e.g. sodium ions). Basal activity of GPCRs like mu-opioid receptors are negatively regulated by sodium (Figure 9). Altering the sodium concentration of a
buffer or drug solution can therefore alter the basal activity and produce an effect on the basal BRET response at different concentrations. Using the disclosed fusion approach is optimal, but not required, as it can eliminate potential effects of endogenous receptor systems on the TRUPATH biosensor. Thus, changes in basal BRET can be attributed to the fused system by eliminating otherwise interfering partners. The unfused format can increase throughput at the potential expense of some of this specificity.
[0025] In some cases, it is necessary to standardize receptor expression in membranes or similar environments (e.g. lipo- or nanodiscs) in the ADSORB approach. Because not all receptors have useful probes for determining expression of functional protein, use of a GPCR-Gα(Rluc) chimera is key. Specifically, the GPCR-Gα(Rluc) chimera from TRUPATH can be incubated with the luminescent substrate to assess relative expression. Comparing luminescence from dilutions of material against luminescence of material which has had expression already determined via a conventional method such as radioligand binding, the amount of previously undetectable receptor (and therefore receptor/transducer complex) can be interpolated (Figure 10).
[0026] In some cases, the GPCR-Gα(Rluc) donor chimera can be used to assess interacting partners via isolation (e.g. immunoprecipitation) and mass spectrometry, and then validated by using a fluorescent acceptor tagged to identified partners. The ability for these interacting partners to modulate affinity of the complex can be probed using the ADSORB approach.
[0027] The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
DESCRIPTION OF DRAWINGS
[0028] FIG· 1 is a schematic of an example embodiment of the disclosed ADSORB (Affinity-Directed Selection of Receptor Binders) screening system. Various agent libraries can be substituted in place of the nucleic acid-encoded library shown here. Steps including purification and immobilization of the GPCR-transducer complex (A), library binding (B), washing (C), and elution (D) are subject to modification as described herein. A major differentiation here is the functional elution step, which consists of dissociating the signaling complex in real time (arrows in D) and effectively shifts the receptor from high to low affinity states. Ligands that prefer the high affinity state of the receptor (e.g. in complex with a transducer) will
dissociate foster from the low affinity receptor. Agonists have a large preference for binding the active receptor state that is equivalent to the magnitude of their signaling in cells.
[0029] FIG. 2A is the experimental workflow for screening of an opioid receptor fused to the Gαil protein (OR-GM active complex) expressed in a native membrane microsome. A radiolabeled agonist is used as the positive control to assess the performance of the screen in place of a large library (i.e. to quantify agonist binding, washing, and elution). FIG. 2B shows quantification of an ADSORB screen at the m-opioid receptor (MOR) fused to Gαit protein (MOR-GM). High adsorption of the tritiated agonist [3H]DAMGO to the active complex manifests as low unbound counts per minute (cpm), low cpms in the wash, and a large elution upon complex dissociation/uncoupling with GPPNHP (30% of total agonist added) versus buffer control (2% of total agonist added). FIG. 2C shows quantification of an ADSORB screen at the k-opioid receptor (KOR) fused to Gαil protein. High adsorption of the tritiated agonist [3HJU69593 to the active complex manifests as low unbound counts per minute (cpm), low cpms in the wash, and a large elution upon complex dissociation/uncoupling with GPPNHP (20% of total agonist added) versus buffer control (3% of total agonist added). Functional elution with GPPNHP is greater than with a competitive antagonist like 10mM naloxone (FIG. 2D), reflecting slow dissociation of the agonist tracer from the active complex and inefficient
displacement by competitor. FIG. 2E and F show quantification of a proof-of-concept ADSORB screen at the unfused MOR (low affinity) and MOR-Gαi1 expressing membranes. In panel E the tracer is the antagonist pHJNaloxone, and in FIG. 2F the tracer is the efficacious agonist pH]DAMGO. As shown in FIG. 2E, the antagonist pHJNaloxone binds poorly to both the MOR and MOR-GαM membranes (black segment), and as a result very little antagonist is eluted from both membranes (small red segments) when treated with GPPNHP. By contrast, the agonist pH]DAMGO in FIG. 2F binds more strongly to the MOR-GαM complex (note smaller unbound fraction in black) and elutes to a greater extent when treated with GPPNHP (larger red segment for MOR-GαM vs. MOR). FIG. 2G shows functional elution with GPPNHP can be enhanced by the addition of sub-saturating concentrations of a competitive ligand. As shown here, the amount of functionally eluted peptide agonist can be doubled by the addition of 100nM naloxone. It is likely that sub-saturating concentrations of competitor enhance elution by keeping the agonist from re-binding the low-affinity state of the receptor. Compared to its weak elution from the
coupled/high affinity state of the receptor, naloxone is now more effective at displacing the agonist from the uncoupled receptor.
[0030] FIG. 3A shows TRUPATH biosensor construction and optimization. FIG. 3A shows Bioluminescence Resonance Energy Transfer (BRET) between chimeric Ga-RLuc8 donor proteins and Gy-GFP2 acceptor proteins can differentiate between inactive (intact, high BRET) and active (dissociated, low BRET) Gabg heterotrimers. Receptor-mediated rearrangement or dissociation of the Gabg heterotrimer represents the proximal step in signal transduction (black arrow). FIG. 3B demonstrates that resonance energy transfer (RET) efficiency between the luminescent and fluorescent proteins depends on both proximity and orientation of their dipole moments. Protein regions can be targeted for RLucS or GFP2 insertion, but the precise location for optimal RET cannot be readily predicted in such conformationally dynamic proteins. FIG. 3C details that to develop next-generation Ga-RLuc8^Y-GFP2 BRET biosensors, we first combined information from atomic- level protein structures, previous data, and computer-generated models to identify candidate regions of the Ga-subunit amenable to luciferase insertion. FIG. 3D outlines that luciferase chimeras were generated at each position within these defined regions (Gctq insertional sites listed as examples). FIG. 3E shows how the performance of each Ga-RLuc8 chimera was assessed as the first step in an exhaustive optimization scheme to select optimal Ga-RLuc8^Y-GFP2 biosensors. Specifically, in FIG. 3F first-pass screens of different Ga-Rluc8 chimers using a standardGb g-ORR2 acceptor (e.g., G1b Y2-GFP2) and model GPCR identified the construct with the greatest dynamic range. The top five constructs were confirmed in secondary screens. In a second step FIG.3G, the top-performing Ga-Rluc8 construct was screened against each of 12 GY-GFP2 constructs to identify the optimal acceptor fusion protein. Lastly in FIG. 3H, optimal Ga-Rluc8 donor/GY-GFP2 acceptor pairs were screened against each of four major G sbubunits to determine the final composition of the GO-RLUC8^Y-GFP2 heterotrimer (FIG. 3I). At all stages of optimization, the construct with the greatest mean amplitude (NET BRET or Baseline-Emax) was selected and advanced forward. All concentration-response curves were fit to a three-parameter logistic equation.
[0031] FIGs. 4A to 4C compares traditional unfused BRET assays (FIG. 4A) and new Receptor-G protein RLuc8 fusion (FIG. 4B) at different stoichiometries of donoracceptor DMA. FIG. 4C shows that fusion BRET system (MOR-GaM) can detect partial and superagonists relative to morphine (100%).
[0032] FIG. 5A shows that TRUPATH is sensitive to inverse agonists as concentration-response curves for the constitutively active cannabinoid 1 receptor (CB1 R) at Gai3 show a small full agonist response (WIN 55,212-2) and large effect of the inverse agonist (Rimonabant). In FIG. 5B, alkylation of the m-opiokJ receptor (MOR) with increasing b-FNA treatment shows a minimal effect of receptor reserve (spare receptors) evidenced by a strong inhibition of maximal efficacy and minimal effect on potency. A test for linear trend in decreasing Emax with b-FNA treatment was significant with a large effect size (FIG. 5C, F(1 ,52) = 180.6, p < 0.0001 ; r2 = 0.7502), while the effect on potency was weak (FIG. 5D, F(1 ,52) = 6.793, p = 0.0119, 12 = 0.1005).
[0033] FIGs. 6A to 6C show the fusion BRET system provides an accurate estimation of the kinetics of receptor activation/equilibration. The substrate appears stable > 1 hour and thus kinetics can be measured by staggered addition of drug followed by simultaneous addition of substrate, or through repeated measurements. Here, the MOR (FIG. 6A) and HTR1 E (FIG. 6B) receptors show activation kinetics. FIG. 6C shows that TRUPATH provides potential leverage for difficult targets like the serotonin-5A receptor (HTR5A) that does not work reproducibly in GloSensor cAMP assays. In addition to kinetic effects, the HTR5A-Gai1 RLuc fusion gives a reliable and substantial serotonin response in BRET.
[0034] FIG. 7A uses the exemplar sensor Goq to illustrate how the crystal structure of the inactive GaV/Gb1/g2 heterotrimer (PDB 3AH8) was used to first identify regions within the alpha-helical domain (red tx»0 for RLuc8 insertion that were close to the predicted N-terminus of the Gy-subunit (green box). For naming, we used the position of the first amino acid in the linker-RLuc8 in the full protein sequence. For example, insertion of RLuc8 following the lysine at position 97 in Goq is named Goq(98)RLuc8.Twenty Gaq-RLuc8 fusion proteins were generated at each amino acid spanning the linker regions between oA-aB and between aB-aC helices. In FIG. 7B each chimera was evaluated in a primary concentration-response assay using the Goq-coupled Neurotensin receptor. Performance was evaluated as fold- increase in dynamic range (Net BRET) relative to the reference construct (AA position 98 in Goq). The top five insertion positions 119, 122, 123, 125,126 (boxed) were confirmed in a secondary screen (three biological replicates), identifying position 125 as the optimal Goq-Rluc8 chimera insertion site (FIG. 7C, boxed). Next, a‘Gy-GFP2’ screen (FIG. 7D) was performed with Gaq(125)-Rluc8 to select the optimal GFP-acceptor construct (three biological replicates) when paired with 12 different N-terminally fused Gy-GFP2 constructs and a co-precipitated mixture of the
four major Gb subunits. The Gy9-GFP2 chimera provided the largest signal and was next screened alongside Goq(125)-Rluc8 and each of the four major G subbunits (three biological replicates) (FIG. 7E). Stepwise optimization determined that Gaq(125)-Rluc8^3Y9-GFP2 was the optimal biosensor composition. In FIG. 7F, biosensor functionality was confirmed in a screen of four well-documented Goq- coupled receptors.
[0035] FIGs. 8A to 8E show constitutive activity of dopamine family receptors (DRD1-5), which reveals unexpected promiscuity. FIG. 8A shows relative basal activity (%Basal BRET- Emax of control) at DRD1-5 across all TRUPATH sensors. Raw BRET values for Git (FIG. 8B), Gustducin (FIG. 8C), G13 (FIG. 8D), and GsS (FIG. 8E) showing variation in the basal BRET values between transducers.
[0036] FIG. 9 shows via a GTPy35S loading assay using GPCR-transducer fusion constructs (MOR-GM) that GPCRs are responsive to negative allostery by sodium ions (right panel). As described in the summary, this is useful for identifying transducer preferences without a ligand in addition to the method of FIG. 8.
[0037] FIG. 10 shows how receptor-transducer(RLuc) fusions in
membranes/microsomes can be used quantify receptor density for ADSORB.
Presented are receptor-Galpha(RLuc8) fusions with known radiolabeled probes that can be used to quantify their expression and then be used as standard curves for receptors with no probes. As shown here, plots of receptor density (e.g. via radiolabeled saturation binding) vs. luciferase activity can quantify the expression levels of understudied receptor-transducer fusion proteins. For "orphan’' receptors or other receptors lacking radioligands, luminescence values from the receptor- transducer-Rluc preparation can be compared to a standard curve and the receptor- density extrapolated due to the 1 :1 receptor/G-alpha-transducer stoichiometry. This ensures equal receptor density for screening in the ADSORB approach.
[0038] FIG. 11 A (left panel) illustrates that GPCR-transducer fusion proteins are functional for a variety of receptors and pathways and faithful to known GPCR coupling preferences. Here are HEK293 cells that endogenously express Gq-coupled purinergic (ATP-activated) and muscarinic (Carbachol-activated) receptors, but not serotonin (5-HT) receptors. Thus 5-HT receptor agonists (5-HT, DOI, Lisuride) do not cause calcium release in these cells (left graph). FIG. 11 A (right graph) illustrates a fusion approach where the 5-HT2A receptor fused to Gq (red cartoon) is expressed in cells to confer responsiveness to 5-HT agonists. This provides an important stoichiometry between the receptor and its immediate effector (i.e., selectivity) and showcases the function of GPCR-transducer fusions. Responses to agonists are
nearly identical to what is observed in the non-fused scenario (i.e. when only the 5HT receptor is introduced, inset). FIG. 11 B shows that GPCR-transducer fusions achieve specificity of G protein activation for screening different pathways (Gi vs. Gq vs. Gs, etc.). Here, a radiolabeled non-hydrolyzable GTP analogue ([35S]GTPyS) is loaded into fused G proteins upon receptor activation by experimental full (5-HT) and partial (Ergometrine) agonists. The nature of the assay is unidirectional as the receptor- mediated incorporation of [“SJGTPyS is irreversible. As shown for the Gi-coupled 5- HT5A receptor, G protein activation ([^SJGTPyS loading) is only seen at the Gi fusion, and not at Gq and Gs fusions. These data verify the functionality of the GPCR-Ga fusions used herein and show their fidelity to reported pharmacology of unfused native GPCRs. FIG. 11 C illustrates that GPCRs signal through multiple potential transducer pathways (e.g. 16 non-visual G proteins and arrestins, not exhaustive). While classically divided into four effector families (e.g. Gi family inhibits adenylyl cyclase production, Gs family stimulates adenylyl cyclase, Gq family stimulates PLC, and G12/13 regulates Rho GEFs), many functional assays of effector activation rely on the expression of intermediary downstream signaling pathway components. The full complement of these signaling components may not be present in every cell type and reconstituting these pathways would require significant a priori knowledge of both the physiology of the cell model as well as the details of the G protein/second-messenger pathway. The disclosed TRUPATH platform covers 14 pathways and is proximal to receptor activation, thus
circumventing the limitations of standard assays described above.
[0039] FIGs. 12A to 12D show Mu opioid receptor (OPRM) signaling at GM and Gz (both Gi class transducers) appears significantly different. FIG. 12A to 12B show the findings of enhanced efficacy at Gz for morphine (classic agonist) and surprisingly for naloxone (classic antagonist). FIGs. 12C and 12D show partial agonism of naloxone confirmed in a second messenger assay (inhibition of cAMP).
[0040] FIGs. 13A to 13D show workflow and data supporting successful optimization of GaM BRET biosensor. FIG. 13A shows results of primary screen of experimental Gai1-RLuc8 fusion constructs (two technical replicates). Top-5 performing chimeras (91 , 93, 95, 98, 99, boxes) were evaluated in a secondary screen (FIG. 13B, three biological replicates), where AA position 91 (box) was selected as the optimal biosensor construct. A screen of Gy-GFP2 constructs (FIG 13C, three biological replicates) identified Gy9-GFP2 and Gy13-GFP2 (boxes) as top performing GFP-acceptor proteins. A screen of these two Gy-GFP2 constructs comparing the performance of Gb$ 1-4 (FIG 13D, three biological replicates)
identified Gb3/Gg9-ORR (box) as the optimal acceptor dimer composition for the Gat TRUPATH sensor. Data are presented as mean ± SEM.
[0041] FIGs. 14A to 14D show workflow and data supporting successful optimization of Gai2 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 14A shows results of primary screen (two technical replicates), FIG 14B shows top-5 performing chimeras (boxed), FIG. 14C shows screen of Gy-GFP2 constructs, FIG. 14D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0042] FIGs. 15A to 15D show workflow and data supporting successful optimization of Gai3 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 15A shows results of primary screen (two technical replicates), FIG 15B shows top-5 performing chimeras (boxed), FIG. 15C shows screen of Gy-GFP2 constructs, FIG. 15D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0043] FIGs. 16A to 16D show workflow and data supporting successful optimization of GaoA BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 16A shows results of primary screen (two technical replicates), FIG 16B shows top-5 performing chimeras (boxed), FIG. 16C shows screen of Gy-GFP2 constructs, FIG. 16D shows results of screen against Gb8 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0044] FIGs. 17A to 17D show workflow and data supporting successful optimization of GaoB BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 17A shows results of primary screen (two technical replicates), FIG 17B shows top-5 performing chimeras (boxed), FIG. 17C shows screen of Gy-GFP2 constructs, FIG. 17D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0045] FIGs. 18A to 18D show workflow and data supporting successful optimization of GoZ BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 18A shows results of primary screen (two technical replicates), FIG 18B shows top-5 performing chimeras (boxed), FIG. 18C shows screen of Gy-GFP2 constructs, FIG. 18D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0046] FIGs. 19A to 19D show workflow and data supporting successful optimization of GaGustdudn BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 19A shows results of primary screen (two technical replicates), FIG 19B shows top-5 performing chimeras (boxed), FIG. 19C shows screen of Gy-GFP2 constructs,
FIG. 19D shows results of screen against G$b 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0047] FIGs. 20A to 20D show workflow and data supporting successful optimization of GosShort BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 20A shows results of primary screen (two technical replicates), FIG 20B shows top-5 performing chimeras (boxed), FIG. 20C shows screen of Gy-GFP2 constructs, FIG. 20D shows results of screen against G$b 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0048] FIGs. 21 A to 21 D show workflow and data supporting successful optimization of GasLong BRET biosensor. Format follows that of FIG. 13. Briefly,
FIG. 21 A shows results of primary screen (two technical replicates), FIG 21 B shows top-5 performing chimeras (boxed), FIG. 21 C shows screen of Gy-GFP2 constructs, FIG. 21 D shows results of screen against G$b 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0049] FIG.S 22A to 22D show workflow and data supporting successful optimization of Ga11 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 22A shows results of primary screen (two technical replicates), FIG 22B shows top-5 performing chimeras (boxed), FIG. 22C shows screen of Gy-GFP2 constructs, FIG. 22D shows results of screen against Gb8 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0050] FIGs. 23A to 23D show workflow and data supporting successful optimization of Ga15 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 23A shows results of primary screen (two technical replicates), FIG 23B shows top-5 performing chimeras (boxed), FIG. 23C shows screen of Gy-GFP2 constructs, FIG. 23D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0051] FIGs. 24A to 24D show workflow and data supporting successful optimization of Ga12 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 24A shows results of primary screen (two technical replicates), FIG 24B shows top-5 performing chimeras (boxed), FIG. 24C shows screen of Gy-GFP2 constructs, FIG. 24D shows results of screen against Gb$ 1-4. Top performing biosensor compositions are shown in Table 1. Data are presented as mean ± SEM.
[0052] FIGs. 25A to 25D show workflow and data supporting successful optimization of Ga13 BRET biosensor. Format follows that of FIG. 13. Briefly, FIG. 25A shows results of primary screen (two technical replicates), FIG. 25B shows top-5 performing chimeras (boxed), FIG. 25C shows screen of Gy-GFP2 constructs, FIG.
25D shows results of screen against Gβ$ 1-4. Top performing biosensor
compositions are shown in Table 1. Data are presented as mean ± SEM.
[0053] FIGs. 26A to 26C show that Switch III in the Gα-subunit is a novel region for optimal RLuc8 insertion. FIG. 26A shows that for difficult to engineer Gα transducers (e.g., Gα11), a new site for RLuc8 insertion was identified between the b4-5ΐG3hΰ and the a3 helix of the Ras-like domain (Switch III, dashed box). The closest residue in the Gα11 model (a glutamic acid at position 241 , FIG. 26A inset) was first targeted to assess the performance of RLuc8 chimeras generated within this region. FIG. 26B delineates the Switch III region within Gα11 for RLuc8 insertion.
FIG. 26C compares an optimized alpha helical Gq biosensor and a Switch III version of Gq; note ~50% enhancement in signal for Switch III. High performance of luciferase insertions within Switch III should extend to all sensors in Table 1.
[0054] FIG. 27 shows that a BRET system at equilibrium not prone to amplification also allows for the measurement of inverse agonism. Because GPCRs possess varying levels of basal activity, an increase in BRET results from the stabilization of an inactive state. Here, the serotonin 2C receptor (HTR2C), which has a moderate level of basal activity), is inactivated by the inverse agonists ritanserin and clozapine. The HTR2C receptor is one of the most highly variant receptors in the brain, and the consequences of many of these variants are unknown. Some editing variants present a greater risk of suicidality, and as such subtype selective ligands may have substantial therapeutic benefit.
[0055] FIG. 28 shows seven ligands screened at six Gα proteins fused to the m-opioid receptor (MOR). Consistent with classical pharmacology, standard in vitro competition radioligand binding assays report affinity shifts for ligands that correlate with their abilities to activate these pathways in cells, thus supporting the functionality of the fusions. The antagonist naloxone does not experience significant affinity shifts, whereas foil agonists (morphine, endomorphins, DAMGO, and Leu-enkephalin) and a partial agonist (TRV130) shift compared to unfosed MOR. Differences in shifts (i.e. molecular efficacy) suggest biased responses at these pathways (Strachan RT et al.
J Biol Chem. 2014;289(20): 14211-24). The magnitudes of affinity shifts are consistent with ligand activation of pathways in cells (e.g. Gi/o), supporting the biological relevance of GPCR-Gα fusions (i.e. pharmacology is conserved even when Gα is fused to the GPCR). Such differences in ligand preferences for low and high affinity states underlies the theoretical framework of ADSORB.
[0056] FIGs. 29A to 29N show direct head-to-head comparisons of the reference constructs (black) to the final TRUPATH suite of biosensors (purple). Fold
difference in amplitude was analyzed as a two-tailed t-test between reference and TRUPATH biosensors (Table 2). Different model receptor systems were used for the comparisons. Performance of GaRLuc8^y-GFP2 BRET sensors were as follows: FIG. 29A (Reference) Gai1-92- Rluc8^1 y2-GFP2 < (TRUPATH) Gai1-91- RIUC8/GP3Y9-GFP2, p < 0.0001. FIG. 29B (Reference) Gai2-92-Rluc8/Gpiy2-GFP2 < (TRUPATH) Gai2-91-Rluc8/Gp3y8-GFP2, p < 0.0001. FIG. 29C (Reference) Gai3- 92-Rluc8/Gpiy2-GFP2 < (TRUPATH) Gai3-99- Rluc8/Gp3y9-GFP2, p < 0.0001. FIG. 29D (Reference) GaoA-92-Rluc8/Gpiy2-GFP2 < (TRUPATH) GaoA-92- Rluc8/Gp3y8-GFP2, p = 0.0007. FIG. 29E (Reference) GaoB-92- Rluc8/Gpi y2- GFP2 < (TRUPATH) GaoB-92-Rluc8/Gp3y8-GFP2, p = 0.0003. FIG. 29F
(Reference) GaZ-92-Rluc8/Gp1 y2-GFP2 < (TRUPATH) GaZ-114-Rluc8/Gp3y1- GFP2, p < 0.0001. FIG. 29G (Reference) GaGustdudn-92-Rluc8/Gpiy2-GFP2 < (TRUPATH) GaGustducin-117-Rluc8/Gp3y1 -GFP2, p < 0.0001. FIG. 29H
(Reference) GasS-100- Rluc8/Gp3y9-GFP2 < (TRUPATH) GasS-123-Rluc8/Gp3y9- GFP2, p < 0.0001. FIG. 29I (Reference) GasL-114-Rluc8/GplYl-GFP2 <
(TRUPATH) GasL-137-Rluc8/Gpi g1 -GFP2, p < 0.0001. FIG. 29J (Reference) Gaq- 98-Rluc8/Gpi g1 -GFP2 < (TRUPATH) Gaq-125- RIUC8/GP3Y9-GFP2, p < 0.0001.
FIG. 29K (Reference) Ga11 -98-Rluc8/Gpi g1 -GFP2 < (TRUPATH) Ga11-246- Rluc8/Gp3Yl3-GFP2, p < 0.0001. FIG. 29L (Reference) Ga15-101- KIuo8/Gb1g2- GFP2 < (TRUPATH) Ga15-245-RIuo8/Gb3g13-GFP2, p < 0.0001. FIG. 29M
(Reference) Ga12-115-Rluc8/Gpi Y2-GFP2 < (TRUPATH) Ga12-134-RIuo8/Gb3g9- GFP2, p < 0.0001. FIG. 29N (Reference) Ga13-107-Rluc8^lY2-GFP2 <
(TRUPATH) Ga13-126- RIuo8/Gb3g9-ORR2, p < 0.0001.
[0057] FIGs. 30A to 30C show triple plasmid architecture incorporating all three heterotrimer components (Ga-RIuo8/Gb/Gg-ORR2). Shown in FIG. 30A is the GaI3-99-RIuo8/Gb1 Y2-GFP2 biosensor and in FIG. 30B is the Gai3-99- RIuo8/Gb3g9-ORR2 biosensor. FIG. 30C details the functionality and enhanced response of the GaI3-99-RIuo8/Gb1 Y2-GFP2 triple plasmid vs. the same components transfected as separate plasmids. Shown are concentration-response curves for the MOR activated by DAMGO.
[0058] FIG. 31 shows that the robust signal of TRUPATH biosensors enables miniaturization to 384-well plates. Head-to-head comparison of GoZ-114- RIuo8/Gb3g1 -GFP2 biosensor for 96-well (top) and 384-well (bottom) plate formats. Shown are concentration-response curves for the neurotensin receptor activated by neurotensin peptide (8-13). The NET BRET response at GoZ was 0.495 for the 96-
well plate and 0.625 for the 384-well plate. Neurotensin potency was 1 ,85nM and 1 ,68nM for 96- and 384-well plates, respectively.
[0059] FIGs. 32A to 32J demonstrate how a panel of KOR agonists engage Gai/o-class TRUPATH sensors with varying potency (FIG. 32A heat map) and efficacy (FIG. 32B heatmap). Responses were not detected at other G proteins. Concentration-response curves for Salvinorin A (FIG. 32C), U69,593 (FIG. 32D), GR89.696 (FIG. 32E), BU74 (FIG. 32F), dynorphin A (FIG. 32G), ML139 (FIG. 32H), diprenorphine (FIG. 32I), and RB64 (FIG. 32J) reveal ligand-dependent shifts in transducer activity. Most ligands exhibit enhanced (GoZ) and diminished
(GaGustducin) potencies relative to other G protein transducers. While many ligands activated all transducers with equal efficacy (Salvinorin A, U69.593, GR89.696, ML139, and RB64), others exhibited efficacy bias (BU74, dynorphin A, and diprenorphine). Data presented as mean values ±SEM. Heatmap colors represent mean Log EC50 and efficacy values.
[0060] FIGs. 33A to 33D show dopamine family (D1-5) transducerome profiles for endogenous agonist dopamine. FIG. 33A shows efficacy values (% control) for dopamine concentration-response curves for DRD1-5 across the full TRUPATH platform. FIG. 33B shows potency values (log EC50) for dopamine concentration-response curves for DRD1-5 across the full TRUPATH platform. FIG 33C shows dopamine concentration-response curves for DRD1-5 at Gz. FIG 33D shows transducer concentration-response curves for dopamine responses at DRD5.
[0061] FIGs. 34A and 34B show transducerome profiles for prototypic (ADRB2 and neurotensin, NTSR1) and understudied (LPA, LPAR6 and serotonin 7, 5-HT7) receptors to demonstrate the varying degrees of promiscuity of endogenous agonists. (A) Relative amplitude (Emax or efficacy) of agonist-induced stimulation of TRUPATH biosensors is frequently nonuniform for a given receptor-ligand pair. (B) Potency (Log EC50) values across the transducerome are similarly non-uniform for many receptor-ligand pairs. Data presented as mean values ± SEM. Heat map values represent mean value.
DETAILED DESCRIPTION
[0062] Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
[0063] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.
[0064] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.
[0065] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.
[0066] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
[0067] Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of chemistry, biology, and the like, which are within the skill of the art.
[0068] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to perform the methods and use the probes disclosed and claimed herein. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but
some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in eC, and pressure is at or near atmospheric. Standard temperature and pressure are defined as 20 °C and 1 atmosphere.
[0069] Before the embodiments of the present disclosure are described in detail, it is to be understood that, unless otherwise indicated, the present disclosure is not limited to particular materials, reagents, reaction materials, manufacturing processes, or the like, as such can vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting. It is also possible in the present disclosure that steps can be executed in different sequence where this is logically possible.
[0070] It must be noted that, as used in the specification and the appended claims, the singular forms“a,"“an," and“the" include plural referents unless the context clearly dictates otherwise.
[0071] The process of ligand-mediated formation and subsequent dissociation of GPCR-Transducer signaling complexes correlates with receptor activation and downstream responses in cells. These complexes can consist of native transducer proteins and/or those consisting of a“fusion" or "chimeric* transducer which contains or is fused to a BRET-like donor enzyme (e.g. Renilla luciferase, RLuc) or a BRET or FRET acceptor (e.g. GFP2). The disclosed system is distinguished in part by the implementation of real time signaling complex formation and dissociation as a way to recapitulate signaling outside of a cellular context (i.e. in vitro) and measure activation of single pathways within a cell without the requirement for second messenger detection. The dynamic signaling complexes claimed may exist unfused or fused. This conceptual framework provides significant advantages detailed herein.
[0072] The invention is further separated into two components: ADSORB ("Affinity Directed Selection of Receptor Binders’) primarily for large-scale, ultra-high throughput in vitro drug screening and TRUPATH (for TRansdUcerome Profile Analysis of g protein paTHways) for cellular drug screening and signaling assays.
[0073] Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
[0074] It must be noted that, as used in the specification and the appended claims, the singular forms *a,* "an,” and“the" include plural referents unless the context clearly dictates otherwise.
[0075] The term“polynucleotide barcode” or“barcode” or“polynucleotide tag" are used interchangeably and, according to the present disclosure, as used herein refer to a sequence of nucleotides, i.e., an oligonucleotide, an oligomer, or an oligo. According to the present disclosure a barcode is attached to a subject molecule. An attached polynucleotide barcode finds use in tagging or labeling a single
macromolecule, e.g., a polynucleotide, a polypeptide, a ribonucleoprotein, a carbohydrate, a lipid, a complex and the like. A single polynucleotide barcode also finds use in tagging or labeling a plurality of macromolecules, e.g., a group of related polynucleotides, a group of related polypeptides, a group of related
ribonucleoproteins, a group of related carbohydrates, a group of related lipids, a group of related complexes, and the like. Unique barcodes are used to individually differentiate members of a group from one another, e.g., unique barcodes attached to individual ribonucleoproteins serves to individually differentiate each
ribonucleoprotein from every other ribonucleoprotein. Unique barcodes are also used to differentiate groups of related members, e.g., derived from the same species, derived from the same individual, derived from the same library, derived from the same experiment, derived from the same sample, etc., from other groups. For example, the same unique barcode is attached to a first plurality of related ribonucleoproteins and a second unique barcode is attached to a second plurality of related ribonucleoproteins such that when the first and second pluralities of related ribonucleoproteins are mixed the barcodes serve to indicate the group to which each ribonucleoprotein belongs. A polynucleotide barcode may be of any useful length, e.g., about 1-100 nucleotides, about 5-10 nucleotides, about 10-15 nucleotides, about 10-18 nucleotides, about 18-25 nucleotides, or about 25-50 nucleotides, depending on the particular contexts in which the barcode is being used and how many individual members or individual groups are preferably differentiated. In certain instances the barcode is between about 17 to about 22 nucleotides in length, e.g., about 17 nucleotides, about 18 nucleotides, about 19, nucleotides about 20 nucleotides, about 21 nucleotides, or about 22 nucleotides. For example, the use of a barcode about 1 nucleotide in length differentiates 4 individual members or groups, about 2 nucleotides in length differentiates 16 individual members or groups, about 3 nucleotides in length differentiates 64 individual members or groups, about 4 nucleotides in length differentiates 256 individual members or groups, about 5
nucleotides in length differentiates 1024 individual members or groups, and so on. Thus the use of a barcode over about 9 nucleotides in length differentiates over 1 million unique individual members or groups and a barcode over about 14 nucleotides in length differentiates over 1 billion unique individual members or groups.
[0076] A "fusion protein" refers to a polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide. The fusion protein can be formed by the chemical coupling of the constituent polypeptides or it can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein. A single chain fusion protein is a fusion protein having a single contiguous polypeptide backbone. Fusion proteins can be prepared using conventional techniques in molecular biology to join the two genes in frame into a single nudeic acid, and then expressing the nucleic acid in an appropriate host cell under conditions in which the fusion protein is produced.
[0077] A "spacer” or "linker" as used herein refers to a peptide that joins the proteins comprising a fusion protein. Generally, a spacer has no specific biological activity other than to join the proteins or to preserve some minimum distance or other spatial relationship between them. However, the constituent amino acids of a spacer may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule. Additionally, linkers may be selected which comport some new functionality to the fusion (e.g. a phosphorylatable region).
[0078] Luciferase here is used as a generic stand-in for any enzyme or protein which can, through chemical or enzymatic reaction, produce light (e.g.
luminescence).
[0079] For the purposes of the mechanism employed in TRUPATH. a luminescent enzyme can be replaced with a fluorescent protein to convert the technique from BRET to FRET.
[0080] The location of the "donor" protein and "acceptor” protein is interchangeable between the subunits of the heterotrimer but is discussed in terms of the donor being fused to the Ga and the acceptor on the Gy for purposes of simplicity.
[0081] Disclosed herein is a screening platform that in some embodiments involves fusion proteins comprised of G protein coupled receptors (GPCRs) fused to a transducer, such as a native or engineered G protein a subunit (Ga), arrestin, or a signaling associated protein (e.g. a scaffolding protein, complex, or a protein or
protein fragment that induces inactive or active structural changes in the receptor). In some cases, the GPCR and transducer are connected by a flexible linker. By fusing the transducer to the receptor, the system has a 1 :1 local stoichiometry, maintains appropriate membrane trafficking, and has increased fidelity to the expressed receptor/transducer pathway (Figure 11A,B). For ADSORB, fusion proteins ensure a stable complex due to high local concentration of tethered transducer.
[0082] All eukaryotes use G proteins for signaling, resulting in a large diversity of G proteins. For example, the human genome encodes roughly 800 GPCRs, 18 different Ga proteins, 4 major G pbroteins, and 12 Gy proteins (Figure 11C). It is understood that the disclosed platform can involve any available combination of these or other mammalian GPCR and suitable transducers from the same or different species. Nucleic acid and amino add sequences for GPCRs and transducer are known and available for use in the disdosed systems.
[0083] For use in the disdosed TRUPATH and ADSORB methods, the Ga subunit of the disdosed fusion protein can also be tagged with a
fluorescent/luminescent donor or acceptor. In these embodiments, if the Ga protein subunit is tagged with a fluorescent/luminescent donor, then either a G prbotein subunit or a Gy protein subunit is tagged with a fluorescent acceptor, and if the Ga protein subunit is tagged with a fluorescent acceptor, then either a G prob tein subunit or a Gy protein subunit is tagged with a fluorescent/luminescent donor.
[0084] Fusion proteins, also known as chimeric proteins, are proteins created through the joining of two or more genes which originally coded for separate proteins. Translation of this fusion gene results in a single polypeptide with function properties derived from each of the original proteins. Recombinant fusion proteins can be created artificially by recombinant DNA technology for use in biological research or therapeutics. Chimeric mutant proteins occur naturally when a large-scale mutation, typically a chromosomal translocation, creates a novel coding sequence containing parts of the coding sequences from two different genes.
[0085] The functionality of fusion proteins is made possible by the fact that many protein functional domains are modular. In other words, the linear portion of a polypeptide which corresponds to a given domain, such as a tyrosine kinase domain, may be removed from the rest of the protein without destroying its intrinsic enzymatic capability. Thus, any of the herein disclosed functional domains can be used to design a functional fusion protein or chimera. Function of the GPCR-transducer fusion proteins and select G protein-RLuc8 chimeras disclosed herein is shown in Figures 4, 11 , 12, 27, and 28.
[0086] A recombinant fusion protein is a protein created through genetic engineering of a fusion gene. This typically involves removing the stop codon from a cDNA sequence coding for the first protein, then appending the cDNA sequence of the second protein in frame through ligation or overlap extension PCR. Synthesis of the fused cDNA sequence can also yield a recombinant fusion protein. That DMA sequence will then be expressed by a cell as a single protein. The protein can be engineered to include the full sequence of both original proteins, or only a portion of either.
[0087] If the two entities are proteins, often linker (or‘spacer”) peptides are also added which make it more likely that the proteins fold independently and behave as expected (see below). Especially in the case where the linkers enable protein purification, linkers in protein or peptide fusions are sometimes engineered with cleavage sites for proteases or chemical agents which enable the liberation of the two separate proteins. This technique is often used for identification and purification of proteins, by fusing a GST protein, FLAG peptide, or a hexa-his peptide (aka: a 6xhis-tag) which can be isolated using nickel or cobalt resins (affinity
chromatography). Chimeric proteins can also be manufactured with toxins or antibodies attached to them in order to study disease development.
[0088] Linkers are any flexible amino-acid sequence including but not limited to the following examples:
TANGO Linker DTGGRTPPSLGPQDESCTTASSSLAKDTSSTGENLYFQL (SEQ ID NO:2);
Small Linker SGGGS (SEQ ID NO:3);
Medium Linker GGGGSADIAAAKAGGGGS (SEQ ID NO:4); and
Long Linker GGGGSADIAAAKAGGGGSGGGGSADIAAAKAGGGGS (SEQ
ID NO:5).
[0089] Alternatively, internal ribosome entry sites (IRES) elements can be used to create multigene or polycistronic messages. IRES elements are able to bypass the ribosome scanning model of 5' methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988). IRES elements from two members of the picomavirus family (polio and
encephak) myocarditis) have been described (Pelletier and Sonenberg, 1988), as well an IRES from a mammalian message (Macejak and Samow, 1991). IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. By virtue of the IRES element, each open reading frame is accessible to
ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (U.S. Pat. Nos. 5,925, 565 and 5,935,819; PCT/US99/05781). IRES sequences are known in the art and include those from encephalomycartiitis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell. Biol., 11 :5848-5849 (1991); BIP protein (Macejak and Samow, Nature, 353:91 (1991)); the Antennapedia gene of drosophilia (exons d and e) [Oh et al., Genes & Development, 6:1643-1653 (1992)); those in polio virus [Pelletier and Sonenberg, Nature, 334:320325 (1988); see also Mountford and Smith, TIG, 11 :179-184 (1985)).
[0090] ADSORB is a screening strategy that relies on the differential abilities of ligand classes (e.g. agonists, antagonists, inverse agonists, allosteric modulators) to recognize or interact with different receptor states (e.g. native/unliganded, liganded, active, inactive, mutant, transducer or signaling mimetic-stabilized) (Figure 1). Ligands here may consist of small-molecules, biologies (e.g. proteins, peptides, antibodies, nanobodies, nudeic adds, aptamers, and derivatives) or chimeras thereof. Ligands may or may not be "tagged” by identifiers (barcodes) such as nucleic acids or known protein sequences for subsequent identification (e.g. via deep-sequendng, protein or small molecule mass spectroscopy, phage titering, protein microarrays, etc). By exploiting the magnitude of ligand preferences for different transducer-induced affinity states, ligand dasses can be identified and segregated. Specifically, the pharmacological output of the screen can be established through the differential affinities (i.e. preferences) for these active and inadive target states through the standard concepts of allostery and biased agonism. The ADSORB method differs from current in vitro and cell-based screening approaches that are limited to only identifying ligands that physically bind static or irreversibly conformationally constrained target proteins. Not to be exhaustive, these indude static approaches that screen complex library mixtures using i) non-specific elution strategies and unliganded or stabilized receptors, ii) cell sorting to separate ligand dasses, and iii) biophysical methods. These static approaches (i.e. the same target receptor does not change affinity states as part of the method) do not differentiate between receptor conformational states that, when modulated in real time as in ADSORB, permit the isolation of ligands with a pre-defined pharmacology. Thus, unlike current technologies, ADSORB is a dynamic method that switches between the transducer-coupled receptor and the inadiveAransducer-uncoupled receptor to control the pharmacology of the screened ligands. Modulating receptor or target conformational states by dynamic assodation with different transducers enables the first rational method to specifically target biased agonists in vitro. Given
that allostery is a fundamental aspect of protein function, it is conceivable that ADSORB could be applied to other proteins (e.g. kinases or transcription factors) to find new ligands with predetermined functional effects. Moreover, the utilization of allostery here includes other reversible receptor stabilization approaches that enable on-demand switching of conformational states. The general process of ADSORB as it relates to GPCRs is described below:
[0091] Target screening complexes (GPCR-transducer fusion proteins) are produced in a biological or in vitro system. The target can be prepared by a membrane preparation (e.g. released, separated, or sequestered in microsomes) or by a purification and isolation strategy (e.g. immuno or chemical purification methods, nano- or lipodisc, detergent micelle, liposomal, or lipidomimetic environment, with or without the use of further purification or isolation methods). The target preparation may or may not be oriented to expose different receptor surfaces for screening.
[0092] The target complexes may or may not be (depending on requirements of assay) immobilized (e.g. bound to affinity bead resin, magnetic resin, column, plate, flow-cells, SPR chips, arrays) or used in the“raw" or crude form (e.g. collected by standard methods of centrifugation or filtration). The tethered transducer may consist of the“tagged" (e.g. Renilla luciferase) or native form and need not be a G protein (transducer here also refers to other proteins and methods to reversibly stabilize receptor states). The "tagged" form may be used to quantify expression or target yield against known standards as some targets lack tools or methods to quantify their expression or yield. This may be done as follows (but is not exclusive to the following method). A known tagged-receptor-transducer fusion is expressed and quantified by methods such as radioligand saturation binding. Via titration, this standard is diluted and probed with a substrate for the tagged luciferase to determine the relationship between luminescence and unit of target determined by standard methods. The“unknown" tagged target is similarly titrated in the luciferase assay to determine the relative concentration or yield by interpolation of the standard curve derived from the known standard (Figure 10).
[0093] Targets are exposed to (i.e. treated or screened with) ligand libraries (collections curated or otherwise, natural product extracts or tissue preparations)— this may consist of incubations of varying duration, washing or otherwise flowing ligands across or through the target preparation. The flow-through/un-bound fraction of the library can be collected for further analysis or subsequent screening (e.g. as a negative selection tool). The“treated" target may or may not be washed to identify “stronger" or more selective interacting ligands or to create a more stringent selection
strategy— all flow-through from wash-stages may be captured for analysis as in the initial eluate.
[0094] In an important distinguishing step that has not been disclosed in other screening methods and that provides control over ligand pharmacology (i.e. to isolate in a targeted fashion agonists, biased agonists, positive allosteric modulators, and others) bound or interacting ligands are functionally eluted by incubating complexes with inhibitors of GPCR-transducer interactions (e.g. guanine nucleotides and other chemical derivatives for G-proteins; inhibitors of arrestin association like arrestin loop peptides; antibodies or other biomimetics that compete for binding surfaces, G protein peptide fragments, or engineered domains that change protein structure) (Figure 2). Heat, chemical denaturants such as acids, bases, urea, methanol, or detergents (nonspecific agents) or competing small molecules can elute all remaining binders, an important consideration for elution of conformational state- insensitive ligands (e.g. antagonists). Differentiating ADSORB from current static methods (i.e. when the target is maintained in a single affinity or conformational state/ensemble, such as when thermostabilized), the functional elution strategy of ADSORB modulates target conformational states in real time to facilitate target ligand dissociation and detection. A major distinction is that conformational state modulation mimics receptor-mediated activation of the tethered transducer in cells, thus recapitulating a cellular activation event in a precisely controlled in vitro environment and solving the problem of in vitro assays lacking function. Such a novel method dismisses and overcomes the notion that functional screening can only be done in cells. As demonstrated in Figure 2, the ADSORB method works because GPCRs are allosteric machines that switch between high affinity transducer-coupled states (active) and low affinity uncoupled states (inactive). Balanced and biased signaling is encoded within these state transitions (Strachan RT et ai. J Biol Chem.
2014.289(20): 14211-24) (Figure 28), thus ligands that elute from different GPCR- transducer complexes will exhibit general or biased activation of those different pathways in cells. Ligands that are insensitive to modulation of receptor states can be eluted using nonspecific or biospecific (i.e. a competing ligand) elution techniques after functional elution. Notably, as shown in Figure 2G, functional elution with GPPNHP can be enhanced by the addition of sub-saturating concentrations of a competitive ligand. Thus, functional elution could also include the combined use of state modulation and competitive inhibition.
[0095] Functional analysis of the elution may consist of bulk-screening eluates in signaling assays (e.g. TRUPATH defined in later section, TANGO assay,
GTPyS, Promega Glosensor cAMP, FLIPR calcium mobilization assays, radio- labeled inositol trisphosphate accumulation, cAMP accumulation, Ras/Rac/Rho assays, transcriptional reporters, etc.). The specific contents of the eluates may also be identified by deep sequencing of nucleic acid barcodes, protein microarrays, small molecule or protein mass spectroscopy, phage tittering, clonal isolation, or other deconvolution methods. Contents of eluates can also be amplified to subsequently enrich future ligand libraries for subsequent and iterative screening. This multi-round selection strategy is an iterative process to enrich for ligands with preferences for the desired receptor affinity state. Multi-round selection can also be used as mentioned above for negative selection. The determined selected components of the library can be compiled into a database for other purposes (e.g. computational analysis and deconvolution, subsequent structure activity relationship analysis, artificial intelligence/machine learning for in silico drug discovery and computational sorting and design, or for further iterative screening purposes involving medicinal chemistry). This selection strategy may be used iteratively as needed for as many rounds as required. The information set for each transducer-tethered target can be used to identify differential affinities of the same or different ligands for the different states (hereafter referred to as signaling bias).
[0096] As depicted in Figure 1 and shown in Figure 2, the differential affinity of agonists for active signaling complexes versus the uncoupled, inactive receptor can be exploited for the isolation of pathway-specific agents (e.g. biased agonists). A fundamental property of G protein-coupled receptor (GPCR) agonists is that they bind 10 to 100X more tightly to active receptors in complex with a transducer through which they can signal compared to the free receptor (Figure 28). This extends to biased agonists that show a preference for binding to different transducer-coupled receptor states. Following complex dissociation (i.e. uncoupling of the tethered transducer from the GPCR), agonists will bind less tightly to the low affinity state of the receptor which involves an increase in ligand dissociation rate (i.e. it functionally elutes). As shown in panel 1 B, under experimental conditions in which an active complex is intact (e.g. immobilized cell membranes expressing a GPCR-G protein fusion), library agents (in this case nucleic acid-tagged small molecules) will bind tightly to the complex and resist washing (Figure 1C). Upon complex dissociation (i.e. addition of non-hydrolyzable guanine nucleotide, GPPNHP), only library agents that now sense this receptor as being in a low affinity state will dissociate and be collected in the eluate (Figure 1 D and 2B, 2C, 2E). When appropriate (e.g. for phage, mRNA-peptide, or yeast display libraries), subsequent amplification and rounds of
selection will enrich for active complex-specific agonists. An initial cloning platform of over 300 druggable GPCRs and 16 different human G proteins covers known therapeutically-relevant receptor signaling complexes. GPCR-transducer fusions could extend to the remainder of GPCRs and other transducers that are understudied or orphaned (e.g. olfactory and taste receptors), thereby providing complete coverage of GPCR-mediated processes in healthy and diseased humans. GPCRs are also found in other organisms and could be used as targets for other purposes including, for example, agricultural pest control and control of disease vectors (e.g. mosquitoes), and so this approach can extend across species and biological systems and encompass genetic variants to identify selective ligands due to differences in their allostery.
[0097] One-shot screening (i.e. using only one round of ADSORB) of libraries could be achieved using very stringent wash protocols or using microfluidics such as those common to surface plasmon resonance (SPR) machines or those using magnetic beads. Automated immobilization of target complexes, library incubation, washing, functional elution, and recovery of eluted library agents would greatly increase the selectivity and efficiency of ADSORB screens.
[0098] TRUPATH is a comprehensive signal transduction profiling assay that correlates heterotrimeric G protein dissociation with downstream signaling. It can be run in unfused or transducer-receptor-fused scenarios and is based on the concept of Ftirster Resonance Energy Transfer. The described application herein relies on a bioluminescent donor enzyme, a derivation called Bioluminescence Resonance Energy Transfer (e.g. BRET) (Figure 3A). The advances described herein can also be applied to the analogous formulation wherein two fluorescent molecules are used rather than a luminescent donor and fluorescent acceptor (e.g. Fluorescence Resonance Energy Transfer, or FRET). BRET is used to measure the interaction (e.g. association or dissociation) or proximity of two entities (e.g. proteins). In brief, one interacting partner is tagged or labeled with a luminescent enzyme (a donor, e.g. Renilla luciferase) which can catalyze the breakdown of a substrate that produces light as a byproduct at a desired wavelength. The other interacting partner is tagged with a fluorescent protein with appropriate absorption and emission wavelengths (an acceptor, e.g. GFP2). If the acceptor is close enough to the site of chemical reaction the luminescence can exdte the fluorophore producing fluorescence. This is known as resonance energy transfer. The relative change in the ratio of these two signals is a measure of the changing association or dissociation of the two partners. Extending this principle to known interacting partners of targets (such as heterotrimeric G
proteins) measures the activation of these signaling pathways. A specific example of G protein pathway activation (e.g. the dissociation of the GaGbGg complex) is described below:
[0099] A GPCR is an allosteric machine that catalyzes the exchange of one nucleotide (e.g. GDP) for another (GTP) in the subunit of a physically associated Ga protein. The Ga protein when inactive is closely associated with the GGgb subunit (an obligate dimeric complex). By tagging the G orb Gg subunit with a donor or acceptor, and the Ga with a donor or acceptor, the association or dissociation of this complex can be measured (Figure 3A). If the receptor and ligand interaction can activate this pathway the complex dissociates when the receptor is active (natively, by mutation, or perturbation by a ligand as defined above) and changes to the rate or magnitude of activation of the receptor can be determined by the changing BRET ratio of these complexes. In the disclosed approach, insertion sites for the donor and acceptor within the Ga subunits have been empirically determined and optimized (Figures 7,13-25, Tablel), and the optimal GGbg subunit complex for each Ga has been empirically identified (Figures 7, 13-25, Table 1). If required, fusing the Go to the receptor (e.g. the target-transducer system from ADSORB) ensures a 1 :1 local stoichiometry in our system, maintains appropriate membrane trafficking, and provides fidelity to the expressed receptor/transducer pathway (Figure 11 A, 11 B). This increases the dynamic range of the assay (Figure 4A, 4B).
[0100] TRUPATH biosensor compositions are novel as insertion sites for the donor/acceptor within the Ga subunits and GGbg acceptor pairs have been empirically determined and optimized (see below for detailed explanation, Figures 3, 7, 13-25). A list of top performing insertion sites is included in Table 1 and their improvements over existing BRET assays are detailed in Figure 29 and Table 2. Notably, apart from some of the closely related isoforms, we did not observe any consistent pattern in the final Ga-Rluc chimeras. This supports the position that a purely structure-guided or homology-based approach for generating optimal Ga-Rluc chimeras is not likely to be successful and that optimal sensor design is non-obvious. Some insertion sites are relatively equivalent, as are certain GGbg dimer pairings, which is reflected in the top amino acid (AA) positions and GGgb compositions listed for each G protein in Table 1. Unlike what is standard practice, TRUPATH biosensors frequently use atypical GbGg pairings (e.g. 0b30g9 and 0b30g13) (Table 1). For comparison, current standard 0b10g1 and 0b10g2 dimers underperformed at all but one sensor, GsLong, although 0b10g1 was practically indistinguishable from 0b40g1 (Figure 21 D, Table 1). For completeness, we disclose and claim for each G
protein the top five Ga-Rluc chimeras, top five Gy-GFP subunits, and all Gb subunits since they were frequently equivalent (Table 1).
[0101] A completely unexplored and non-obvious region for luminescent or fluorescent insertions is disclosed herein. Specifically, we identified a flexible linker region extending from the B4-strand to the a3 helix of the Ras-like domain (Switch III, Figure 26 A). No known chimeric proteins have been generated in this region, likely because mutations within or deletion of the entire Switch III region are thought to negate functional coupling of Ga to its effector. Contrary to this prediction, insertion of RLuc8 into this region (Ga11 (241>RLuc8, Figure 26B) yielded a construct that performed identically to its wildtype counterpart. Generation and screening of Ga- RLuc8 constructs spanning this Switch III region (Figure 26 B) used Gy13 as a suitable, but atypical acceptor pair. The retained function of new Switch III chimeras may be because the insertion of proteins (i.e. chimera generation) may not present the same negative effect on transducer behavior as mutations or deletions— something heretofore unreported or predicted. This region may also be useful for generating chimeras with split GFP or split-luciferase components, or for use with bait-prey type protein complexes to identify novel interacting partners in pulldown and mass-spectrometry assays. The optimization workflow (Figure 3F-3I) identified optimal Ga11 and Ga15 biosensor compositions using Switch III protein engineering (Figures 22 and 23). As shown in Figure 26C, the Switch III version of Gq performed better than the helical domain Rluc8 insertion, thus luciferase insertions within this new region should extend to all sensors in Table 1.
[0102] Head-to-head comparisons against other BRET heterotrimer sensors demonstrates that TRUPATH biosensor compositions are superior at every G protein tested, with statistically significant improvements ranging from 1.5- to approximately 100-fold (Figure 29 and Table 2), with the median and mean improvements being 7.8- and 20.5-fold, respectively.
[0103] The TRUPATH platform can be enhanced by generating polycistronic triple plasmids' that encode Go, Gβ, and Gy subunits under the same promoter using 2A self-deaving peptide and internal ribosome entry site sequences (Figure 30A.B). Here it is shown to work with the TRUPATH Gαi3 biosensor (Figure 30C). Compared to a quadruple co-transfection protocol, the triple plasmid strategy increases the NET BRET signal (Figure 30C) and will improve the between- experiment consistency. Preliminary results (Figure 30C) show that there is no difference in the measured ligand pharmacology between approaches.
[0104] The general principle described in the G protein example can be extended to situations such as the recruitment of other transducers such as arrestins, scaffolding complexes, or in some cases the dissociation of other complexes at the receptor.
[0105] Highlighting the platform's strength as a complete drug discovery tool, TRUPATH can be used to i) assay dose-responses of known ligands or those derived from ADSORB in an effort to determine their efficacies, potencies, or allosteric properties, or ii) assay single point concentrations of ligand across multitudes of conditions (matrix) or large ligand libraries. Conversely, TRUPATH can precede ADSORB to identify transducer preferences that can then be used to screen and isolate new pathway-specific ligands (i.e. tailor ligand pharmacology). For example, the GPCR-GaRLuc8 fusion protein corresponding to the signaling pathway activated in TRUPATH will serve as the target complex for uHTS of extremely large ligand libraries in ADSORB. Miniaturizing this platform to 384-well (Figure 31) or smaller will accommodate larger scale screening as well as simultaneous reading of BRET to enable kinetic data acquisition.
[0106] ADSORB and TRUPATH are complementary technologies, which as a platform enable large scale profiling of all signaling pathways that can facilitate rapid and targeted screening of complex ligand mixtures, and vice versa. Together, these technologies greatly expand the signaling space and chemical space available to GPCRs, thus increasing our understanding of GPCR function in human health and disease and our ability to treat its dysfunction.
[0107] TRUPATH screening has many uses. These include but are not limited to: 1) comprehensive profiling of signaling for any given ligand-GPCR pair, 2) profiling the signaling of receptor mutants and variants (pharmacogenomics), and 3) profiling the signaling of understudied GPCRs and orphan GPCRs (i.e. receptors that lack an endogenous agonist or well-defined physiological function).
[0108] A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
EXAMPLES
Example 1: Affinity-Directed Selection of Receptor Binders (ADSORB) enables specific Isolation of opioid receptor agonists.
[0109] Methods
[0110] Cloning: GPCR-transducer fusions in which the top Ga-RLuc8 chimera from TRUPATH (Table 1) is fused via its N-tenminus to the C-terminus of a GPCR can be generated via standard cloning methodologies such as Gibson
assembly. Fusions between proteins can be direct or use any of the linkers detailed above. See the Genbank formatted example of a receptor-Galpha-Rluc fusion protein (Neurotensin-Gq) provided below.
[0111] Microsomal membrane preparation: A given GPCR-transducer fusion in a mammalian expression vector is transiently transfected into HEK293 suspension cells (30mg DNA/30ml_ culture) for overexpression. Microsomes are prepared 36-48 hr post-transfection using differential centrifugation. Briefly, cells are collected at 300xg for 10min at RT. Cell pellets are resuspended in 10mL Homogenization Buffer (50mM TrisHCI, 2mM EDTA, 1X protease inhibitors, pH7.4) and dounce
homogenized on ice (50 strokes, Type A). Lysed cells are centrifuged 500 x g for 10min at 4'C. The low speed supernatant is transferred to a 30mL centrifuge tube and microsomes are collected at 35,000 x g for 60min at 4°C. The high-speed pellet (P2) is resuspended in 1 mL of Resuspension Buffer (50mM TrisHCI, 2mM EDTA, 10mM MgCh, 5% glycerol, 1X protease inhibitors, pH7.4) and aliquoted into 1.5mL tubes. Membranes pellets are collected at max speed in a table top centrifuge (14000 x g for 30min) at 4°C. The supernatant is removed and pellets are frozen and stored at -80ºC until use.
[0112] ADSORB process using membranes and centrifugation: Membrane pellets are thawed and resuspended to homogeneity in cold Binding Buffer (20mM HEPES, 10mM MgCI2, 0.1 mM EDTA, 0.1%BSA, pH7.4) and aliquoted into 1.5mL tubes at ~1 x 1012 receptor molecules per selection (or less depending on round).
The membrane pellet is recovered at 18000 x g for 10min at 4eC. Microsomes are resuspended in a library surrogate (KD concentration of [3H]agonist radiotracers like pH]DAMGO or pHJUegSOS, or pHJantagonist radiotracer like pHJNaloxone) and incubated for 2hr at RT with end-over-end mixing. The membrane pellet is recovered at 18000 x g for 10min at 4°C. Supernatant is removed and membrane pellet washed by resuspension in 1 mL cold binding buffer. Membranes are recovered at 18000 x g for 10min at 4°C. This step is repeated four times for a total of 5 washes, with the last wash split according to the different elution conditions (e.g. buffer or GPPNHP). The final wash is removed and the pellet is resuspended in 500pL of binding buffer or GPPNHP elution buffer. Incubate at RT for various times (typically 1 to 5 min). High speed centrifugation is used to pellet the membrane and the supernatant containing the eluted ligands is saved for downstream processing. In the case of a radiotracer we performed scintillation counting to detect the number of ligands at each step. Elution steps can be repeated as needed to recover the ligand. Functional elution
can be followed with general elution (e.g. 0.2M Glycine, pH 2.2) for recovery of all other binders.
[0113] Results
[0114] FIG. 2B shows quantification of ADSORB screen at the mu-opioid receptor (MOR) fused to Gαil protein. High adsorption to the active, high affinity complex manifests as low unbound counts per minute (cpm), low cpms in the wash, and a large elution upon complex dissociation/uncoupling with GPPNHP (30% of total agonist added) versus buffer control (2% of total agonist added).
[0115] FIG. 2C shows quantification of ADSORB screen at the kappa-opioid receptor (KOR) fused to GαM protein. High adsorption to the active, high affinity complex manifests as low unbound counts per minute (cpm), low cpms in the wash, and a large elution upon complex dissociation/uncoupling with GPPNHP (20% of total agonist added) versus buffer control (3% of total agonist added). Functional elution with GPPNHP is greater than with a competitive antagonist like 10uM naloxone.
[0116] FIG. 2D shows quantification of ADSORB screen at the mu-opioid receptor unfused (MOR) and fused to GCBI-RLUC8 chimera (MOR-GM RLuc). The radiotracer in this experiment is the antagonist [3H]-Naloxone. Low adsorption of antagonist to both the unfused (inactive) MOR and fused MOR-GM Rluc (active) manifests as high unbound counts per minute (cpm) (on average 55% of total added for both membrane types), modest cpms in the wash (on average 25% for both), and a very small elution upon complex dissociation with GPPNHP (1% of total for MOR and 2.5% for MOR-GM RLuc) versus buffer control (~0.5% of total for both). Notably, the antagonist showed no real preference for low or high affinity states and would not be highly represented in the eluate of an ADSORB screen.
[0117] FIG. 2E shows the same experimental setup as in FIG. 2D but instead uses an agonist radiotracer ([3H]DAMGO), low affinity MOR membranes, and high affinity MOR-GM RLuc complexes. Quantification of counts per minute (cpm) shows high preferential adsorption of the agonist to the MOR-GM RLuc complex (23% unbound tracer) compared to unfused MOR (67% unbound tracer). Upon GPPNHP treatment, a very small fraction of agonist eluted from low affinity MOR (0.8% of total agonist) vs. the relatively large fraction that eluted from the high affinity MOR- GM RLuc complex (7% of total agonist). Compared to the antagonist tracer experiment in FIG. 2D, ADSORB preferentially binds and elutes agonist ligands from GPCR-transducer complexes. In a multi-round enrichment paradigm, high efficacy agonists should predominate in the functionally eluted fractions of later rounds.
Example 2: Development of a Scalable, Cell-Type-Agnostic Platform for Profiling GPCR Signaling at Single Transducer Resolution
[0118] G Protein Coupled Receptors (GPCRs) are the most widely drugged protein family in the human genome. It is recognized that signaling events following GPCR activation by a ligand can proceed disproportionately through multiple G- protein pathways. This signaling“bias" makes it possible to tune the physiological response for each receptor-ligand interaction, thus setting up the potential to develop safer and more efficacious biased drugs (Manglik A et al. Nature. 2016 Sep
8;537(7619):185-190). However, there are limited assays that can differentiate between G proteins, and many of these are further confounded because of their dependence on downstream signaling events and manifest qualities such as amplification and cell-type variation. The ability to measure the extent to which any given ligand-GPCR signaling response is biased would advance the scope of known GPCR pharmacology and help inform drug-discovery and optimization efforts. This disclosure presents a comprehensive signaling assay to avoid these specific caveats.
[0119] For the following, placement of the luminescent donor and fluorescent acceptor can be exchanged (i.e. it is not necessary that the luminescent donor be on the Ga, and could for the intended purposes be located on the Gb or Gy subunit).
[0120] Peptide sequences for Ga subunits are used to generate maps of known or putative flexible or disordered domains. This can be done either by using published structures or through modeling of amino acid sequences for less well understood Ga subunits against known structures with high similarity (Table 3). Plasmids containing human Ga, Gb, and Gy constructs were obtained from public resources, except for Ga12 and Gagustducin, which were synthesized as gene blocks. All constructs were subcloned into pcDNAS/FRT/TO.
[0121] Chimeric constmcts (e.g. Gα-RLuc8 and Gy-GFP2 constructs) were generated via Gibson assembly-type methods. Gy-GFP2 constructs were generated by amplification of the backbone construct (e.g. pcDNA-Gy) from the N-terminal start codon and adding homology to the C-terminus of GFP flanked by a short flexible linker sequence (GSAGT). GFP2 sequences were amplified by PCR, adding homology to the pcDNA backbone at the 5’ end, and homology to the N-terminus of the Gy sequence at the 3’ end. Backbone and insert constructs were co-incubated with Gibson-assembly master mix and transformed into competent E. coli. Gα-RLuc8 constructs were generated by linearizing a single backbone template for each region (e.g. oA-aB linker region, aB-aC helical region, Switch III), amplifying outwards from the 5’ and 3‘ ends of the beginning of those respective regions— producing a linearized construct lacking that sequence. These deleted codons were filled in with RLuc8 insertion sequences by overhang PCR while adding a flexible SGGGS linker, the missing codon sequences flanking the appropriate insertion site, and homology to the 5’ and 3' end of the linearized backbone. These were incubated with Gibson- assembly master mix to assemble Gα-RLuc8 chimeric constructs containing a fully intact Go with an RLuc8 sequence, one for each amino-acid position within the targeted region.
[0122] For GPCR-fusion proteins, the optimal Gα-RLuc8 chimera is fused via its N-terminus to the C-terminus of a GPCR using standard cloning methods. See the Genbank formatted example of a receptor-Gαlpha-Rluc fusion protein (Neurotensin + Gq) provided below.
[0123] Biosensor optimization can be performed as follows using either a co- transfection of receptor and GαRluc variants or an N-terminally fused GPCR-GαRluc chimera (Figure 3). The following text describes optimization in the context of a GPCR-Gα fusion but can be applied to a“non-fused” Go construct. First identify a suitable prototype GPCR if not using one already fused to the Go’s N-terminus.
Then, transfect equal ratios of the GPCR and optimal biosensor plasmids containing Gβ1 , 2, 3, or 4, and a fluorescently tagged Gy subunit 1 through 13. The standard Gβ1 Gy2-GFP2 dimer is a good starting point. Any combination can be tried at first (including switching the fluorescent protein from the Gy to the Gβ subunit) if little BRET is observed. After transfection, cells can be plated in a plate suitable for use in a luminescence/ fluorescence plate reader (or read right away if transfected directly
in such a plate). Treatment of wells with luminescent substrate and a known agonist (either at single points or to produce a dose-response curve) can be used to observe the relative change in BRET from basal conditions. The top 5 insertion sites based on NET BRET (number can be modified based on needs) can then be retested to be confident that the optimal insertion site has been identified (Figure 3F). All Gb subunits can then be co-precipitated and the optimal construct transfected in parallel with each fluoresce ntly-tagged Gy subunit (separate transfections for each Gy subunit, Figure 3G). Alternately this can be done without co-precipitating by running a large matrix. The order of this can be reversed if/when tagging the Gb subunit with the fluorescent acceptor. A dose-response assay may be performed to determine the optimal donor/acceptor pair. If a foil matrix for GbGg dimers was not performed, the optimal Ga-RLuc (or GPCR-GaRLuc fusion) and the optimal acceptor construct can be taken, and then each of the untagged Gb or Gy substituents can then be separately transfected (Figure 3H). A concentration response experiment can be performed to verify the optimal heterotrimeric substituents.
[0124] The following is a Genbank formatted example of a receptor-Ga-Rluc fusion protein (Neurotensin-Ga-Rluc):
1 atgaagacga tcatcgccct gagctacatc ttctgcctgg tattcgccga clacaaggac 61 gatgatgacg ccagcatcga tatgcacctc aacagctccg tgccgcaggg cacccctggt 121 gaacccgatg cccagccctt ttcgggacca cagtccgaaa tggaagogac gttcctggcg 181 ctcagttlga gcaatggtlc tggcaatacc tcggaatccg acacggcagg gcccaacagc 241 gacctggacg tgaacactga catltattcc aaggtgctgg tgactgctat atacctggca 301 ctcltcgtgg tgggcactgt gggcaactcc gtgacactct tcactctagc gcggaagaag 361 tcactgcaga gcctgcagag cadgtgcat taccacctgg gcagcctggc actgtctgac 421 ctgctlatcc ttctgctggc catgcccgtg gagctataca adtcatdg ggtacaccat 481 ccctgggccl ttggggacgc tggctgccgt ggctactatt tcdgcgtga tgcdgcacc 541 tatgccacag ccdcaatgt agccagcctg agtgtggagc gctacttggc catctgccat 601 cccttcaagg ccaagacccl catgtcccgc agccgcacca agaaattcat cagtgccata 661 tggctagctt cggcgctgct ggctataccc atgctttlca ccatgggcd gcagaaccgc 721 agtgcogacg gcaogcaccc tggcggcctg gtgtgcacac ccatlgtgga cacagccact 781 gtcaaggtcg tcatccaggt taacaccttc atgtccttcc tgtttcccat gttggtcatc
841 tccatcctaa acaccgtgat tgccaacaaa clgacagtca tggtgcacca ggccgccgag 901 cagggccgag tgtgcaccgt gggca cacao aacggttlag agcacagcac gttcaacatg 961 accatcgagc cgggtcgtgt ccaggccctg cgccacggag tcctcgtctt acgtgctgtg 1021 gtcattgccl ttgtggtctg ctggctgccc taccacgtgc gacgcctgat gttctgctat 1081 atdcggatg aacagtggac tacgttcdc tlcgatttd accadattt dacatgda
1141 accaacgdc tdtdacgc cagdccgcc atcaatccca tcddacaa cdggtdcc 1201 gccaacttcc gccaggtdt tdgtccacg dggcdgcc ttlgtcdgg gtggcgccac 1261 cgccggagga agcgccccgc dtdcacgg aaggccgad cagtatcdc taaccatacc 1321 dgagttcaa acgccadcg ggaaaogdg tacatcgata ccggtggacg caccccaccc 1381 agcdgggtc cccaagatga gtcdgcacc accgccagd cdccdggc caaggacad 1441 tcatcgaccg gtgagaacd gtadtccag daatgadc tggagtccat catggogtgc 1501 tgcdgagcg aggaggccaa ggaagcccgg cggatcaacg acgagatcga gcggcagdc 1561 cgcagggaca agcgggacgc ccgccgggag dcaagdgc tgdgdcgg gacaggagag 1621 agtggcaaga gtacgtttat caagcagatg agaatcatcc atgggtcagg ataddgat
1681 gaagataaaa ggggcttcac caagctggtg tatcagaaca tcttcacggc catgcaggcc
1741 atgatcagag ccatggacac actcaagatc ccatacaagt atgagcacaa taaggctcat 1801 gcacaattag ttcgagaagt tgatgtggag aaggtgtctg ctttttctgg tggtggtgga
1861 tccatggctt ccaaggtgta cgaccccgag caacgcaaac gcatgatcac tgggcctcag
1921 tggtgggctc gctgcaagca aatgaacgtg ctggactcct tcatcaacta clatgattcc
1981 gagaagcacg ccgagaacgc cgtgatlttt ctgcatggta acgctacctc cagctacctg
2041 tggaggcacg tcgtgcctca catcgagccc gtggctagat gcatcatccc tgatclgatc
2101 ggaatgggta agtccggcaa gagcgggaat ggctcatatc gcctcctgga tcactacaag
2161 tacctcaccg cttggttcga gctgctgaac cttccaaaga aaatcatctl tgtgggccac
2221 gactgggggg ctgctctggc ctttcactac gcctacgagc accaagacag gatcaaggcc
2281 atcgtccata tggagagtgt cgtggacgtg atcgagtcct gggacgagtg gcctgacatc
2341 gaggaggata tcgccctgat caagagcgaa gagggogaga aaatggtgct tgagaataac 2401 tlcttcgtcg agaccgtgct cccaagcaag atcatgcgga aactggagcc tgaggagttc
2461 gctgcctacc tggagccatt caaggagaag ggcgaggtta gacggcctac cctctcctgg
2521 cctcgcgaga tccctctcgt taagggaggc aagcccgacg tcgtccagat tgtccgcaac
2581 tacaacgcct accttcgggc cagcgacgat ctgcctaagc tgtlcatcga gtccgaccct
2641 gggttctttt ccaacgclat tgtogaggga gctaagaagt tccctaacac cgagttcgtg
2701 aaggtgaagg gcctccactt cctccaggag gacgctccag atgaaatggg taagtacatc
2761 aagagcttcg tggagcgcgt gctgaagaac gagcagagcg gaggaggcgg cagtgagaat 2821 ccatatgtag atgcaataaa gagtttatgg aatgatcctg gaatccagga atgctatgat
2881 agacgacgag aatatcaatt atctgactct accaaatact atcttaatga cttggaccgc
2941 gtagctgacc ctgcctacct gcctacgcaa caagatgtgc ttagagttcg agtccccacc
3001 acagggatca tcgaataccc cttlgactta caaagtgtca ttttcagaat ggtcgatgta
3061 gggggccaaa ggtcagagag aagaaaatgg atacactgct ttgaaaatgt cacctctatc
3121 atgttlclag tagcgcttag tgaatatgat caagttclcg tggagtcaga caatgagaac
3181 cgaatggagg aaagcaaggc tctctttaga acaattatca catacccctg gttccagaac
3241 tcctcggtla ttctgttctt aaacaagaaa gatcttctag aggagaaaat catgtattcc
3301 catctagtcg actacttccc agaatatgat ggaccccaga gagatgccca ggcagcccga
3361 gaatlcattc tgaagatgtt cgtggacctg aacccagaca gtgacaaaat tatctactcc
3421 cacti cacgt gcgccacaga caccgagaat atccgctttg tctttgctgc cgtcaaggac
3481 accatcctcc agttgaacct gaaggagtac aatctggtd aa (SEQ ID NO:1).
Example 3: TRUPATH Assays for Screening Prototyplc and Understudied GPCRs for G-Proteln Preferences
[0125] A mammalian expression vector containing any GPCR can be used to screen the complete set of TRUPATH G protein sensors (Table 1) for any number of ligands. Alternatively, a single expression vector utilizing multiple promoter regions or
IRES (or similar sites) can be employed to express the entire system from a single plasmid (described here as a triple plasmid or polycistronic vector (Figure 30A,B).
[0126] After transfection, cells are plated in a suitable plate for the instrument/plate-reader (e.g. a 96-well plate, 384, 1536, etc). This step is unnecessary if the cells are transfected directly in such a plate.
[0127] After sufficient time to allow for expression (~36 to 48 hr), cell media is aspirated off and washed with an assay buffer (e.g. a buffered saline solution).
[0128] The order of addition of ligands or substrate can be determined by the experimenter, but in a general experiment a substrate for the luminescent enzyme is added and allowed to equilibrate in solution with the cells (optional). Test ligands are then added (single point or dose response) and either read in the plate-reader right away or after a pre-determined amount of time.
[0129] Dose response curves can be analyzed using conventional pharmacological methods (e.g. three parameter logistic model) to estimate parameters such as efficacy (Ema)0 and potency (EC50) (Figure 32). For receptors with a known standard ligand, all values can be measured relative to this reference. Bias at each transducer can be calculated using published standard pharmacological formulas (e.g. Onaran HO et al. Sci Rep. 2017 Mar14;7:44247) or other model free methods.
[0130] The relative efficacies can be measured by comparing the net BRET values from the experiment above against a standard receptor/alpha/ligand (e.g. Neurotensin for most G proteins except for Gs isoforms (beta2-adrenergic receptor) or GaGustducin (KOR)). Once normalized to these standards, a user-defined method of bias quantification can be used.
[0131] In Figure 32, heatmaps and concentration-response curves demonstrate how a panel of KOR agonists engage Gai/o-class TRUPATH sensors with varying potency (Figure 32A) and efficacy (Figure 32B). Responses were not detected at other G proteins.
[0132] In Figure 33, heatmaps and concentration-response curves demonstrate how the endogenous agonist dopamine activates its receptors to produce different transducerome signatures. Note considerable differences amongst subclasses of dopamine receptors originally thought to signal similarly (Figure 33 A and B).
[0133] For comprehensive transducerome profiling of understudied receptors (Figure 8), the basal activities of the receptor can be evaluated relative to a receptor with known low constitutive activity, or in the case of Gai class proteins, pertussis
toxin can be used. Other toxins and inhibitors for G proteins can be similarly used. For instance, toxins such as cholera or Pasteurella multodda toxin can be used to irreversibly activate G proteins, thus providing a theoretical“maximum" response for the assay.
[0134] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
[0135] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
Claims
1. An in vitro method comprising:
(a) providing a system comprising a G protein coupled receptor (GPCR) fused to a transducer protein (GPCR-transducer fusion) incorporated into a membrane environment, wherein the GPCR and the transducer are capable of reversible physical coupling that switches the receptor between high affinity and low affinity states which are perceived differently by candidate agents;
(b) contacting the system with a composition comprising a plurality of candidate agents;
(c) conducting washing steps to remove unbound candidate agents;
(d) selectively uncoupling the transducer from the GPCR to change the GPCR affinity state mimicking pathway activation; and
(e) eluting bound candidate agents from the affinity-modulated receptor, wherein the eluted candidate agents represent ligands with differential affinity for the GPCR in transducer-coupled versus uncoupled states.
2. The method of claim 1 , further comprising repeating steps (b) to (e) with the eluted candidate agents to enrich for ligands with a desired pharmacology.
3. The method of claim 1 or 2, wherein step (d) comprises contacting the system with an effective amount of non-hydrolyzable guanine nucleotide (GPPNHP) or other agents capable of disrupting the GPCR and transducer interaction.
4. The method of any one of claims 1 to 3, wherein the composition comprises a complex mixture of untagged candidate agents.
5. The method of any one of claims 1 to 4, wherein each candidate agent is tagged with an identifier.
6. The method of claim 5, wherein the identifier is a nucleic acid barcode.
7. The method of any one of claims 1 to 6, wherein the lipid bilayer is a membrane of a micelle, microsome, liposome, or lipid disc.
8. The method of any one of claims 1 to 7, wherein the lipid bilayer is a membrane is a cell membrane or its equivalent untethered, immobilized on a bead, immobilized on a surface, or captured by a filter.
9. The method of any one of claims 1 to 8, wherein the transducer is a G protein a subunit (Ga), arrestin, a signaling associated protein, or a protein or protein fragment that induces active or inactive structural changes in the receptor.
10. The method of claims 1 to 9 wherein the receptor or transducer are derived from non-human mammalian genomes.
11. The method of claims 1 to 9 wherein the receptor or transducer are derived from non-mammalian genomes.
12. A method for measuring G protein pathway activation by an agent, comprising (a) providing a system comprising:
a G protein coupled receptor (GPCR) that is unfused or fused to a Ga protein subunit that is tagged with a fluorescent or luminescent donor or acceptor through empirically optimized insertion sites and incorporated into a lipid bilayer,
a Gb protein subunit and a Gy protein subunit, wherein one of the Gb protein subunit or the Gy protein subunit is tagged with a fluorescent or luminescent donor or acceptor through empirically optimized insertion sites, wherein if the Ga protein subunit is tagged with a fluorescent or luminescent donor, then either the Gb protein subunit or the Gy protein subunit is tagged with a fluorescent acceptor, and wherein if the Ga protein subunit is tagged with a fluorescent acceptor, then either the Gb protein subunit or the Gy protein subunit is tagged with a fluorescent or luminescent donor;
(b) measuring a first resonance energy transfer in the system;
(c) contacting the system with the agent;
(d) measuring a second resonance energy transfer in the system; and
(e) calculating G protein pathway activation (complex dissociation or rearrangement) from the difference between the second bioluminescence resonance energy transfer and the first bioluminescence resonance energy transfer.
13. The method of claim 12, further comprising repeating steps (b) to (e) for the agent at a plurality of doses and calculating a dose-response curve.
14. The method of claim 12 or 13, further comprising repeating steps (b) to (e) for the agent using a plurality of 0a/0b/6g combinations.
15. The method of any one of claims 12 to 14, further comprising repeating steps (b) to (e) overtime to determine kinetic parameters.
16. The method of any one of claims 12 to 15, wherein the agent is first identified by the method of any one of claims 1 to 11.
17. The method of claim 16, wherein the system comprises a GPCR-Ga fusion or GPCR-Ga unfused pair used in the method of any one of claims 1 to 9.
18. The method of any one of claims 12 to 17, wherein the lipid bilayer is a membrane of an intact cell, micelle, microsome, or liposome.
19. The method of any one of claims 12 to 18, wherein other unfused or fused transducers are substituted for the G-protein.
20. The method of any of one of claims 12 to 19 wherein the insertional sites for the Ga/Gb/Gg combinations are as defined in Table 1.
21. The method of any one of claims 12 to 20, wherein the insertional site for the Ga-protein subunit encompasses a position within the Switch III region of the Ga protein.
22. The method of any one of claims 12 to 21 wherein any combination of the GPCR-Ga fusion, Gb protein subunit, or the Gy protein subunit are expressed in a single plasmid under one promoter or in a bidirectional construct.
23. The method of any one of claims 12 to 22, wherein the GPCR, the Ga protein subunit, theGb protein subunit, and the Gy protein subunit are expressed in a stably- transfected cell line.
24. The method of claims 12 to 23 wherein the GPCR, Ga protein subunit, Gb protein subunit, or the Gy protein subunit are derived from non-human mammalian genomes.
25. The method of claims 12 to 23 wherein the GPCR, Ga protein subunit, Gb protein subunit, or the Gy protein subunit are derived from non-mammalian genomes.
26. A method for ligand-free G protein pathway transducerome screening, comprising
(a) providing a system comprising:
a G protein coupled receptor (GPCR),
a Ga protein subunit that is tagged with a fluorescent or luminescent donor or acceptor through empirically optimized insertion sites and incorporated into a lipid bilayer,
aGb protein subunit and Gy protein, wherein one of the G probtein subunit or Gy protein subunit is tagged with a fluorescent or luminescent donor or acceptor through empirically optimized insertion sites,
wherein if the Ga protein subunit is tagged with a fluorescent or luminescent donor, then either the Gb protein subunit or the Gy protein subunit is tagged with a fluorescent acceptor, and wherein if the Ga protein subunit is tagged with a fluorescent acceptor, then either the G pbrotein subunit or the Gy protein subunit is tagged with a fluorescent or luminescent donor;
(b) measuring a first resonance energy transfer in the system without the GPCR;
(c) measuring a second resonance energy transfer in the system with the GPCR but without a ligand; and
(d) calculating a basal G protein pathway activation (complex dissociation or rearrangement) from the difference between the second bioluminescence resonance energy transfer and the first bioluminescence resonance energy transfer, wherein a low basal BRET2 ratio indicates constitutive activation of the G protein pathway.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/296,818 US12360111B2 (en) | 2018-12-04 | 2019-12-03 | G protein-coupled receptor screening systems |
| US19/233,396 US20250298017A1 (en) | 2018-12-04 | 2025-06-10 | G protein-coupled receptor screening systems |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862775045P | 2018-12-04 | 2018-12-04 | |
| US62/775,045 | 2018-12-04 | ||
| US201962886452P | 2019-08-14 | 2019-08-14 | |
| US62/886,452 | 2019-08-14 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/296,818 A-371-Of-International US12360111B2 (en) | 2018-12-04 | 2019-12-03 | G protein-coupled receptor screening systems |
| US19/233,396 Division US20250298017A1 (en) | 2018-12-04 | 2025-06-10 | G protein-coupled receptor screening systems |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020117752A1 true WO2020117752A1 (en) | 2020-06-11 |
Family
ID=70974864
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/064159 Ceased WO2020117752A1 (en) | 2018-12-04 | 2019-12-03 | G protein-coupled receptor screening systems |
Country Status (2)
| Country | Link |
|---|---|
| US (2) | US12360111B2 (en) |
| WO (1) | WO2020117752A1 (en) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030153063A1 (en) * | 2000-11-17 | 2003-08-14 | Feder John N. | Novel human G-protein coupled receptor, HGPRBMY11, expressed highly in heart and variants thereof |
| US20080280308A1 (en) * | 2001-03-14 | 2008-11-13 | Caden Biosciences | G protein coupled receptor signaling modulation |
| US20080286828A1 (en) * | 2003-05-20 | 2008-11-20 | Graeme Milligan | Materials and methods relating to g-protein coupled receptor oligomers |
| US20170234870A1 (en) * | 2014-10-14 | 2017-08-17 | Université de Montréal | Biosensor based on g-beta-gamma-interacting proteins to monitor g-protein activation |
-
2019
- 2019-12-03 WO PCT/US2019/064159 patent/WO2020117752A1/en not_active Ceased
- 2019-12-03 US US17/296,818 patent/US12360111B2/en active Active
-
2025
- 2025-06-10 US US19/233,396 patent/US20250298017A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030153063A1 (en) * | 2000-11-17 | 2003-08-14 | Feder John N. | Novel human G-protein coupled receptor, HGPRBMY11, expressed highly in heart and variants thereof |
| US20080280308A1 (en) * | 2001-03-14 | 2008-11-13 | Caden Biosciences | G protein coupled receptor signaling modulation |
| US20080286828A1 (en) * | 2003-05-20 | 2008-11-20 | Graeme Milligan | Materials and methods relating to g-protein coupled receptor oligomers |
| US20170234870A1 (en) * | 2014-10-14 | 2017-08-17 | Université de Montréal | Biosensor based on g-beta-gamma-interacting proteins to monitor g-protein activation |
Non-Patent Citations (1)
| Title |
|---|
| STRACHAN, RT ET AL.: "Divergent Transducer-specific Molecular Efficacies Generate Biased Agonism at a G Protein-coupled Receptor (GPCR)", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 289, no. 20, 16 May 2014 (2014-05-16), pages 14211 - 14224, XP055716781 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US12360111B2 (en) | 2025-07-15 |
| US20220002357A1 (en) | 2022-01-06 |
| US20250298017A1 (en) | 2025-09-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Milligan et al. | Chimaeric Gα proteins: their potential use in drug discovery | |
| Lai et al. | Structural basis of the PNRC2-mediated link between mRNA surveillance and decapping | |
| US8703915B2 (en) | Mutant proteins and methods for producing them | |
| Cotton et al. | Generation of a dual-labeled fluorescence biosensor for Crk-II phosphorylation using solid-phase expressed protein ligation | |
| US20150099271A1 (en) | Fluorescent proteins, split fluorescent proteins, and their uses | |
| JP6932636B2 (en) | Gβγ interacting protein-based biosensor for monitoring G protein activation | |
| Yumerefendi et al. | ESPRIT: an automated, library-based method for mapping and soluble expression of protein domains from challenging targets | |
| Aitio et al. | Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly | |
| Li et al. | High-throughput profiling of sequence recognition by tyrosine kinases and SH2 domains using bacterial peptide display | |
| Galinski et al. | Multiplexed profiling of GPCR activities by combining split TEV assays and EXT-based barcoded readouts | |
| Pandey et al. | The Caenorhabditis elegans D2-like dopamine receptor DOP-2 physically interacts with GPA-14, a Gαi subunit | |
| Zahm et al. | A communication hub for phosphoregulation of kinetochore-microtubule attachment | |
| JP6251252B2 (en) | Assay | |
| EP2985347A1 (en) | Method for detecting protein stability and uses thereof | |
| William et al. | G-protein-directed ligand discovery with peptide combinatorial libraries | |
| US20250298017A1 (en) | G protein-coupled receptor screening systems | |
| Styles et al. | High-throughput protein binder discovery by rapid in vivo selection | |
| US20110244487A1 (en) | Methods for testing binding of a ligand to a g protein-coupled receptor | |
| Lan et al. | Structural Basis of RACK7 PHD Domain to Read a Pediatric Glioblastoma‐Associated Histone Mutation H3. 3G34R | |
| JP2008511310A (en) | Methods for determining protein solubility | |
| He et al. | Detection of protein–protein interactions by ribosome display and protein in situ immobilisation | |
| Yumerefendi et al. | Library-based methods for identification of soluble expression constructs | |
| Saarinen | Discrete approaches for leveraging g protein-coupled receptors as therapeutic tools | |
| US20220326229A1 (en) | Assay for real-time simultaneous recruitment of arrestin isoforms to g protein-coupled receptors | |
| Alvarez-Curto et al. | Defining the functional equivalence of wild-type and chemically engineered G protein-coupled receptors |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19893530 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 19893530 Country of ref document: EP Kind code of ref document: A1 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 17296818 Country of ref document: US |








