WO2020070363A1 - Método para predecir o pronosticar la respuesta al tratamiento de la esclerosis múltiple con interferón beta. - Google Patents

Método para predecir o pronosticar la respuesta al tratamiento de la esclerosis múltiple con interferón beta.

Info

Publication number
WO2020070363A1
WO2020070363A1 PCT/ES2019/070660 ES2019070660W WO2020070363A1 WO 2020070363 A1 WO2020070363 A1 WO 2020070363A1 ES 2019070660 W ES2019070660 W ES 2019070660W WO 2020070363 A1 WO2020070363 A1 WO 2020070363A1
Authority
WO
WIPO (PCT)
Prior art keywords
levels
sifnar2
treatment
individual
kit
Prior art date
Application number
PCT/ES2019/070660
Other languages
English (en)
French (fr)
Inventor
Begoña OLIVER MARTOS
Laura LEYVA FERNÁNDEZ
Isaac HURTADO GUERRERO
Óscar FERNÁNDEZ FERNÁNDEZ
José PAVÍA MOLINA
Original Assignee
Servicio Andaluz De Salud
Universidad De Málaga
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Servicio Andaluz De Salud, Universidad De Málaga filed Critical Servicio Andaluz De Salud
Priority to EP19869444.0A priority Critical patent/EP3862436A4/en
Priority to US17/281,520 priority patent/US20220043006A1/en
Publication of WO2020070363A1 publication Critical patent/WO2020070363A1/es

Links

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/58—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/715—Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons
    • G01N2333/7156—Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons for interferons [IFN]
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2470/00—Immunochemical assays or immunoassays characterised by the reaction format or reaction type
    • G01N2470/04—Sandwich assay format
    • G01N2470/06—Second binding partner specifically binding complex of analyte with first binding partner
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/28—Neurological disorders
    • G01N2800/285—Demyelinating diseases; Multipel sclerosis
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • the present invention falls within the field of biomedicine, and relates to a method of predicting or predicting the response of patients with multiple sclerosis to IFNB treatment.
  • MS Multiple sclerosis
  • CNS central nervous system
  • interferon beta (IFNB) remains one of the first-line treatments due to its efficacy and safety profile. Numerous clinical trials have shown that it decreases the frequency and severity of outbreaks, the number and volume of brain injuries observed by resonance, and progression on the physical disability scale. However, a significant percentage of patients (30-50%) do not respond adequately to treatment, as they continue with the presence of outbreaks and progress on the physical disability scale. Although there are numerous biomarkers of response to treatment in the research phase, there are none validated and implanted in clinical practice to help predict whether a patient with multiple sclerosis (MS) will respond adequately to treatment with IFNB.
  • MS multiple sclerosis
  • Fig. 1 Detection of recombinant SIFNAR2 by western blot (A) and standard ELISA curve (B) in mean values of optical density (OD) versus concentration (Conc.).
  • Fig. 2 ELISA determination of the concentration of SIFNAR2 in serum of patients with untreated MS (NT-MS) and healthy controls (HC). Untreated MS patients showed significantly lower SIFNAR2 levels than HC (Orpez-Zafra et al, 2015)
  • NT-MS patients showed significantly lower SIFNAR2 levels than healthy controls (HC) and controls of other inflammatory neurological diseases (OIND), and showed no difference with patients with isolated clinical syndrome (CIS).
  • the heterogeneous group of OIND showed no significant differences with the HCs and their levels increased significantly when compared with patients treated with IFNB (EM-IFNB).
  • MS patients treated with bRNA showed significantly higher levels of SIFNAR2 than MS patients without prior treatment and were significantly lower than those of HC.
  • Fig. 4. Follow-up of IFNB treatment over time, from initial (T0), taking at 6 months (6T), to 12 months (T12). IFNB treatment increases SIFNAR2 levels. With all the patients analyzed, IRNb increased SIFNAR2 levels significantly after 6 months of starting treatment.
  • Fig. 5 Basal SIFNAR2 levels as a biomarker of response to IFNB.
  • NR non-responders
  • R responders
  • Logistic regression analysis showed that patients with baseline SIFNAR2 levels less than 43.2 ug / ml had an OR of 5.1 for patients who did not respond to IFNB treatment. The model was adjusted for possible.
  • Fig. 6 Response to treatment with IFNB in NR, from start of treatment (T0), taking at 6 months (6T), up to 12 months (T12). These patients significantly increased SIFNAR2 levels after 6 months of treatment.
  • Fig. 7 Response to IFNB treatment in R, from start of treatment (T0), taking at 6 months (6T), up to 12 months (T12). These patients kept SIFNAR2 levels stable after 6 months of treatment.
  • Fig. 8. Relationship with other clinical variables. Elevated SIFNAR2 levels were observed in patients during relapse (Rei, relapse) compared to the same patient in remission (Rem) (p 0.002).
  • the authors of the present invention have evaluated the serum levels of S ⁇ FNAR2 as a biomarker of response to bRNA as well as its relation with other clinical variables, developing a method to predict or forecast the response to IFNB in patients with multiple sclerosis.
  • the basal levels of S ⁇ FNAR2 are predictive of response to treatment with bRNA and could have clinical applicability when selecting treatment.
  • Lower basal levels of S ⁇ FNAR2 in non-responders are restored after six months of treatment with bRNA and reach similar values to responders.
  • the authors of the present invention propose the determination of a serum biomarker with a technique developed in their laboratory that allows predicting whether or not an MS patient will respond to treatment with IFNB.
  • a first aspect of the invention relates to the use of IFNAR2.3 expression product and / or SIFNAR2 levels, preferably serum levels, to predict or forecast the response of an individual with multiple sclerosis to treatment with IRNb.
  • Said SEQ ID NO: 2 is represented by the following amino acid sequence: (MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHY
  • SIFNAR2 is also defined by a nucleotide or polynucleotide sequence, which constitutes the coding sequence of the protein collected in SEQ ID NO: 2, and which would comprise various variants from: a) acid molecules nucleic encoding a polypeptide comprising the amino acid sequence of SEQ ID NO: 2, b) nucleic acid molecules whose complementary strand hybrid to the polynucleotide sequence of a), c) nucleic acid molecules whose sequence differs from a) and / or b) due to the degeneracy of the genetic code, d) nucleic acid molecules encoding a polypeptide comprising the amino acid sequence with an identity of at least 60%, 70%, 80%, 90%, 95% , 98% or 99% with SEQ ID NO: 2, and in which the polypeptide encoded by said nucleic acids possesses the activity and structural characteristics of the IFNAR2.3 protein.
  • NC Accession No. 1 nucleic acid sequence of GenBank
  • a second aspect of the invention relates to a method of obtaining useful data to predict or forecast the response of an individual with multiple sclerosis to treatment with bRNA, hereinafter the first method of the invention, comprising: a) measuring the expression product of IFNAR2.3 and / or SIFNAR2 levels in a biological sample isolated from the individual, and b) comparing the levels obtained in step (a) with a reference quantity.
  • a third aspect of the invention relates to a method for predicting or forecasting the response of an individual with multiple sclerosis to treatment with bRNA, hereinafter the second method of the invention, comprising steps (a) and (b) of the first method of the invention, and further comprises: c) assigning the individual from step (a) to the group of non-responding individuals when he has significantly lower SIFNAR2 levels compared to responding individuals.
  • the reference quantity is obtained from the constitutive expression values of IFNAR2.3, in a group of individuals responding to the treatment of multiple sclerosis with bRNA.
  • Suitable reference amounts can be determined by the method of the present invention from a reference sample that can be analyzed, for example, simultaneously or consecutively, together with the test biological sample. So for example but Without limiting our, the reference sample may be negative controls, that is, the amounts detected by the method of the invention in samples from individuals not responding to treatment of multiple sclerosis with bRNA.
  • the expression product of IFNAR2.3 is the SIFNAR2 protein.
  • the invention comprises comparing the detection of the SIFNAR2 protein in the biological sample of (a) with the detection of the slFNAR2 protein in a reference population.
  • the methods of the invention to identify responding and non-responding individuals with multiple sclerosis to treatment with bRNA, are preferably carried out prior to initiating treatment with bRNA.
  • the term "comparison” as used in the description refers, but is not limited, to the comparison of IFNAR2.3 expression products and / or SIFNAR2 levels in a sample sample versus population of reference, or alternatively, to the comparison of the amount of the gene expression products or the amount of antibodies against IFNAR2.3 and / or SIFNAR2 of the biological sample to be analyzed, also called the biological test sample, with a amount of the expression products of the genes or with an amount of antibodies against IFNAR2.3 and / or the levels of SIFNAR2 of one or more desirable reference samples.
  • the reference sample can be analyzed, for example, simultaneously or consecutively, together with the test biological sample.
  • the comparison described in section (c) of the method of the present invention can be performed manually or assisted by computer.
  • Steps (b) and / or (c) of the methods described above can be fully or partially automated, for example, by means of robotic sensor equipment for detecting the quantity in step (b) or computerized comparison in step (c).
  • the method of the invention is an in vitro method, and the sample on which the parameters are measured is an isolated sample.
  • an "isolated biological sample” includes, but is not limited to, cells, tissues, and / or biological fluids of an organism, obtained by any method known to a person skilled in the art.
  • the biological sample isolated from an individual in step (a) is serum.
  • the biological sample isolated from an individual in step (a) is cerebrospinal fluid.
  • slFNAR2 refers to the expression product of the IFNAR2.3 gene, preferably being the amino acid sequence of SIFNAR2.
  • the measurement of SIFNAR2 levels although it can be qualitative, can also determine the amount or concentration semi-quantitatively or quantitatively, and can be carried out directly or indirectly.
  • Direct measurement refers to the measurement of the amount or concentration of the gene expression product, based on a signal obtained directly from detection of the protein. Such a signal - which we can also refer to as an intensity signal - can be obtained, for example, by measuring an intensity value of a chemical or physical property of said products.
  • Indirect measurement includes measurement obtained from a secondary component or biological measurement system (eg, measurement of cellular responses, ligands, "tags" or enzymatic reaction products).
  • IFNAR2.3 expression product and / or levels of can be carried out by any means known in the state of the art.
  • immunoassay refers to any analytical technique that is based on the reaction of conjugation of an antibody with an antigen.
  • immunoassays known in the state of the art are, for example, but not limited to: immunoblot, enzyme-linked immunosorbent assay (ELISA), linear immunoassay (LIA), radioimmunoassay (RIA), immunofluorescence, x-map or protein chips .
  • the immunoassay is an enzyme-linked immunosorbent assay or ELISA (Enzyme-Linked ImmunoSorbent Assay).
  • ELISA Enzyme-Linked ImmunoSorbent Assay
  • the ELISA is based on the premise that an immunoreactive agent (antigen or antibody) can be immobilized on a solid support, then contacting that system with a fluid phase that contains the complementary reagent that can bind to a marker compound.
  • an immunoreactive agent antigen or antibody
  • ELISA Enzyme-Linked ImmunoSorbent Assay
  • the ELISA is based on the premise that an immunoreactive agent (antigen or antibody) can be immobilized on a solid support, then contacting that system with a fluid phase that contains the complementary reagent that can bind to a marker compound.
  • ELISA There are different types of ELISA: direct ELISA, indirect ELISA or sandwich ELISA.
  • the ELISA is a sandwich ELISA.
  • marker compound refers to a compound capable of giving rise to a chromogenic, fluorogenic, radioactive and / or chemiluminescent signal that allows the detection and quantification of the amount of antibodies against to IFNAR2.3.
  • the marker compound is selected from the list comprising radioisotopes, enzymes, fluorophores or any molecule that can be conjugated with another molecule or detected and / or directly quantified. This marker compound can bind to the antibody directly, or through another compound.
  • marker compounds that bind directly are, but are not limited to, enzymes such as alkaline phosphatase or peroxidase, radioactive isotopes such as 32 P or 35 S, fluorochromes such as fluorescein, or metal particles, for direct detection by colorimetry, autoradiography. , fluorimetry, or metallography respectively.
  • enzymes such as alkaline phosphatase or peroxidase
  • radioactive isotopes such as 32 P or 35 S
  • fluorochromes such as fluorescein
  • metal particles for direct detection by colorimetry, autoradiography. , fluorimetry, or metallography respectively.
  • kits or devices hereafter the kit or device of the invention, comprising the elements necessary to quantify the IFNAR2.3 expression product and / or determine SIFNAR2 levels.
  • the kit or device of the present invention comprises at least one anti-IFNAR2.3 and / or anti-FNAR2 antibody.
  • the kit of the invention comprises secondary antibodies or positive and / or negative controls.
  • the kit comprises the polypeptide of the invention, produced by recombinant technology, as a positive control.
  • the kit may also include, without limitation, buffers, protein extraction solutions, agents to prevent contamination, inhibitors of protein degradation, etc.
  • the kit can include all the supports and containers necessary for its start-up and optimization.
  • the kit further comprises instructions for carrying out the methods of the invention.
  • the kit of the invention comprises: a) a solid support that has a primary antibody attached
  • the primary antibody is an antibody comprising the amino acid sequence SEQ ID NO: 3 (MLLSQNAFIVRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHY
  • the secondary antibody is an antibody comprising the amino acid sequence SEQ ID NO: 4
  • another aspect of the invention relates to a method of classifying individuals with multiple sclerosis into two groups, hereafter the third method of the invention, a first group that includes individuals identified as responders to bRNA, and a second group that includes individuals identified as non-responders to the IRNb.
  • Another aspect of the invention relates to bRNA for use in the treatment of multiple sclerosis in an individual classified as a responder according to any of the methods of the invention.
  • the invention relates to a computer program comprising program instructions for causing a computer to carry out the method according to any of the methods of the invention.
  • the invention encompasses computer programs arranged on or within a carrier.
  • the carrier can be any entity or device capable of supporting the program.
  • the carrier may be made up of said cable or another device or medium.
  • the carrier could be an integrated circuit in which the program is included, the integrated circuit being adapted to execute, or to be used in the execution of, the corresponding processes.
  • the programs could be embedded in a storage medium, such as a ROM, a CD ROM or a semiconductor ROM, a USB memory, or a magnetic recording medium, for example, a floppy disk or a disk. Lasted.
  • the programs could be supported on a transmittable carrier signal.
  • it could be an electrical or optical signal that could be transported through an electrical or optical cable, by radio or by any other means.
  • the invention also extends to computer programs adapted so that any processing means can carry out the methods of the invention.
  • Such programs may take the form of source code, object code, an intermediate source of code, and object code, for example, as in partially compiled form, or in any other form suitable for use in implementing the processes according to the invention.
  • Computer programs also encompass cloud applications based on this procedure.
  • Another aspect of the invention relates to a computer readable storage medium comprising program instructions capable of causing a computer to carry out the steps of any of the methods of the invention.
  • Another aspect of the invention relates to a transmittable signal comprising program instructions capable of causing a computer to carry out the steps of any of the methods of the invention.
  • the first and / or second method of the invention may include additional steps, such as, for example, protein separation by mono and two-dimensional electrophoresis (2D-PAGE), or pre-digestion with trypsin of a protein mixture (from the sample ) to then purify and analyze the peptides by mass spectrometry (MS), such as MALDI-TOF, or by multidimensional chromatography, by ICAT (Isotope-coded affinity tags), DIGE (, Differential ge I electrophoresis) or protein arrays.
  • MS mass spectrometry
  • polynucleotide and “nucleic acid” are used interchangeably herein, referring to polymeric forms of nucleotides of any length, both ribonucleotides (RNA or RNA) and deoxyribonucleotides (DNA or DNA).
  • amino acid sequence refers to a polymeric form of amino acids of any length, which may be coding or non-coding, chemically or biochemically modified.
  • SIFNAR2 a recombinant SIFNAR2 protein, 249 amino acids and a molecular weight of 29 KDa, which corresponds to the soluble fraction of the IFNB receptor.
  • This protein has been used as a standard in the development and validation of an ELISA for the detection of the soluble form of the IFNB receptor (slFNAR2) in serum.
  • SIFNAR2 The quantification of SIFNAR2 in serum was performed using an ELISA developed and validated in our laboratory ( ⁇ rpez-Zafra T. Bioanalysis 2015; 2869-2880). Each trial included a standard curve, 2 quality controls, and a negative control. SIFNAR2 concentration was determined by optical interpolation of samples and controls on the standard curve. The calibration curve was established using a four-parameter curve fitting model. Non-parametric tests were used to compare SIFNAR2 levels between groups-
  • SIFNAR2 determination by ELISA could be used in clinical practice as a biomarker to predict whether a patient will respond to IFNB treatment.
  • the ELISA technique is easy to implant in clinical diagnostic laboratories and, when determining it in serum, it is a minimally invasive method for the patient.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Chemical & Material Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Health & Medical Sciences (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Método para predecir o pronosticar la respuesta de los individuos con esclerosis múltiple al tratamiento con INF-beta que comprende medir los niveles séricos de sIFNAR2, isoforma soluble del receptor de INF-beta.

Description

Método para predecir o pronosticar la respuesta al tratamiento de la esclerosis múltiple con interferon beta.
La presente invención se encuentra dentro del campo de la biomedicina, y se refiere a un método para predecir o pronosticar la respuesta de los pacientes con esclerosis múltiple al tratamiento con IFNB.
ESTADO DE LA TÉCNICA ANTERIOR
La esclerosis múltiple (EM) es una enfermedad crónica inflamatoria y desmielinizante del sistema nervioso central (SNC), presumiblemente autoinmune. Se caracteriza por la presencia de lesiones inflamatorias en la sustancia blanca y gris del SNC, denominadas placas, en las que se produce pérdida de mielina y cierto grado de degeneración axonal.
Aunque en los últimos años se han desarrollado numerosos fármacos para paliar los efectos de esta enfermedad, el interferon beta (IFNB) sigue siendo uno de los tratamientos de primera línea por su perfil de eficacia y seguridad. Numerosos ensayos clínicos han demostrado que disminuye la frecuencia y gravedad de los brotes, el número y volumen de las lesiones cerebrales observadas por resonancia y la progresión en la escala de discapacidad física. Sin embargo, un porcentaje importante de pacientes (30-50%) no responden adecuadamente al tratamiento, ya que continúan con la presencia de brotes y progresan en la escala de discapacidad física. Aunque existen numerosos biomarcadores de respuesta al tratamiento en fase de investigación, no existe ninguno validado e implantado en la práctica clínica que ayude a predecir si un paciente con esclerosis múltiple (EM) va a responder adecuadamente al tratamiento con IFNB.
Es necesario, por tanto, disponer de una prueba, preferiblemente poco invasiva y fácil de realizar, para determinar si un paciente con esclerosis múltiple va responder o no al tratamiento con IFNB. DESCRIPCIÓN DE LAS FIGURAS
F¡g. 1. Detección de SIFNAR2 recombinante por western blot (A) y curva estándar de ELISA (B) en valores medios de densidad óptica (OD) frente a concentración (Conc.).
Fig. 2. Determinación de ELISA de la concentración de SIFNAR2 en suero de pacientes con EM no tratados (EM-NT) y controles sanos (HC). Los pacientes con EM no tratados mostraron niveles de SIFNAR2 significativamente menores que HC (Orpez-Zafra et al, 2015)
Fig. 3. Los pacientes con EM-NT mostraron niveles de SIFNAR2 significativamente más bajos que los controles sanos (HC) y controles de otras enfermedades inflamatorias neurológicas (OIND), y no mostraron diferencias con los pacientes con síndrome clínico aislado (CIS). El grupo heterogéneo de OIND no mostró diferencias significativas con los HC y sus niveles aumentaron significativamente cuando se compararon con pacientes tratados con IFNB (EM- IFNB). Por otro lado, los pacientes con EM tratados con IRNb mostraron niveles significativamente más altos de SIFNAR2 que los pacientes con EM sin tratamiento previo y fueron significativamente más bajos que los de HC.
Fig. 4. Seguimiento del tratamiento con IFNB en el tiempo, desde inicial (T0), tomando a los 6 meses (6T), hasta los 12 meses (T12). El tratamiento con IFNB aumenta los niveles de SIFNAR2. Con todos los pacientes analizados, el IRNb aumentó los niveles de SIFNAR2 significativamente después de 6 meses de inicio del tratamiento.
Fig. 5. Niveles de SIFNAR2 básales como biomarcador de respuesta al IFNB. Antes del inicio del tratamiento (T0), los pacientes clasificados como no respondedores (NR) tenían niveles significativamente más bajos de SIFNAR2 en comparación con los pacientes respondedores (R). El análisis de regresión logística mostró que los pacientes con niveles SIFNAR2 básales menores de 43.2 ug/ml tenían un OR de 5.1 de pacientes que no respondieron al tratamiento con IFNB. El modelo se ajustó para posible.
Fig. 6. Respuesta al tratamiento con IFNB en NR, desde inicio del tratamiento (T0), tomando a los 6 meses (6T), hasta los 12 meses (T12). Estos pacientes aumentaron significativamente los niveles de SIFNAR2 después de 6 meses de tratamiento.
Fig. 7. Respuesta al tratamiento con IFNB en R, desde inicio del tratamiento (T0), tomando a los 6 meses (6T), hasta los 12 meses (T12). Estos pacientes mantuvieron estables los niveles de SIFNAR2 después de 6 meses de tratamiento. Fig. 8. Relación con otras variables clínicas. Se observaron niveles elevados de SIFNAR2 en pacientes durante la recaída (Reí, del inglés relapse) en comparación con el mismo paciente en remisión (Rem) (p = 0,002).
Fig. 9. Análisis en cuanto a la forma clínica evolutiva de la esclerosis múltiple, desde RR: Remitente recurrente; SP: Secundaria progresiva; hasta PP: Primaria progresiva. Se observó que en PP había elevado SIFNAR2 en comparación con RR y SP (p = 0.042, p = 0.010).
DESCRIPCIÓN DE LA INVENCIÓN
Los autores de la presente invención han evaluado los niveles séricos de SÍFNAR2 como biomarcador de respuesta a IRNb así como su relación con otras variables clínicas, desarrollando un método para predecir o pronosticar la respuesta a IFNB en pacientes con esclerosis múltiple. Tal y como se muestra en los ejemplos de la presente invención, los niveles básales de SÍFNAR2 son predictivos de respuesta al tratamiento con IRNb y podrían tener aplicabilidad clínica al momento de seleccionar el tratamiento. Los niveles básales inferiores de SÍFNAR2 en pacientes que no responden se restablecen después de seis meses de tratamiento con IRNb y alcanzan valores similares a los pacientes respondedores.
En resumen, los autores de la presente invención proponen la determinación de un biomarcador en suero con una técnica desarrollada en su laboratorio que permite predecir si un paciente con EM va a responder o no al tratamiento con IFNB.
Entre otras ventajas, se trata de una prueba mínimamente invasiva para el paciente puesto que se realiza en suero, y además es fácil de implementar ya que el ELISA es una herramienta común utilizada en laboratorios clínicos.
Por tanto, un primer aspecto de la invención se refiere al uso de producto de expresión de IFNAR2.3 y/o de los niveles de SIFNAR2, preferiblemente de los niveles séricos, para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IRNb.
Múltiples variantes de la transcripción que codificaban por lo menos tres isoformas diferentes se han encontrado para el gen que codifica la subnunidad IFNAR2 del receptor de IFNB. La secuencia aminoacídica de SIFNAR2 se encuentra con número de acceso en el GenBank (NCBI) L41943.1 y en la SEQ ID NO: 2 en referencia al gen ÍFNAR2.3. Dicha SEQ ID NO: 2 está representada por la siguiente secuencia aminoacídica: (MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHY
TLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAI
DMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYII
DKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS).
En el contexto de la presente invención, SIFNAR2 se define también por una secuencia de nucleótidos o polinucleótido, que constituye la secuencia codificante de la proteína recogida en la SEQ ID NO: 2, y que comprendería diversas variantes procedentes de: a) moléculas de ácido nucleico que codifican un polipéptido que comprende la secuencia aminoacídica de la SEQ ID NO: 2, b) moléculas de ácido nucleico cuya cadena complementaria híbrida con la secuencia polinucleotídica de a), c) moléculas de ácido nucleico cuya secuencia difiere de a) y/o b) debido a la degeneración del código genético, d) moléculas de ácido nucleico que codifican un polipéptido que comprende la secuencia aminoacídica con una identidad de al menos un 60%, un 70%, un 80%, un 90%, un 95%, un 98% o un 99% con la SEQ ID NO: 2, y en las que el polipéptido codificado por dichos ácidos nucleicos posee la actividad y las características estructurales de la proteína IFNAR2.3. Entre dichas moléculas de ácido nucléico se encuentra la recogida en la secuencia del GenBank (NCBI) L41943.1 y la SEQ ID NO: 1. Dicha SEQ ID N01 está representada por la siguiente secuencia nucleotídica:
(agatgtaaaagtcaagagaagactctaaaaatagcaaagatgcttttgagccagaatgccttcatcttcagatcacttaatttggttctc atggtgtatatcagcctcgtgtttggtatttcatatgattcgcctgattacacagatgaatcttgcactttcaagatatcattgcgaaatttccg gtccatcttatcatgggaattaaaaaaccactccattgtaccaactcactatacattgctgtatacaatcatgagtaaaccagaagatttg aaggtggttaagaactgtgcaaataccacaagatcattttgtgacctcacagatgagtggagaagcacacacgaggcctatgtcacc gtcctagaaggattcagcgggaacacaacgttgttcagttgctcacacaatttctggctggccatagacatgtcttttgaaccaccagag tttgagattgttggttttaccaaccacattaatgtgatggtgaaatttccatctattgttgaggaagaattacagtttgatttatctctcgtcattg aagaacagtcagagggaattgttaagaagcataaacccgaaataaaaggaaacatgagtggaaatttcacctatatcattgacaag ttaattccaaacacgaactactgtgtatctgtttatttagagcacagtgatgagcaagcagtaataaagtctcccttaaaatgcaccctcct tccacctggccaggaatcagaattttcataactttttagcctggccatttcctaacctgccaccgttggaagccatggatatggtggaggt catttacatcaacagaaagaagaaagtgtgggattataattatgatgatgaaagtgatagcgatactgaggcagcgcccaggacaa gtggcggtggctataccatgcatggactgactgtcaggcctctgggtcaggcctctgccacctctacagaatcccagttgatagacccg gagtccgaggaggagcctgacctgcctgaggttgatgtggagctccccacgatgccaaaggacagccctcagcagttggaactctt gagtgggccctgtgagaggagaaagagtccactccaggacccttttcccgaagaggactacagctccacggaggggtctgggggc agaattaccttcaatgtggacttaaactctgtgtttttgagagttcttgatgacgaggacagtgacgacttagaagcccctctgatgctatc gtctcatctggaagagatggttgacccagaggatcctgataatgtgcaatcaaaccatttgctggccagcggggaagggacacagc caacctttcccagcccctcttcagagggcctgtggtccgaagatgctccatctgatcaaagtgacacttctgagtcagatgttgaccttgg ggatggttatataatgagatgactccaaaactattgaatgaacttggacagacaagcacctacagggttctttgtctctgcatcctaactt gctgccttatcgtctgcaagtgttctccaagggaaggaggaggaaactgtggtgttcctttcttccaggtgacatcacctatgcacattcc cagtatggggaccatagtatcattcagtgcattgtttacatattcaaagtggtgcactttgaaggaagcacatgtgcacctttcctttacact aatgcacttaggatgtttctgcatcatgtctaccagggagcagggttccccacagtttcagaggtggtccaggaccctatgatatttctctt ctttcgttcttttttttttttttttgagacagagtctcgttctgtcgcccaagctggagcgcaatggtgtgatcttggctcactgcaacatccgcct cccgggttcaggtgattctcctgcctcagcctccctcgcaagtagctgggattacaggcgcctgccaccatgcctagcaaatttttgtattt ttagtggagacaggattttaccatgttggccaggctggtctcgaactcctgacctcaagtgatctgccctcctcagcctcgtaaagtgctg ggattacaggggtgagccgctgtgcctggctggccctgtgatatttctgtgaaataaattgggccagggtgggagcagggaaagaaa aggaaaatagtagcaagagctgcaaagcaggcaggaagggaggaggagagccaggtgagcagtggagagaaggggggccc tgcacaaggaaacagggaagagccatcgaagtttcagtcggtgagccttgggcacctcacccatgtcacatcctgtctcctgcaattg gaattccaccttgtccagccctccccagttaaagtggggaagacagactttaggatcacgtgtgtgactaatacagaaaggaaacat ggcgtcggggagagggataaaacctgaatgccatattttaagttaaaaaaaaaaaa).
Un segundo aspecto de la invención se refiere a un método de obtención de datos útiles para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IRNb, de ahora en adelante primer método de la invención, que comprende: a) medir el producto de expresión de IFNAR2.3 y/o los niveles de SIFNAR2 en una muestra biológica aislada del individuo, y b) comparar los niveles obtenidos en el paso (a) con una cantidad de referencia.
Un tercer aspecto de la invención se refiere a un método para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IRNb, de ahora en adelante segundo método de la invención, que comprende los pasos (a) y (b) del primer método de la invención, y además comprende: c) asignar al individuo del paso (a) al grupo de individuos no respondedores cuando presenta unos niveles de SIFNAR2 significativamente más bajos en comparación con los individuos respondedores.
La cantidad de referencia se obtiene a partir de los valores de expresión constitutiva de IFNAR2.3, en un grupo de individuos respondedores al tratamiento de la esclerosis múltiple con IRNb. Las cantidades de referencia adecuadas pueden ser determinadas por el método de la presente invención a partir de una muestra de referencia que puede ser analizada, por ejemplo, simultánea o consecutivamente, junto con la muestra biológica problema. Así, por ejemplo pero sin limitarnos, la muestra de referencia pueden ser los controles negativos, esto es, las cantidades detectadas por el método de la invención en muestras de individuos no respondedores al tratamiento de la esclerosis múltiple con IRNb. Preferiblemente, el producto de expresión de IFNAR2.3 es la proteína SIFNAR2. En otra realización más preferida, la invención comprende comparar la detección de la proteína SIFNAR2 en la muestra biológica de (a) con la detección de la proteína slFNAR2en una población de referencia.
Los métodos de la invención, para identificar los individuos con esclerosis múltiple respondedores y no respondedores al tratamiento con IRNb, se llevan a cabo, preferiblemente, antes de iniciar el tratamiento con IRNb.
El término“comparación”, tal y como se utiliza en la descripción, se refiere pero no se limita, a la comparación de los productos de expresión de IFNAR2.3 y/o de los niveles de SIFNAR2 en una muestra problema frente a la población de referencia, o alternativamente, a la comparación de la cantidad de los productos de expresión de los genes o de la cantidad de anticuerpos frente a IFNAR2.3 y/o SIFNAR2 de la muestra biológica a analizar, también llamada muestra biológica problema, con una cantidad de los productos de expresión de los genes o con una cantidad de anticuerpos frente a IFNAR2.3 y/o de los niveles de SIFNAR2 de una o varias muestras de referencia deseable. La muestra de referencia puede ser analizada, por ejemplo, simultánea o consecutivamente, junto con la muestra biológica problema. La comparación descrita en el apartado (c) del método de la presente invención puede ser realizada manualmente o asistida por ordenador.
Los pasos (b) y/o (c) de los métodos descritos anteriormente pueden ser total o parcialmente automatizados, por ejemplo, por medio de un equipo robótico sensor para la detección de la cantidad en el paso (b) o la comparación computerizada en el paso (c).
El método de la invención es un método in vitro, y la muestra sobre la que se miden los parámetros es una muestra aislada. Así, una“muestra biológica aislada” incluye, pero sin limitarnos a, células, tejidos y/o fluidos biológicos de un organismo, obtenidos mediante cualquier método conocido por un experto en la materia. Preferiblemente, la muestra biológica aislada de un individuo del paso (a) es suero. En otra realización preferida, la muestra biológica aislada de un individuo del paso (a) es líquido cefalorraquídeo.
El término “individuo”, tal y como se utiliza en la descripción, se refiere a animales, preferiblemente mamíferos, y más preferiblemente, humanos. El término “individuo” no pretende ser limitativo en ningún aspecto, pudiendo ser éste de cualquier edad, sexo y condición física. Los niveles de“slFNAR2” tal y como se entiende en la presente memoria, hacen referencia al producto de expresión del gen IFNAR2.3, siendo preferiblemente la secuencia aminoacídica de SIFNAR2.
La medida de los niveles de SIFNAR2, aunque puede ser cualitativa, también puede determinarse la cantidad o la concentración de manera semi-cuantitativa o cuantitativa, y puede ser llevada a cabo de manera directa o indirecta. La medida directa se refiere a la medida de la cantidad o la concentración del producto de expresión de los genes, basada en una señal que se obtiene directamente de la detección de la proteína. Dicha señal - a la que también podemos referirnos como señal de intensidad - puede obtenerse, por ejemplo, midiendo un valor de intensidad de una propiedad química o física de dichos productos. La medida indirecta incluye la medida obtenida de un componente secundario o un sistema de medida biológica (por ejemplo la medida de respuestas celulares, ligandos,“etiquetas” o productos de reacción enzimática).
La detección del producto de expresión de IFNAR2.3 y/o de los niveles de puede realizarse por cualquier medio conocido en el estado de la técnica.
En otra realización preferida, la detección de la cantidad de producto de expresión de IFNAR2.3 y/o los niveles de SIFNAR2 se realiza mediante un inmunoensayo. El término “inmunoensayo”, tal y como se utiliza en la presente descripción se refiere a cualquier técnica analítica que se basa en la reacción de la conjugación de una anticuerpo con un antígeno. Ejemplos de inmunoensayos conocidos en el estado de la técnica son, por ejemplo, pero sin limitarse: inmunoblot, ensayo inmunoabsorbente ligado a enzimas (ELISA), inmunoensayo lineal (LIA), radioinmunoensayo (RIA), inmunofluoresecencia, x-map o chips de proteína.
En otra realización preferida, el inmunoensayo es un ensayo inmunoabsorbente ligado a enzimas o ELISA ( Enzyme-Linked ImmunoSorbent Assay). El ELISA se basa en la premisa de que un inmunorreactivo (antígeno o anticuerpo) puede ser inmovilizado en un soporte sólido, poniendo luego ese sistema en contacto con una fase fluida que contiene el reactivo complementario que puede unirse a un compuesto marcador. Existen diferentes tipos de ELISA: ELISA directo, ELISA indirecto o ELISA sándwich. En una realización preferida de este aspecto de la invención, el ELISA es un ELISA sándwich.
El término“compuesto marcador”, tal y como se utiliza en la presente descripción, se refiere a un compuesto capaz de dar lugar a una señal cromogénica, fluorogénica, radiactiva y/o quimioluminiscente que permita la detección y cuantificación de la cantidad de anticuerpos frente a IFNAR2.3. El compuesto marcador se selecciona de la lista que comprende radioisótopos, enzimas, fluoróforos o cualquier molécula susceptible de ser conjugada con otra molécula o detectada y/o cuantificada de forma directa. Este compuesto marcador puede unirse al anticuerpo directamente, o a través de otro compuesto. Algunos ejemplos de compuestos marcadores que se unen directamente son, pero sin limitarse, enzimas como la fosfatasa alcalina o la peroxidasa, isótopos radiactivos como 32P o 35S, fluorocromos como fluoresceína o partículas metálicas, para su detección directa mediante colorimetría, auto- radiografía, fluorimetría, o metalografía respectivamente.
KIT O DISPOSITIVO DE DIAGNÓSTICO Y USOS
Otro aspecto de la presente invención se refiere a un kit o dispositivo, de ahora en adelante kit o dispositivo de la invención, que comprende los elementos necesarios para cuantificar el producto de expresión de IFNAR2.3 y/o determinar los niveles de SIFNAR2.
Preferiblemente, el kit o dispositivo de la presente invención comprende al menos un anticuerpo anti-IFNAR2.3 y/o antisi FNAR2. En otra realización preferida, el kit de la invención comprende anticuerpos secundarios o controles positivos y/o negativos. En una realización mucho más preferente el kit comprende el polipéptido de la invención, producido por tecnología recombinante, como control positivo. El kit además puede incluir, sin ningún tipo de limitación, tampones, soluciones de extracción de proteínas, agentes para prevenir la contaminación, inhibidores de la degradación de las proteínas, etc.
Por otro lado el kit puede incluir todos los soportes y recipientes necesarios para su puesta en marcha y optimización. Preferiblemente, el kit comprende además las instrucciones para llevar a cabo los métodos de la invención.
En otra realización preferida, el kit de la invención comprende: a) un soporte sólido que lleva unido un anticuerpo primario
b) anticuerpo secundario
c) una solución del anticuerpo de detección, marcado con un marcador enzimático; d) un reactivo.
En una realización aún más preferida, el anticuerpo de primario es un anticuerpo que comprende la secuencia aminoacídica SEQ ID NO: 3 (MLLSQNAFIVRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHY
TLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAI
DMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYII
DKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAKIGGIITVFLIALVLTSTIVTLK
WIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCP
SD).
En otra realización más preferida, el anticuerpo secundario es un anticuerpo que comprende la secuencia aminoacídica SEQ ID NO: 4
(MLLSQNAFIVRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHY
TLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAI
DMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYII
DKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAKIGGIITVFLIALVLTSTIVTLK
WIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCP
SD)
USOS MÉDICOS DE LA INVENCIÓN
Los individuos con esclerosis múltiple identificados como respondedores al IRNb según los métodos de la invención serán, por tanto, susceptibles de ser tratados por IRNb.
Por tanto, otro aspecto de la invención se refiere a un método de clasificación de individuos con esclerosis múltiple en dos grupos, de ahora en adelante tercer método de la invención, un primer grupo donde se incluyen los individuos identificados como respondedores al IRNb, y un segundo grupo donde se incluyen los individuos identificados como no respondedores al IRNb.
Otro aspecto de la invención se refiere al IRNb para su uso en el tratamiento de la esclerosis múltiple en un individuo clasificado como respondedor según cualquiera de los métodos de la invención.
AUTOMATIZACIÓN DEL MÉTODO DE LA INVENCIÓN IMPLEMENTÁNDOLO EN UN
PROGRAMA DE ORDENADOR
Otro aspecto de la invención se refiere a un programa de ordenador que comprende instrucciones de programa para hacer que un ordenador lleve a la práctica el procedimiento de acuerdo con cualquiera de los métodos de la invención. En particular, la invención abarca programas de ordenador dispuestos sobre o dentro de una portadora. La portadora puede ser cualquier entidad o dispositivo capaz de soportar el programa. Cuando el programa va incorporado en una señal que puede ser transportada directamente por un cable u otro dispositivo o medio, la portadora puede estar constituida por dicho cable u otro dispositivo o medio. Como variante, la portadora podría ser un circuito integrado en el que va incluido el programa, estando el circuito integrado adaptado para ejecutar, o para ser utilizado en la ejecución de, los procesos correspondientes.
Por ejemplo, los programas podrían estar incorporados en un medio de almacenamiento, como una memoria ROM, una memoria CD ROM o una memoria ROM de semiconductor, una memoria USB, o un soporte de grabación magnética, por ejemplo, un disco flexible o un disco duro. Alternativamente, los programas podrían estar soportados en una señal portadora transmisible. Por ejemplo, podría tratarse de una señal eléctrica u óptica que podría transportarse a través de cable eléctrico u óptico, por radio o por cualesquiera otros medios.
La invención se extiende también a programas de ordenador adaptados para que cualquier medio de procesamiento pueda llevar a la práctica los métodos de la invención. Tales programas pueden tener la forma de código fuente, código objeto, una fuente intermedia de código y código objeto, por ejemplo, como en forma parcialmente compilada, o en cualquier otra forma adecuada para uso en la puesta en práctica de los procesos según la invención. Los programas de ordenador también abarcan aplicaciones en la nube basadas en dicho procedimiento.
Otro aspecto de la invención se refiere a un medio de almacenamiento legible por un ordenador que comprende instrucciones de programa capaces de hacer que un ordenador lleve a cabo los pasos de cualquiera de los métodos de la invención.
Otro aspecto de la invención se refiere a una señal transmisible que comprende instrucciones de programa capaces de hacer que un ordenador lleve a cabo los pasos de cualquiera de los métodos de la invención.
El primer y/o el segundo método de la invención pueden incluir etapas adicionales, como por ejemplo, la separación de proteínas mediante electroforesis mono y bidimensional (2D-PAGE), o la digestión previa con tripsina de una mezcla de proteínas (de la muestra) para después purificar y analizar los péptidos mediante espectrometría de masas (MS), como el MALDI-TOF, o mediante cromatografía multidimensional, mediante ICAT (Isotope-coded affinity tags), DIGE (, Differential ge I electrophoresis) o arrays de proteínas. Los términos “polinucleótido” y “ácido nucleico” se usan aquí de manera intercambiable, refiriéndose a formas poliméricas de nucleótidos de cualquier longitud, tanto ribonucleótidos (ARN ó RNA) como desoxiribonucleótidos (ADN ó DNA).
Los términos“secuencia aminoacídica”,“péptido”,“oligopéptido”,“polipéptido” y“proteína” se usan aquí de manera intercambiable, y se refieren a una forma polimérica de aminoácidos de cualquier longitud, que pueden ser codificantes o no codificantes, química o bioquímicamente modificados.
A lo largo de la descripción y las reivindicaciones la palabra "comprende" y sus variantes no pretenden excluir otras características técnicas, aditivos, componentes o pasos. Para los expertos en la materia, otros objetos, ventajas y características de la invención se desprenderán en parte de la descripción y en parte de la práctica de la invención. Los siguientes ejemplos y dibujos se proporcionan a modo de ilustración, y no se pretende que sean limitativos de la presente invención.
EJEMPLOS DE LA INVENCIÓN
En primer lugar, los autores de la invención clonaron una proteína recombinante análoga a SIFNAR2 humana, que fue identificada por WB y también por MALDI-TOF. Esta proteína se usó en el desarrollo y la validación de un ELISA para detectar SIFNAR2 en suero (Figura 1) (Órpez- Zafra T. Bioanalysis 2015; 2869-2880). La implementación clínica en dos cohortes independientes mostró niveles significativamente más bajos de pacientes con MS no infartados que en controles sanos (Figuras 2 y 3) y niveles aumentados en pacientes tratados con IENb (Figura 3) (Órpez-Zafra T. Bioanalysis 2015; 2869-2880; Órpez-Zafra T. Mult Soler. 2017 Jun;23(7):937-945). Se trata de una proteína recombinante de SIFNAR2, de 249 aminoácidos y un peso molecular de 29 KDa, que se corresponde a la fracción soluble del receptor de IFNB. Ésta proteína ha sido utilizada como standard en el desarrollo y validación de un ELISA para la detección de la forma soluble del receptor de IFNB (slFNAR2) en suero.
Se realizó un estudio longitudinal en el que se incluyó 66 pacientes con EM (básales, 6 y 12 meses después del inicio del tratamiento con IFN), 51 clasificados como respondedores (R) y no respondedores (NR) de acuerdo con la Calificación de Río (Rio J. Mult Soler. 2009. 15: 848- 53). Los brotes, la progresión de la Escala Expandida del Estado de Discapacidad (EDSS) y la actividad de MRI se consideraron como las variables de respuesta a la terapia. 23 pacientes fueron considerados no respondedores de acuerdo con la ocurrencia de dos o tres variables positivas durante el primer año de terapia, de lo contrario, 28 se consideraron respondedores. Además, se incluyeron 12 pacientes con EM en el momento de brote y posteriormente en remisión. Para la forma clínica, se analizaron 143 remitentes recidivantes, 43 progresivos secundarios y 12 primarios progresivos.
La cuantificación de SIFNAR2 en suero se realizó mediante un ELISA desarrollado y validado en nuestro laboratorio (Órpez-Zafra T. Bioanalysis 2015 ; 2869-2880). Cada ensayo incluyó una curva estándar, 2 controles de calidad y un control negativo. La concentración de SIFNAR2 se determinó mediante la interpolación óptica de las muestras y los controles en la curva estándar. La curva de calibración se estableció utilizando un modelo de ajuste de curvas de cuatro parámetros. Se usaron pruebas no paramétricas para comparar los niveles de SIFNAR2 entre grupos-
Se ha observado que antes del inicio del tratamiento, los pacientes NR tenían niveles significativamente más bajos de SIFNAR2 en comparación con los pacientes R (p = 0,026). El análisis de regresión logística mostró que los pacientes con niveles básales de SIFNAR2 inferiores a 43.2 pg/ml tienen un OR de 5.1 (p = 0.012 IC [1.42-18.25]) de no respondedores al tratamiento con IFNB. El modelo se ajustó para posibles variables de confusión, como sexo, edad y tiempo de evolución. Por tanto, individuos que presenten niveles básales de SIFNAR2 inferiores a 100 pg/ml, y más preferiblemente inferiores a 90, 80, 70, 60, 50, y aún más preferiblemente 45 pg/ml pondrán ser incluidos en el grupo de individuos con esclerosis múltiple no respondedores al tratamiento con IFNB. La Tabla 1 muestra el análisis de regresión logística del riesgo de no respuesta según los niveles de SIFNAR2.
Figure imgf000013_0002
Figure imgf000013_0001
La determinación de SIFNAR2 mediante ELISA podría utilizarse en la práctica clínica como biomarcador para predecir si un paciente va a responder al tratamiento con IFNB. La técnica de ELISA es de fácil implantación en los laboratorios de diagnóstico clínico y al realizarse la determinación en suero, supone un método mínimamente invasivo para el paciente.

Claims

REIVINDICACIONES
1.- El uso de los niveles de SIFNAR2 para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IRNb.
2.- Un método de obtención de datos útiles para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IRNb que comprende: a) medir los niveles de SIFNAR2 en una muestra biológica aislada del individuo, y b) comparar los niveles obtenidos en el paso (a) con una cantidad de referencia.
3.- Un método para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IRNb que comprende los pasos (a) y (b) según la reivindicación 2, y además comprende: c) asignar al individuo del paso (a) al grupo de individuos no respondedores cuando presenta unos niveles de SIFNAR2 significativamente más bajos en comparación con los individuos respondedores.
4 - El método según cualquiera de las reivindicaciones 2-3 donde la muestra biológica aislada de un individuo del paso (a) es suero.
5.- El método según cualquiera de las reivindicaciones 2-4 donde la determinación de los niveles de SIFNAR2 se realiza mediante un inmunoensayo.
6.- El método según cualquiera de las reivindicaciones 2-5 donde la determinación de los niveles de SIFNAR2 se realiza mediante una técnica que se selecciona de entre: inmunoblot, ensayo inmunoabsorbente ligado a enzimas (ELISA), inmunoensayo lineal (LIA), radioinmunoensayo (RIA), inmunofluoresecencia, x-map o chips de proteína.
7.- El método según cualquiera de las reivindicaciones 2-8 donde la determinación de los niveles de SIFNAR2 se realiza mediante un ensayo inmunoabsorbente ligado a enzimas o E Ll SA ( Enzyme-Linked ImmunoSorbent Assay) .
8.- El método según cualquiera de las reivindicaciones 2-8 donde la determinación de los niveles de SIFNAR2 se realiza mediante un ELISA sándwich.
9.- Un kit o dispositivo, que comprende los elementos necesarios para cuantificar los niveles de SÍFNAR2.
10.- El kit o dispositivo según la reivindicación anterior, que comprende un anticuerpo primario que comprende la secuencia aminoacídica SEQ ID NO: 3.
11.- El kit o dispositivo según cualquiera de las reivindicaciones 9-10, que comprende un anticuerpo secundario que comprende la secuencia aminoacídica SEQ ID NO: 4.
12.- El kit o dispositivo según cualquiera de las reivindicaciones 9-11, que comprende una proteína recombinante de secuencia aminoacídica SEQ ID NO: 2.
13.- El kit o dispositivo según cualquiera de las reivindicaciones 9-12, que además comprende: a) un soporte sólido que lleva unido un anticuerpo primario
b) anticuerpo secundario
c) una solución del anticuerpo de detección, marcado con un marcador enzimático; y d) un reactivo.
14.- El uso de un kit según cualquiera de las reivindicaciones 9-13 para predecir o pronosticar la respuesta de un individuo con esclerosis múltiple al tratamiento con IENb.
PCT/ES2019/070660 2018-10-02 2019-10-02 Método para predecir o pronosticar la respuesta al tratamiento de la esclerosis múltiple con interferón beta. WO2020070363A1 (es)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP19869444.0A EP3862436A4 (en) 2018-10-02 2019-10-02 METHODS OF PREDICTING OR PROGNOSTING RESPONSE TO TREATMENT OF MULTIPLE SCLEROSIS WITH INTERFERON BETA
US17/281,520 US20220043006A1 (en) 2018-10-02 2019-10-02 Method for predicting or prognosticating the response to the treatment of multiple sclerosis with interferon beta

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
ES201830953 2018-10-02
ESP201830953 2018-10-02

Publications (1)

Publication Number Publication Date
WO2020070363A1 true WO2020070363A1 (es) 2020-04-09

Family

ID=70055696

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/ES2019/070660 WO2020070363A1 (es) 2018-10-02 2019-10-02 Método para predecir o pronosticar la respuesta al tratamiento de la esclerosis múltiple con interferón beta.

Country Status (3)

Country Link
US (1) US20220043006A1 (es)
EP (1) EP3862436A4 (es)
WO (1) WO2020070363A1 (es)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010010057A2 (en) * 2008-07-24 2010-01-28 Merck Serono S.A. Use of genetic markers for identifying the response to interferon treatment in multiple sclerosis patients
WO2015140793A1 (en) * 2014-03-17 2015-09-24 Hadasit Medical Research Services And Development Ltd. Markers for diagnosing multiple sclerosis and predicting responsiveness to interferon treatment

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1994169A4 (en) * 2006-03-06 2009-12-09 Aegera Therapeutics Inc XAF-1, DIAGNOSTIC MARKER FOR INTERFERON SENSITIVITY IN THE TREATMENT OF MULTIPLE SCLEROSIS
ES2470816B1 (es) * 2012-11-22 2015-04-01 Servicio Andaluz De Salud Proteína recombinante y usos en el diagnóstico de la esclerosis múltiple

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010010057A2 (en) * 2008-07-24 2010-01-28 Merck Serono S.A. Use of genetic markers for identifying the response to interferon treatment in multiple sclerosis patients
WO2015140793A1 (en) * 2014-03-17 2015-09-24 Hadasit Medical Research Services And Development Ltd. Markers for diagnosing multiple sclerosis and predicting responsiveness to interferon treatment

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. L41943.1
M.J. PINTO-MEDEL, I. HURTADO GUERRERO, A. ALONSO, J.L. RODRIGUEZ-BADA, P. URBANEJA, Ó. FERNÁNDEZ, L. LEYVA1, B. OLIVER-MARTOS: "Evaluation of soluble IFNbeta receptor (sIFNAR2) as IFNbeta response biomarker in multiple sclerosis patients", MULTIPLE SCLEROSIS JOURNAL 20181001, vol. 24, no. S2, 1 October 2018 (2018-10-01), pages 1 - 2, XP055700014, ISSN: 1352-4585, DOI: 10.1177/1352458518798590 *
ORPEZ-ZAFRA T, BIOANALYSIS, 2015, pages 2869 - 2880
ORPEZ-ZAFRA T, MULT SCLER., vol. 23, no. 7, June 2017 (2017-06-01), pages 937 - 945
ÓRPEZ-ZAFRA T, PAVÍA J, PINTO-MEDEL M J, HURTADO-GUERRERO I, RODRIGUEZ-BADA J L, MARTÍN MONTAÑEZ E, FERNÁNDEZ Ó, LEYVA L, OLIVER-M: "Development and validation of an ELISA for quantification of soluble IFN-beta receptor: assessment in multiple sclerosis", BIOANALYSIS, vol. 7, no. 22, 1 January 2015 (2015-01-01), pages 2869 - 2880, XP002756854, ISSN: 1757-6180, DOI: 10.4155/bio.15.208 *
RÍO J, CASTILLÓ J, ROVIRA A, TINTORÉ M, SASTRE-GARRIGA J, HORGA A, NOS C, COMABELLA M, AYMERICH X, MONTALBÁN X: "Measures in the first year of therapy predict the response to interferon beta in MS", MULTIPLE SCLEROSIS JOURNAL, vol. 15, no. 7, 1 July 2009 (2009-07-01), pages 848 - 853, XP055805565, ISSN: 1352-4585, DOI: 10.1177/1352458509104591 *
RIO J, MULT SCLER., vol. 15, 2009, pages 848 - 53
See also references of EP3862436A4
TERESA ÓRPEZ-ZAFRA, JOSE PAVÍA, ISAAC HURTADO-GUERRERO, MARIA J PINTO-MEDEL, JOSE LUIS RODRIGUEZ BADA, PATRICIA URBANEJA, MARGARIT: "Decreased soluble IFN-beta receptor (sIFNAR2) in multiple sclerosis patients: A potential serum diagnostic biomarker", MULTIPLE SCLEROSIS JOURNAL JUN 2017, vol. 23, no. 7, 31 May 2017 (2017-05-31), pages 937 - 945, XP055805559, ISSN: 1352-4585, DOI: 10.1177/1352458516667564 *

Also Published As

Publication number Publication date
US20220043006A1 (en) 2022-02-10
EP3862436A1 (en) 2021-08-11
EP3862436A4 (en) 2022-08-17

Similar Documents

Publication Publication Date Title
US20230393133A1 (en) Blood biomarker that predicts persistent cognitive dysfunction after concussion
Wang et al. Comparative salivary proteomics analysis of children with and without dental caries using the iTRAQ/MRM approach
EP3260866B1 (en) Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers
KR101559101B1 (ko) 혈액유래 암 진단용 펩티드 마커 및 이를 이용한 암 진단방법
US20180120328A1 (en) Biomarker for psychiatric and neurological disorders
EP3088899A1 (en) Biomarkers for psychiatric diseases including cognitive impairment and methods for detecting psychiatric diseases including cognitive impairment using the biomarkers
JP2018205327A (ja) 子癇前症を診断するための方法および組成物
WO2011085300A2 (en) Compostions and methods relating to monitoring alcohol consumption and alcohol abuse
Demiralp et al. Comprehensive identification of erythrocyte membrane protein deficiency by 2 D gel electrophoresis based proteomic analysis in hereditary elliptocytosis and spherocytosis
ES2932803T3 (es) Biomarcadores para el diagnóstico y/o pronóstico de fragilidad
WO2020070363A1 (es) Método para predecir o pronosticar la respuesta al tratamiento de la esclerosis múltiple con interferón beta.
US20070042429A1 (en) Assay for differentiating Alzheimer's and Alzheimer's-like disorders
WO2014080063A1 (es) Proteína recombinante y usos en el diagnóstico de la esclerosis múltiple
KR20220034707A (ko) 주요 우울 장애 치료 반응성 평가용 바이오마커
EP3436828A1 (de) Markersequenzen für rheumatoide arthritis
Ota et al. Upregulation of plasma CCL8 in mouse model of graft-vs-host disease
ES2728669T3 (es) Procedimientos para determinar el riesgo de diabetes tipo 1 mediante biomarcadores de proteínas séricas
KR102681006B1 (ko) 뇌의 레닌-안지오텐신 시스템 인자를 이용한 알츠하이머병의 진단 방법
ES2657422T3 (es) Método de diagnóstico para trastornos relacionados con el daño cerebral basado en la detección de NDKA
US20060269963A1 (en) Composition for the diagnosis of retinal vascular disease comprising aldolase and method for diagnosis using it
ES2548653A2 (es) Método y kit para el diagnóstico de celiaquía
ES2368293A1 (es) Acil coenzima-a sintetasas de cadena larga (acsl.s) como biomarcadores cito-serológicos en enfermedades inflamatorias o autoinmunes.
WO2015177394A1 (es) Método de obtención de datos útiles para el diagnóstico de hepatocarcinoma en pacientes alcohólicos con hepatitis c
JP2016090456A (ja) ヒトｔリンパ好性ウイルス−１（ｈｔｌｖ−１）関連脊髄症（ｈａｍ／ｔｓｐ）の検査方法、及び検査用キット

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19869444

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019869444

Country of ref document: EP

Effective date: 20210503