WO2020041520A1 - Monoclonal antibodies against human tim-3 - Google Patents
Monoclonal antibodies against human tim-3 Download PDFInfo
- Publication number
- WO2020041520A1 WO2020041520A1 PCT/US2019/047573 US2019047573W WO2020041520A1 WO 2020041520 A1 WO2020041520 A1 WO 2020041520A1 US 2019047573 W US2019047573 W US 2019047573W WO 2020041520 A1 WO2020041520 A1 WO 2020041520A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- fragment
- cdr1
- cdr2
- Prior art date
Links
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 title claims abstract description 126
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 title claims abstract description 120
- 239000012634 fragment Substances 0.000 claims abstract description 115
- 238000000034 method Methods 0.000 claims abstract description 36
- 230000027455 binding Effects 0.000 claims description 102
- 239000000427 antigen Substances 0.000 claims description 51
- 108091007433 antigens Proteins 0.000 claims description 51
- 102000036639 antigens Human genes 0.000 claims description 51
- 210000004027 cell Anatomy 0.000 claims description 32
- 108020004707 nucleic acids Proteins 0.000 claims description 30
- 102000039446 nucleic acids Human genes 0.000 claims description 30
- 150000007523 nucleic acids Chemical class 0.000 claims description 30
- 206010028980 Neoplasm Diseases 0.000 claims description 22
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 22
- 201000011510 cancer Diseases 0.000 claims description 20
- 108060003951 Immunoglobulin Proteins 0.000 claims description 15
- 102000018358 immunoglobulin Human genes 0.000 claims description 15
- 230000002401 inhibitory effect Effects 0.000 claims description 7
- 230000001404 mediated effect Effects 0.000 claims description 6
- 230000001629 suppression Effects 0.000 claims description 6
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 claims description 5
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 claims description 5
- 101150046249 Havcr2 gene Proteins 0.000 claims description 5
- 239000003814 drug Substances 0.000 claims description 5
- 229940124597 therapeutic agent Drugs 0.000 claims description 5
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 4
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 4
- 239000003550 marker Substances 0.000 claims description 3
- 208000002250 Hematologic Neoplasms Diseases 0.000 claims description 2
- 229940127089 cytotoxic agent Drugs 0.000 claims description 2
- 239000002254 cytotoxic agent Substances 0.000 claims description 2
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 claims description 2
- 229960003957 dexamethasone Drugs 0.000 claims description 2
- 201000005787 hematologic cancer Diseases 0.000 claims description 2
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 claims description 2
- 238000003384 imaging method Methods 0.000 claims description 2
- 239000002955 immunomodulating agent Substances 0.000 claims description 2
- 230000002584 immunomodulator Effects 0.000 claims description 2
- 229940121354 immunomodulator Drugs 0.000 claims description 2
- 230000002285 radioactive effect Effects 0.000 claims description 2
- 238000002560 therapeutic procedure Methods 0.000 claims description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 46
- 239000000203 mixture Substances 0.000 description 18
- 108090000765 processed proteins & peptides Proteins 0.000 description 18
- 239000008194 pharmaceutical composition Substances 0.000 description 16
- 235000018102 proteins Nutrition 0.000 description 16
- 108090000623 proteins and genes Proteins 0.000 description 16
- 102000004169 proteins and genes Human genes 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 15
- 235000001014 amino acid Nutrition 0.000 description 14
- 229920001184 polypeptide Polymers 0.000 description 14
- 102000004196 processed proteins & peptides Human genes 0.000 description 14
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 7
- 125000003275 alpha amino acid group Chemical group 0.000 description 7
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 7
- 241000283984 Rodentia Species 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 238000010494 dissociation reaction Methods 0.000 description 6
- 230000005593 dissociations Effects 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 108020001507 fusion proteins Proteins 0.000 description 6
- 102000037865 fusion proteins Human genes 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 101000957437 Homo sapiens Mitochondrial carnitine/acylcarnitine carrier protein Proteins 0.000 description 4
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 4
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 102100038738 Mitochondrial carnitine/acylcarnitine carrier protein Human genes 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 210000004408 hybridoma Anatomy 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 3
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 3
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- FVFVNNKYKYZTJU-UHFFFAOYSA-N 6-chloro-1,3,5-triazine-2,4-diamine Chemical compound NC1=NC(N)=NC(Cl)=N1 FVFVNNKYKYZTJU-UHFFFAOYSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 102100040004 Gamma-glutamylcyclotransferase Human genes 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108010007707 Hepatitis A Virus Cellular Receptor 2 Proteins 0.000 description 2
- 102100037907 High mobility group protein B1 Human genes 0.000 description 2
- 101000886680 Homo sapiens Gamma-glutamylcyclotransferase Proteins 0.000 description 2
- 101001025337 Homo sapiens High mobility group protein B1 Proteins 0.000 description 2
- 101000998953 Homo sapiens Immunoglobulin heavy variable 1-2 Proteins 0.000 description 2
- 101000984189 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily B member 2 Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 102100036887 Immunoglobulin heavy variable 1-2 Human genes 0.000 description 2
- 102100025583 Leukocyte immunoglobulin-like receptor subfamily B member 2 Human genes 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 101150050559 SOAT1 gene Proteins 0.000 description 2
- 102100021993 Sterol O-acyltransferase 1 Human genes 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- JLQUFIHWVLZVTJ-UHFFFAOYSA-N carbosulfan Chemical compound CCCCN(CCCC)SN(C)C(=O)OC1=CC=CC2=C1OC(C)(C)C2 JLQUFIHWVLZVTJ-UHFFFAOYSA-N 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 102000049109 human HAVCR2 Human genes 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 229940027941 immunoglobulin g Drugs 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 108091008042 inhibitory receptors Proteins 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- RGPBUVUVZKQNHD-MDZDMXLPSA-N 2-[2-[3,5-bis(2-hydroxyethoxy)oxolan-2-yl]-2-(2-hydroxyethoxy)ethoxy]ethyl (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCCOCC(OCCO)C1OC(OCCO)CC1OCCO RGPBUVUVZKQNHD-MDZDMXLPSA-N 0.000 description 1
- 102100022524 Alpha-1-antichymotrypsin Human genes 0.000 description 1
- 101000651036 Arabidopsis thaliana Galactolipid galactosyltransferase SFR2, chloroplastic Proteins 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- ZGTMUACCHSMWAC-UHFFFAOYSA-L EDTA disodium salt (anhydrous) Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102100031351 Galectin-9 Human genes 0.000 description 1
- 101710121810 Galectin-9 Proteins 0.000 description 1
- 102100024375 Gamma-glutamylaminecyclotransferase Human genes 0.000 description 1
- 101710201613 Gamma-glutamylaminecyclotransferase Proteins 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 101000678026 Homo sapiens Alpha-1-antichymotrypsin Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101000998947 Homo sapiens Immunoglobulin heavy variable 1-46 Proteins 0.000 description 1
- 101001091242 Homo sapiens Immunoglobulin kappa joining 1 Proteins 0.000 description 1
- 101001008253 Homo sapiens Immunoglobulin kappa variable 3D-7 Proteins 0.000 description 1
- 101000604674 Homo sapiens Immunoglobulin kappa variable 4-1 Proteins 0.000 description 1
- 101000856513 Homo sapiens Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase Proteins 0.000 description 1
- 101001047520 Homo sapiens Probable non-functional immunoglobulin kappa variable 3-7 Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 1
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100036888 Immunoglobulin heavy variable 1-46 Human genes 0.000 description 1
- 102100034892 Immunoglobulin kappa joining 1 Human genes 0.000 description 1
- 102100027407 Immunoglobulin kappa variable 3D-7 Human genes 0.000 description 1
- 102100038198 Immunoglobulin kappa variable 4-1 Human genes 0.000 description 1
- 102100025509 Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100022959 Probable non-functional immunoglobulin kappa variable 3-7 Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 108091005906 Type I transmembrane proteins Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 108010025592 aminoadipoyl-cysteinyl-allylglycine Proteins 0.000 description 1
- 230000002052 anaphylactic effect Effects 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- LFYJSSARVMHQJB-QIXNEVBVSA-N bakuchiol Chemical compound CC(C)=CCC[C@@](C)(C=C)\C=C\C1=CC=C(O)C=C1 LFYJSSARVMHQJB-QIXNEVBVSA-N 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 208000026037 malignant tumor of neck Diseases 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 229940111688 monobasic potassium phosphate Drugs 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 229940043515 other immunoglobulins in atc Drugs 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- BBMHARZCALWXSL-UHFFFAOYSA-M sodium dihydrogenphosphate monohydrate Chemical compound O.[Na+].OP(O)([O-])=O BBMHARZCALWXSL-UHFFFAOYSA-M 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
Definitions
- T cell immunoglobulin and mucin-domain containing-3 also known as Hepatitis A virus cellular receptor 2 (HAVCR2), is a type I transmembrane protein and is an inhibitory receptor that is expressed on IFN-g-producing T cells, Foxp3+ Treg cells and innate immune cells such as macrophages and dendritic cells. Tim-3 can suppress immune responses upon interaction with its ligands.
- HAVCR2 Hepatitis A virus cellular receptor 2
- Tim-3 contains a N- terminal immunoglobulin (IgV) domain, a mucin domain containing O-linked glycosylation sites, a stalk domain lying between the mucin and transmembrane domain with sites for N-linked sugars, a transmembrane domain and a cytoplasmic tail (Monney 2002).
- IgV domain N- terminal immunoglobulin domain
- mucin domain containing O-linked glycosylation sites
- a stalk domain lying between the mucin and transmembrane domain with sites for N-linked sugars a transmembrane domain and a cytoplasmic tail
- the inventor's laboratory previously reported that the IgV domain of Tim-3 is a functional domain which can bind carbohydrates (Cao 2007).
- Tim-3 IgV domain contains two noncanonical disulfide bonds and a unique CC'-FG cleft which is a signature structure identified in all Tim family proteins but is not in other immunoglobulin superfamily members (Cao 2007).
- Tim-3 (Koyama 2016).
- other molecules reported to be ligands for Tim-3, including Galectin-9 (Zhu 2005), Phosphatidylserine (DeKruyff 2010), HMGB1 (high-mobility group box 1 ) (Chiba 2012), and LILRB2 (Leukocyte immunoglobulin like receptor B2) (PCT Publ. No. W016/1 1 1947).
- An antibody or antigen-binding fragment thereof which binds to an IgV domain of a human Tim-3 (T cell immunoglobulin and mucin-domain containing- 3) or IgV mucin-stalk of a human Tim-3, and comprises:
- a heavy chain comprising one or more of:
- GYSFTGYTIN (SEQ ID NO: 1 ) (complementarity determining region (CDR) 1 (CDR1 )); LFNPYNGGTT (SEQ ID NO:2) (CDR2);
- ARRYYGYDAMDY (SEQ ID NO:3) (CDR3);
- a light chain comprising one or more of:
- KSSQSVLYSSNQKNHLA (SEQ ID NO:4) (CDR1 );
- KASQNVDTAVA (SEQ ID NO: 10) (CDR1 );
- SASNRYT SEQ ID NO:1 1 ) (CDR2)
- An antibody or antigen-binding fragment thereof which binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, and comprises: a heavy chain comprising GYSFTGYTIN (SEQ ID NO:1 ) (CDR1 );
- ARRYYGYDAMDY SEQ ID N0:3) (CDR3);
- KSSQSVLYSSNQKNHLA (SEQ ID NO:4) (CDR1 );
- An antibody or antigen-binding fragment thereof which binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, and comprises: a heavy chain comprising
- KASQNVDTAVA (SEQ ID NO: 10) (CDR1 );
- SASNRYT SEQ ID NO:1 1 ) (CDR2)
- An isolated antibody which binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, with an affinity of 10.0 nM KD or stronger.
- a nucleic acid is provided encoding a heavy chain of an antibody which comprises one or more of:
- ARRYYGYDAMDY (SEQ ID NO:3) (CDR3).
- a nucleic acid is provided encoding a heavy chain of an antibody which comprises one or more of:
- GFNIKDYYMH (SEQ ID NO:7) (CDR1 ); WIDPENDNTIY (SEQ ID NO:8) (CDR2);
- a nucleic acid is provided encoding a light chain of an antibody which comprises one or more of:
- KSSQSVLYSSNQKNHLA (SEQ ID NO:4) (CDR1 );
- a nucleic acid is provided encoding a light chain of an antibody which comprises one or more of:
- KASQNVDTAVA (SEQ ID NO: 10) (CDR1 );
- a host cell comprising one or more of the nucleic acids described herein.
- An antibody or fragment thereof described herein is provided linked or conjugated to a therapeutic agent.
- a method of inhibiting a human Tim-3 in a subject comprising administering an amount of an antibody or fragment thereof as described herein effective to inhibit a human Tim-3.
- a method is provided of inhibiting Tim-3-mediated T cell suppression in a subject comprising administering an amount of an antibody or fragment thereof as described herein effective to inhibit Tim-3-mediated T cell suppression.
- a method is provided of treating a cancer in a subject comprising administering an amount of an antibody or fragment thereof as described herein effective to treat a cancer in a subject.
- a method is provided of detecting a human Tim-3-positive cell in a subject comprising administering an amount of an antibody or fragment thereof as described herein, having a detectable marker conjugated thereto, in an amount effective to label a human Tim-3-positive cell and then detecting the presence of the label in the subject, thereby detecting a human Tim-3-positive cell in a subject.
- nucleic acid is a DNA.
- nucleic acid is a cDNA.
- nucleic acid is an RNA.
- the antigen-binding fragment of the antibody is a Tim-3 IgV domain-binding fragment thereof. In embodiments, the antigen-binding fragment of the antibody is a human Tim-3 IgV domain-binding fragment thereof.
- a vector encoding the nucleic acid molecule described herein is provided.
- a host cell comprising the nucleic acid molecule described herein, or the vector described herein, is provided.
- a method of producing an anti-Tim-3 IgV domain antibody, or Tim-3 IgV domain-binding fragment thereof comprising culturing the host cell described herein, under conditions wherein the anti-Tim-3 IgV domain antibody, or Tim-3 IgV domain-binding fragment thereof, is produced by the host cell.
- a pharmaceutical composition comprising an anti-Tim-3 IgV domain antibody, or Tim-3 IgV domain-binding fragment thereof, described herein, and a pharmaceutically acceptable excipient, is provided.
- a method of reducing an activity of Tim-3 in a subject in need thereof comprising administering to said subject a therapeutically effective amount of the anti-Tim-3 IgV domain antibody, or Tim-3 IgV domain-binding fragment thereof, as described herein.
- FIG. 1 ELISA shows 50B5 binds to Tim-3-lgV protein and Tim-3 whole extracellular part protein (IgVmucin-stalk), but not human IgG control protein.
- FIG. 2. FACS shows 50B5 bind to cell lines expressing human Tim-3, but not mouse Tim-3. 50B5 (open histograms) or mouse lgG1 isotype control (shaded histograms)
- FIG. 3 Kinetic parameters for 50B5 from Surface Plasmon Resonance.
- FIG. 4A-4B 4A: In mixed lymphocyte reaction assay, divided CD4 and CD8 T cells, but not undivided CD4 and CD8T cells, expressed Tim-3 on day 4.
- FIG. 5 FACS shows 15B4 bind to a cell line expressing human Tim-3. 15B4 (open histograms) or mouse lgG1 isotype control (shaded histograms).
- FIG. 6 Kinetic parameters from Surface Plasmon Resonance.
- An antibody or antigen-binding fragment thereof which binds to an IgV domain of a human Tim-3 (T cell immunoglobulin and mucin-domain containing- 3) or IgV mucin-stalk of a human Tim-3, and comprises:
- a heavy chain comprising one or more of:
- ARRYYGYDAMDY (SEQ ID NO:3) (CDR3);
- a light chain comprising one or more of:
- KSSQSVLYSSNQKNHLA (SEQ ID NO:4) (CDR1 );
- KASQNVDTAVA (SEQ ID NO:10) (CDR1 );
- SASNRYT SEQ ID NO:1 1 ) (CDR2)
- An antibody or antigen-binding fragment thereof which binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, and comprises: a heavy chain comprising
- ARRYYGYDAMDY SEQ ID NO:3 (CDR3);
- KSSQSVLYSSNQKNHLA (SEQ ID NO:4) (CDR1 );
- An antibody or antigen-binding fragment thereof which binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, and comprises: a heavy chain comprising
- KASQNVDTAVA (SEQ ID NO: 10) (CDR1 );
- SASNRYT SEQ ID NO:1 1 ) (CDR2)
- the framework regions of the light chain and the heavy chain are human framework regions, or have 85% or more identify thereto.
- the framework regions of the light chain and the heavy chain are human framework regions.
- An isolated antibody or antigen-binding fragment thereof is provided which binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, with an affinity of 10.0 nM KD or stronger.
- the antibody binds to an IgV domain of a human Tim-3 or IgV mucin-stalk of a human Tim-3, with an affinity of 1.0 nM K D or stronger.
- the antibody binds to an IgV domain of a human Tim-3 or IgV mucin- stalk of a human Tim-3, with an affinity of 0.5 nM K D or stronger.
- the antibody does not bind mouse Tim-3.
- the antibody inhibits binding of human Tim-3 to phosphatidylserine expressed on a dexamethasone-treated Jurkat T cell.
- the isolated antibody or antigen-binding fragment thereof has a human sequence Fc region.
- the isolated antibody or antigen-binding fragment thereof comprises a heavy chain comprising one or more of:
- ARRYYGYDAMDY (SEQ ID NO:3) (CDR3).
- the isolated antibody or antigen-binding fragment thereof comprises a light chain comprising one or more of:
- the isolated antibody or antigen-binding fragment thereof comprises a heavy chain comprising one or more of:
- the isolated antibody or antigen-binding fragment thereof comprises a light chain comprising one or more of
- SASNRYT (SEQ ID NO:1 1 ) (CDR2)
- QQYSSYPT (SEQ ID NO:12) (CDR3).
- the isolated antibody or antigen-binding fragment thereof the antibody or fragment thereof is chimeric or humanized.
- the isolated antibody or antigen-binding fragment thereof the antibody or fragment thereof is selected from the group consisting of a monoclonal antibody, an scFv, an Fab fragment, an Fab' fragment, and an F(ab)' fragment. It is noted that while an scFv is not strictly a fragment of an antibody, rather it is a fusion protein, herein a fragment of an antibody includes an scFv unless otherwise excluded.
- a nucleic acid is provided encoding a heavy chain of an antibody which comprises one or more of:
- ARRYYGYDAMDY (SEQ ID NO:3) (CDR3).
- a nucleic acid is provided encoding a heavy chain of an antibody which comprises one or more of:
- ARDFGYVAWLVY SEQ ID NO:9 (CDR3).
- a nucleic acid is provided encoding a light chain of an antibody which comprises one or more of:
- KSSQSVLYSSNQKNHLA (SEQ ID NO:4) (CDR1 );
- a nucleic acid is provided encoding a light chain of an antibody which comprises one or more of:
- KASQNVDTAVA (SEQ ID NO: 10) (CDR1 );
- a host cell comprising one or more of the nucleic acids described herein.
- An antibody or fragment thereof described herein is provided linked or conjugated to a therapeutic agent.
- the therapeutic agent is a cytotoxic drug, a radioactive isotope, an immunomodulator, or a second antibody.
- a method of inhibiting a human Tim-3 in a subject comprising administering an amount of an antibody or fragment thereof as described herein, or a human Tim3-binding fragment thereof, effective to inhibit a human Tim-3.
- the subject has a cancer.
- a method of inhibiting Tim-3-mediated T cell suppression in a subject comprising administering an amount of an antibody or fragment thereof as described herein, or a human Tim3-binding fragment thereof, effective to inhibit Tim-3- mediated T cell suppression.
- a method of treating a cancer in a subject comprising administering an amount of an antibody or fragment thereof as described herein, effective to treat a cancer in a subject.
- the cancer is a human Tim-3-positive cancer.
- a method of detecting a human Tim-3-positive cell in a subject comprising administering an amount of an antibody or fragment thereof as described herein, having a detectable marker conjugated thereto, in an amount effective to label a human Tim-3-positive cell and then detecting the presence of the label in the subject, thereby detecting a human Tim-3-positive cell in a subject.
- the label is detected by imaging.
- the cell is a cancer cell.
- the cancer is a hematologic malignancy.
- the cancer is a cancer of lung, gastric, head or neck cancer, schwannoma, melanoma, or follicular B-cell non-Hodgkin lymphoma.
- the cancer comprises a solid tumor.
- the subject is receiving an anti-PD-1 or anti-PD-L1 or anti- CTLA4 therapy.
- the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment thereof comprises (i) a VH framework comprising the framework sequence of human germline IGHV1-2 * 02, IGHV1 -2 * 04, IGHV1-2 * 05, IGHV1 -18 * 04, IGHV1 -69-2 * 01 , IGHV1-46 * 01 , IGHD5-12 * 01 , IGHD5-24 * 01 , IGHD6-25 * 01 , IGHJ3 * 01 , IGHJ4 * 01 , IGHJ4 * 03, IGHJ6 * 01 , IGHJ6 * 02 and/or (ii) a VL framework comprising the framework sequence of human germline IGKV1 -13 * 02, IGKV1 -27 * 01 , IGKV3-7 * 02, IGKV4-1 * 01 , IGKV1 D-13 * 02, IGKV3D-7 * 01 , IGKJ1
- the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment thereof binds Tim-3 IgV domain with a binding affinity (KD) of from about 1x1 O 9 M to about 1x1 O 12 M.
- the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment thereof is a monoclonal antibody.
- the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment thereof is a recombinant antibody.
- the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment thereof has a human framework region.
- the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment thereof has a human constant region.
- the anti-Tim-3 IgV domain antibody is provided.
- the Tim-3 IgV domain-binding fragment of the antibody is provided.
- the Tim-3 IgV domain-binding fragment is an Fab, F(ab)2 or scFv.
- nucleic acid molecule encoding the anti-Tim-3 IgV domain antibody, or Tim-3 IgV domain-binding fragment thereof, described herein is provided.
- the nucleic acid is a DNA.
- nucleic acid is a cDNA.
- nucleic acid is an RNA.
- a vector encoding the nucleic acid molecule described herein is provided.
- a host cell comprising the nucleic acid molecule described herein, or the vector described herein, is provided.
- a method of producing an anti-Tim-3 IgV domain antibody or Tim-3 IgV domain-binding fragment thereof comprising culturing the host cell described herein, under conditions wherein the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain- binding fragment, is produced by the host cell.
- a composition comprising the anti-Tim-3 IgV domain antibody or Tim-3 IgV domain-binding fragment thereof as described herein, and a carrier.
- the composition is a pharmaceutical composition
- the carrier is a pharmaceutical carrier.
- a pharmaceutical composition comprising the antibody or binding fragment thereof, described herein, and a pharmaceutically acceptable excipient, is also provided.
- the term "antibody” refers to an intact antibody, i.e. with complete Fc and Fv regions. "Fragment” refers to any portion of an antibody, or portions of an antibody linked together, such as, in non-limiting examples, a Fab, F(ab)2, a single-chain Fv (scFv), which is less than the whole antibody but which is an antigen- binding portion and which competes with the intact antibody of which it is a fragment for specific binding.
- the antigen is the human Tim-3 IgV domain.
- Such fragments can be prepared, for example, by cleaving an intact antibody or by recombinant means. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989), hereby incorporated by reference in its entirety).
- Antigen-binding fragments may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies or by molecular biology techniques.
- a fragment is an Fab, Fab', F(ab')2, Fd, Fv, complementarity determining region (CDR) fragment, single-chain antibody (scFv), (a variable domain light chain (VL) and a variable domain heavy chain (VH) linked via a peptide linker.
- the scFv comprises a variable domain framework sequence having a sequence identical to a human variable domain FR1 , FR2, FR3 or FR4.
- the scFv comprises a linker peptide from 5 to 30 amino acid residues long.
- the scFv comprises a linker peptide comprising one or more of glycine, serine and threonine residues.
- the linker of the scFv is 10-25 amino acids in length.
- the peptide linker comprises glycine, serine and/or threonine residues (see, e.g., Bird 1988 and Huston 1988, both of which are hereby incorporated by reference in their entirety), or a polypeptide that contains at least a portion of an antibody that is sufficient to confer human Tim-3 IgV domain specific antigen binding on the polypeptide, including a diabody.
- both the mature light and heavy chain variable domains comprise the regions FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is in accordance with the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991 )), Chothia & Lesk 1987, or Chothia 1989, each of which are hereby incorporated by reference in their entirety).
- the term "polypeptide” encompasses native or artificial proteins, protein fragments and polypeptide analogs of a protein sequence.
- a polypeptide may be monomeric or polymeric.
- an Fd fragment means an antibody fragment that consists of the VH and CH1 domains; an Fv fragment consists of the V1 and VH domains of a single arm of an antibody; and a dAb fragment (Ward 1989, hereby incorporated by reference in its entirety) consists of a VH domain.
- fragments are at least 5, 6, 8 or 10 amino acids long.
- the fragments are at least 14, at least 20, at least 50, or at least 70, 80, 90, 100, 150 or 200 amino acids long.
- the term "monoclonal antibody” as used herein refers to an antibody member of a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts. Thus, the modifier “monoclonal” indicates the character of the antibody as not being a mixture of discrete antibodies. In certain embodiments, such a monoclonal antibody typically includes an antibody comprising a polypeptide sequence that binds a human Tim-3 IgV domain antibody.
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins.
- an identified monoclonal antibody can be produced by non-hybridoma techniques, e.g. by appropriate recombinant means once the sequence thereof is identified.
- the antibody is isolated.
- isolated antibody refers to an antibody that by virtue of its origin or source of derivation has one, two, three or four of the following: (1 ) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and (4) does not occur in nature absent the hand of man.
- the antibody is humanized.
- "Humanized" forms of non- human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from a hypervariable region (HVR) (or CDR) of the recipient are replaced by residues from a HVR (or CDR) of a non-human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity.
- HVR hypervariable region
- donor antibody such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity.
- the antibody has 1 , 2, 3, 4, 5, or all 6 CDR1-3 of both the heavy and light chain of the murine antibodies described herein (mAb 15B4 and mAb 50B5).
- framework (FR) residues of the murine mAb are replaced with corresponding human immunoglobulin variable domain framework (FR) residues.
- FR immunoglobulin variable domain framework
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. In an embodiment, the humanized antibodies do not comprise residues that are not found in the recipient antibody or in the donor antibody.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all, or in embodiments substantially all, of the hypervariable loops correspond to those of a non-human immunoglobulin (e.g. mAb 15B4 and mAb 50B5 described herein), and all, or in embodiments substantially all, of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones 1986; Riechmann 1988; Presta 1992; Vaswani & Hamilton 1998; Harris 1995; Hurle & Gross 1994; and U.S. Patent Nos.
- the humanized antibodies do comprise residues that are not found in the recipient antibody or in the donor antibody
- the Fc regions of the antibodies are modified as described in WO 99/58572, the content of which is hereby incorporated by reference in its entirety.
- the antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g. PCT Publ. No. W099/58572; UK Patent Application No. 9809951 .8.
- Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty 1991 ; U.S. Patent Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692; 6,210,671 ; and 6,350,861 ; and PCT Publ. No. W001/27160, each of which is hereby incorporated by reference herein in their entirety.
- humanized antibodies have one or more, or all, CDRs (CDR L1 , CDR L2, CDR L3, CDR H1 , CDR H2, or CDR H3) which are altered with respect to the original antibody, which are also termed one or more CDRs "derived from" one or more CDRs from the original antibody.
- the antibody of the invention is a humanized mAb 15B4 and mAb 50B5 with one or more, or all, CDRs (CDR L1 , CDR L2, CDR L3, CDR H1 , CDR H2, or CDR H3) which are altered with respect to the original antibody.
- the antibody of the invention is a humanized mAb 15B4 and mAb 50B5 with none of its CDRs (CDR L1 , CDR L2, CDR L3, CDR H1 , CDR H2, or CDR H3) altered with respect to the original antibody.
- the antibodies or fragments herein can be produced recombinantly, for example antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes.
- the anti-Tim-3 IgV domain antibody described herein is capable of specifically binding or specifically binds a human Tim-3 IgV domain.
- the terms "is capable of specifically binding” or “specifically binds” refers to the property of an antibody or fragment of binding to the (specified) antigen with a dissociation constant that is ⁇ 1 mM, preferably ⁇ 1 nM and most preferably ⁇ 10 pM.
- the Kd of the antibody (or fragment) for Tim-3 IgV domain is better than 10.0 nM.
- the Kd of the antibody (or fragment) for Tim-3 IgV domain is better than 1.0 nM.
- the Kd of the antibody (or fragment) for Tim- 3 IgV domain is better than 0.5 nM.
- the Kd of the antibody (or fragment) for Tim-3 IgV domain is 0.1 nM or stronger.
- K d is intended to refer to the dissociation constant of an antibody-antigen interaction.
- One way of determining the K d or binding affinity of antibodies to Tim-3 IgV domain is by measuring binding affinity of monofunctional Fab fragments of the antibody. (The affinity constant is the inverted dissociation constant).
- an antibody for example, IgG
- the affinity of a fragment of an anti-human Tim-3 IgV domain antibody can be determined, for example, by surface plasmon resonance (BIAcore3000TM surface plasmon resonance (SPR) system, BIAcore Inc., Piscataway N.J.).
- CM5 chips can be activated with N-ethyl-N'-(3-dimethylaminopropyl)- carbodiinide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions.
- EDC N-ethyl-N'-(3-dimethylaminopropyl)- carbodiinide hydrochloride
- NHS N-hydroxysuccinimide
- Serial dilutions (0.1-1 Ox estimated Kd) of purified Fab samples are injected for 1 min at 100 microliters/min and dissociation times of up to 2 h are allowed.
- concentrations of the Fab proteins are determined by ELISA and/or SDS-PAGE electrophoresis using a Fab of known concentration (as determined by amino acid analysis) as a standard.
- Kd Kinetic association rates (k on ) and dissociation rates (k 0ff ) are obtained simultaneously by fitting the data to a 1 :1 Langmuir binding model (see Karlsson et al.“Kinetic and concentration analysis using BIA technology, Methods: A Companion to Methods Enzymol 6:99-1 10 (1994), the content of which is hereby incorporated in its entirety) using the BIA evaluation program.
- Equilibrium dissociation constant (Kd) values are calculated as k 0ff /k 0n . This protocol is suitable for use in determining binding affinity of an antibody or fragment to any antigen. Other protocols known in the art may also be used, e.g., ELISA.
- An epitope that "specifically binds" to an antibody or a polypeptide is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art.
- a molecular entity is said to exhibit "specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances.
- An antibody “specifically binds” or “preferentially binds” to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
- an antibody that specifically or preferentially binds to a human Tim-3 IgV domain is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other Tim-3 epitopes or non-Tim-3 epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding.
- the term "compete”, as used herein with regard to an antibody means that a first antibody, or an antigen-binding portion thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen-binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
- the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
- each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to "cross-corn pete" with each other for binding of their respective epitope(s).
- Both competing and cross-competing antibodies are encompassed by the present invention. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
- antibodies can be assigned to different classes.
- the antibody or fragment can be, e.g., any of an IgG, IgD, IgE, IgA or IgM antibody or fragment thereof, respectively.
- the antibody is an immunoglobulin G.
- the antibody fragment is a fragment of an immunoglobulin G.
- the antibody is an lgG1 , lgG2, lgG2a, lgG2b, lgG3 or lgG4.
- the antibody comprises sequences from a human lgG1 , human lgG2, human lgG2a, human lgG2b, human lgG3 or human lgG4.
- a combination of any of these antibodies subtypes can also be used.
- One consideration in selecting the type of antibody to be used is the desired serum half-life of the antibody.
- an IgG generally has a serum half-life of 23 days, IgA 6 days, IgM 5 days, IgD 3 days, and IgE 2 days. (Abbas AK, Lichtman AH, Pober JS. Cellular and Molecular Immunology, 4th edition, W.B. Saunders Co., Philadelphia, 2000, hereby incorporated by reference in its entirety).
- variable region refers to the amino- terminal domains of the heavy or light chain of the antibody.
- variable domain of the heavy chain may be referred to as "VH.”
- variable domain of the light chain may be referred to as "VL.”
- VH variable domain of the heavy chain
- VL variable domain of the light chain
- HVRs hypervariable regions
- variable domains The more highly conserved portions of variable domains are called the framework regions (FR).
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991 )).
- the constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
- the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda (l), based on the amino acid sequences of their constant domains.
- hypervariable region refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six HVRs; three in the VH (H1 , H2, H3) and three in the VL (L1 , L2, L3).
- H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
- HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1 ), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
- the variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
- Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions.
- the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, orfrom Pro230, to the carboxyl-terminus thereof.
- the C-terminal lysine of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, an intact antibody as used herein may be an antibody with or without the otherwise C-terminal lysine.
- compositions or pharmaceutical compositions comprising the antibodies, scFvs or fragments of antibodies disclosed herein are preferably comprise stabilizers to prevent loss of activity or structural integrity of the protein due to the effects of denaturation, oxidation or aggregation over a period of time during storage and transportation prior to use.
- the compositions or pharmaceutical compositions can comprise one or more of any combination of salts, surfactants, pH and tonicity agents such as sugars can contribute to overcoming aggregation problems.
- a composition or pharmaceutical composition of the present invention is used as an injection, it is desirable to have a pH value in an approximately neutral pH range, it is also advantageous to minimize surfactant levels to avoid bubbles in the formulation which are detrimental for injection into subjects.
- the composition or pharmaceutical composition is in liquid form and stably supports high concentrations of bioactive antibody in solution and is suitable for inhalational or parenteral administration.
- the composition or pharmaceutical composition is suitable for intravenous, intramuscular, intraperitoneal, intradermal and/or subcutaneous injection.
- the composition or pharmaceutical composition is in liquid form and has minimized risk of bubble formation and anaphylactoid side effects.
- the composition or pharmaceutical composition is isotonic.
- the composition or pharmaceutical composition has a pH or 6.8 to 7.4.
- the ScFvs or fragments of antibodies disclosed herein are lyophilized and/or freeze dried and are reconstituted for use.
- Examples of pharmaceutically acceptable carriers include, but are not limited to, phosphate buffered saline solution, sterile water (including water for injection USP), emulsions such as oil/water emulsion, and various types of wetting agents.
- Preferred diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline, for example 0.9% sodium chloride solution, USP.
- Compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 20th Ed.
- dibasic sodium phosphate potassium chloride
- monobasic potassium phosphate polysorbate 80
- polysorbate 80 e.g., 2-[2-[3,5-bis(2-hydroxyethoxy)oxolan-2-yl]-2-(2- hydroxyethoxy)ethoxy]ethyl (E)-octadec-9-enoate
- disodium edetate dehydrate sucrose
- monobasic sodium phosphate monohydrate and dibasic sodium phosphat
- antibodies, or fragments of antibodies, or compositions, or pharmaceutical compositions described herein can also be lyophilized or provided in any suitable forms including, but not limited to, injectable solutions or inhalable solutions, gel forms and tablet forms.
- Fc domain herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions.
- the human IgG heavy chain Fc domain is usually defined to stretch from an amino acid residue at position Cys226, orfrom Pro230, to the carboxyl-terminus thereof.
- the C-terminal lysine of the Fc domain may be removed, for example, by recombinantly engineering the nucleic acid encoding it.
- the antibody comprises an Fc domain.
- the Fc domain has the same sequence or 99% or greater sequence similarity with a human lgG1 Fc domain.
- the Fc domain has the same sequence or 99% or greater sequence similarity with a human lgG2 Fc domain. In an embodiment, the Fc domain has the same sequence or 99% or greater sequence similarity with a human lgG3 Fc domain. In an embodiment, the Fc domain has the same sequence or 99% or greater sequence similarity with a human lgG4 Fc domain. In an embodiment, the Fc domain is not mutated. In an embodiment, the Fc domain is mutated at the CH2-CH3 domain interface to increase the affinity of IgG for FcRn at acidic but not neutral pH (Dall'Acqua 2006; Yeung 2009). In an embodiment, the Fc domain has the same sequence as a human lgG1 Fc domain.
- the invention encompasses modifications to the variable regions disclosed herein.
- the invention includes antibodies comprising functionally equivalent variable regions and CDRs which do not significantly affect their properties as well as variants which have enhanced or decreased activity and/or affinity.
- the amino acid sequence may be mutated to obtain an antibody with the desired binding affinity to human Tim-3 IgV.
- Modification of polypeptides is routine practice in the art and need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or use of chemical analogs.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.
- Substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place.
- substitutional mutagenesis sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but framework alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of "conservative substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated “exemplary substitutions” in Table 1 , or as further described below in reference to amino acid classes, may be introduced and the products screened.
- Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a b-sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side-chain properties:
- Non-conservative substitutions are made by exchanging a member of one of these classes for another class.
- substitution for example, that may be made is to change one or more cysteines in the antibody, which may be chemically reactive, to another residue, such as, without limitation, alanine or serine.
- alanine or serine for example, there can be a substitution of a non-canonical cysteine.
- the substitution can be made in a CDR or framework region of a variable domain or in the constant region of an antibody.
- the cysteine is canonical.
- Any cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant cross-linking.
- cysteine bond(s) may be added to the antibody to improve its stability, particularly where the antibody is an antibody fragment such as an Fv fragment.
- the antibodies may also be modified, e.g. in the variable domains of the heavy and/or light chains, e.g., to alter a binding property of the antibody. Changes in the variable region can alter binding affinity and/or specificity. In some embodiments, no more than one to five conservative amino acid substitutions are made within a CDR domain. In other embodiments, no more than one to three conservative amino acid substitutions are made within a CDR domain. For example, a mutation may be made in one or more of the CDR regions to increase or decrease the KD of the antibody for human Tim-3 IgV domain, to increase or decrease k 0ff , or to alter the binding specificity of the antibody. Techniques in site-directed mutagenesis are well-known in the art.
- a modification or mutation may also be made in a framework region or constant region to increase the half-life of an anti-human Tim-3 IgV domain antibody. See, e.g., PCT Publication No. WO 00/09560.
- a mutation in a framework region or constant region can also be made to alter the immunogenicity of the antibody, to provide a site for covalent or non-covalent binding to another molecule, or to alter such properties as complement fixation, FcR binding and antibody-dependent cell-mediated cytotoxicity.
- a single antibody may have mutations in any one or more of the CDRs or framework regions of the variable domain or in the constant region.
- an antibody described herein is recombinantly produced.
- the fusion protein is produced in a eukaryotic expression system.
- the fusion protein produced in the eukaryotic expression system comprises glycosylation at a residue on the Fc portion corresponding to Asn297.
- composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein is substantially pure with regard to the antibody, or antigen-binding fragment thereof.
- a composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein is "substantially pure" with regard to the antibody or fragment when at least 60% to 75% of a sample of the composition or pharmaceutical composition exhibits a single species of the antibody, or antigen-binding fragment thereof.
- a substantially pure composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein can comprise, in the portion thereof which is the antibody, or antigen-binding fragment, 60%, 70%, 80% or 90% of the antibody, or antigen-binding fragment, of the single species, more usually about 95%, and preferably over 99%. Purity or homogeneity may be tested by a number of means well known in the art, such as polyacrylamide gel electrophoresis or HPLC. [0112] In an embodiment, the human Tim3 has the following sequence:
- an IgV domain sequence of the antibody comprises: SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNWLRTDERDVN YWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPA
- Tim-3 IgV-lg fusion protein was generated by fusing the human Tim-3 IgV coding region (S22-A132) to a human lgG1 Fc tag of plasmid pMT/BiP as previously described (Zhao 2013). The fusion protein was expressed in a S2 system and then purified. Mice were immunized with Tim-3 IgV-lg fusion protein and hybridomas were generated by standard techniques from splenocytes fused to NSO myeloma cells.
- mAb 50B5 Characterization of mAb 50B5: mAb 50B5 was generated. It is lgG1 with kappa chain. It bound both Tim-3-lgV protein and Tim-3 whole extracellular part protein (IgV-mucin-stalk), but not human IgG protein, in ELISA assay (FIG. 1 ). It was confirmed that 50B5 bound to human Tim-3, but not mouse Tim-3, expressed on cell lines in FACS (FIG. 2). [0119] By Surface Plasmon Resonance method, the binding affinity of mAb 50B5 to human Tim-3 protein was determined to be 0.13 nM KD (FIG. 3).
- mAb 50B5 blocked the binding of human Tim-3 to phosphatidylserine expressed on dexamethasone-treat Jurkat T cells.
- Tim-3 is an inhibitory receptor that is expressed on IFN-g-producing T cells
- mixed lymphocyte reaction was used to test the antagonist ability of mAb 50B5.
- Mature Dendritic cells which were differentiated from monocytes from PBMC from one donor, were incubated with purified T cells, which were from PBMC from another donor, for four days. Divided CD4 T cells and divided CD8 T cells were found, but not the undivided CD4 and CD8 T cells, expressed Tim-3 on their surface (FIG. 4A).
- mAb 50B5 or the control mouse lgG1 was added, and it was found mAb 50B5 increased I FN-g production more than three times than control lgG1 (FIG. 4B).
- 50B5 Heavy chain DNA sequence (414 bp)
- 50B5 Heavy chain Amino acids sequence (138 aa)
- 50B5 Light chain Amino acids sequence (132 aa)
- mAb 15B4 Another mAb, 15B4, was generated by the same technique as above.
- mAb 15B4 is lgG1 with kappa chain, and binds to human Tim-3 expressed on cell lines in FACS (FIG. 5).
- FACS Fluorescence Activated Cell Sorting
- 15B4 Heavy chain Amino acids sequence (138 aa):
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
Claims
Priority Applications (11)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2019325558A AU2019325558A1 (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3 |
SG11202012148RA SG11202012148RA (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3 |
CN201980037800.1A CN112566936A (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies to human TIM-3 |
MX2020013428A MX2020013428A (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3. |
US17/270,405 US20210198357A1 (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3 |
CA3108879A CA3108879A1 (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3 |
EP19852182.5A EP3841125A4 (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3 |
KR1020217004986A KR20210045999A (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibody against human Tim-3 |
JP2021502951A JP2021534735A (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibody against human Tim-3 |
BR112021003018-2A BR112021003018A2 (en) | 2018-08-21 | 2019-08-21 | monoclonal antibodies against human tim-3 |
IL280757A IL280757A (en) | 2018-08-21 | 2021-02-09 | Monoclonal antibodies against human tim-3 |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862720234P | 2018-08-21 | 2018-08-21 | |
US62/720,234 | 2018-08-21 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2020041520A1 true WO2020041520A1 (en) | 2020-02-27 |
Family
ID=69591459
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2019/047573 WO2020041520A1 (en) | 2018-08-21 | 2019-08-21 | Monoclonal antibodies against human tim-3 |
Country Status (12)
Country | Link |
---|---|
US (1) | US20210198357A1 (en) |
EP (1) | EP3841125A4 (en) |
JP (1) | JP2021534735A (en) |
KR (1) | KR20210045999A (en) |
CN (1) | CN112566936A (en) |
AU (1) | AU2019325558A1 (en) |
BR (1) | BR112021003018A2 (en) |
CA (1) | CA3108879A1 (en) |
IL (1) | IL280757A (en) |
MX (1) | MX2020013428A (en) |
SG (1) | SG11202012148RA (en) |
WO (1) | WO2020041520A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2021175191A1 (en) * | 2020-03-02 | 2021-09-10 | 信达生物制药(苏州)有限公司 | Anti-tim-3 antibody and use thereof |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117377692A (en) * | 2021-04-23 | 2024-01-09 | 苏州逻晟生物医药有限公司 | TIM-3-targeting antibodies and uses thereof |
TW202345900A (en) * | 2022-03-14 | 2023-12-01 | 大陸商正大天晴藥業集團南京順欣製藥有限公司 | Pharmaceutical composition of anti-tim-3 antibody and hypomethylating agent |
WO2023174408A1 (en) * | 2022-03-18 | 2023-09-21 | 正大天晴药业集团南京顺欣制药有限公司 | Pharmaceutical combination of anti-tim-3 antibody and anti-pd-l1 antibody |
TW202346342A (en) * | 2022-05-13 | 2023-12-01 | 大陸商正大天晴藥業集團南京順欣製藥有限公司 | Drug combination of anti-TIM-3 antibody and anti-PD-1 antibody |
WO2024051670A1 (en) * | 2022-09-06 | 2024-03-14 | 正大天晴药业集团股份有限公司 | Pharmaceutical combination of antibody binding to tim-3 and antibody binding to pd-1 |
Citations (21)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
US6210671B1 (en) | 1992-12-01 | 2001-04-03 | Protein Design Labs, Inc. | Humanized antibodies reactive with L-selectin |
WO2001027160A1 (en) | 1999-10-14 | 2001-04-19 | Applied Molecular Evolution, Inc. | Methods of optimizing antibody variable region binding affinity |
US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
US20060015952A1 (en) * | 2003-11-13 | 2006-01-19 | Genentech, Inc. | Screening assays and methods of tumor treatment |
US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
US20090197330A1 (en) * | 2005-03-31 | 2009-08-06 | Masanori Numazaki | Anti-cd20 monoclonal antibody |
WO2015069794A2 (en) * | 2013-11-06 | 2015-05-14 | Stem Centrx, Inc. | Novel anti-claudin antibodies and methods of use |
WO2015117002A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
WO2016111947A2 (en) | 2015-01-05 | 2016-07-14 | Jounce Therapeutics, Inc. | Antibodies that inhibit tim-3:lilrb2 interactions and uses thereof |
US20170088616A1 (en) * | 2010-06-11 | 2017-03-30 | Kyowa Hakko Kirin Co., Ltd | Anti-tim-3 antibody |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
PE20181805A1 (en) * | 2016-04-12 | 2018-11-19 | Symphogen As | COMPOSITIONS AND ANTI-TIM-3 ANTIBODIES |
BR112019000431A2 (en) * | 2016-07-14 | 2019-07-09 | Bristol-Myers Squibb Company | antibodies against tim3 and their uses |
BR112019003976A2 (en) * | 2016-08-26 | 2019-05-28 | Beigene Ltd | anti-tim-3 antibodies and their use |
AU2017354071A1 (en) * | 2016-11-01 | 2019-05-23 | Anaptysbio, Inc. | Antibodies directed against T cell immunoglobulin and mucin protein 3 (TIM-3) |
-
2019
- 2019-08-21 EP EP19852182.5A patent/EP3841125A4/en active Pending
- 2019-08-21 CA CA3108879A patent/CA3108879A1/en active Pending
- 2019-08-21 MX MX2020013428A patent/MX2020013428A/en unknown
- 2019-08-21 CN CN201980037800.1A patent/CN112566936A/en active Pending
- 2019-08-21 US US17/270,405 patent/US20210198357A1/en active Pending
- 2019-08-21 BR BR112021003018-2A patent/BR112021003018A2/en unknown
- 2019-08-21 SG SG11202012148RA patent/SG11202012148RA/en unknown
- 2019-08-21 JP JP2021502951A patent/JP2021534735A/en active Pending
- 2019-08-21 KR KR1020217004986A patent/KR20210045999A/en unknown
- 2019-08-21 WO PCT/US2019/047573 patent/WO2020041520A1/en unknown
- 2019-08-21 AU AU2019325558A patent/AU2019325558A1/en active Pending
-
2021
- 2021-02-09 IL IL280757A patent/IL280757A/en unknown
Patent Citations (26)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US6331415B1 (en) | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
US6210671B1 (en) | 1992-12-01 | 2001-04-03 | Protein Design Labs, Inc. | Humanized antibodies reactive with L-selectin |
US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
WO2001027160A1 (en) | 1999-10-14 | 2001-04-19 | Applied Molecular Evolution, Inc. | Methods of optimizing antibody variable region binding affinity |
US20060015952A1 (en) * | 2003-11-13 | 2006-01-19 | Genentech, Inc. | Screening assays and methods of tumor treatment |
US20090197330A1 (en) * | 2005-03-31 | 2009-08-06 | Masanori Numazaki | Anti-cd20 monoclonal antibody |
US20170088616A1 (en) * | 2010-06-11 | 2017-03-30 | Kyowa Hakko Kirin Co., Ltd | Anti-tim-3 antibody |
WO2015069794A2 (en) * | 2013-11-06 | 2015-05-14 | Stem Centrx, Inc. | Novel anti-claudin antibodies and methods of use |
WO2015117002A1 (en) | 2014-01-31 | 2015-08-06 | Novartis Ag | Antibody molecules to tim-3 and uses thereof |
WO2016111947A2 (en) | 2015-01-05 | 2016-07-14 | Jounce Therapeutics, Inc. | Antibodies that inhibit tim-3:lilrb2 interactions and uses thereof |
Non-Patent Citations (33)
Title |
---|
"Remington, The Science and Practice of Pharmacy", 2000, MACK PUBLISHING |
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO. |
BROWN ET AL., CANCER RES, vol. 47, no. 13, 1987, pages 3577 - 3583 |
CAO ET AL., IMMUNITY, vol. 26, no. 3, 2007, pages 311 - 321 |
CHIBA ET AL., NAT IMMUNOL, vol. 13, no. 9, 2012, pages 832 - 842 |
CHOTHIA ET AL., NATURE, vol. 341, no. 6242, 1989, pages 544 - 546 |
CHOTHIALESK, J MOL BIOL, vol. 196, no. 4, 1987, pages 901 - 917 |
DALL'ACQUA ET AL., J BIOL CHEM, vol. 281, no. 33, 2006, pages 23514 - 23524 |
DAUGHERTY ET AL., NUCLEIC ACIDS RES, vol. 19, no. 9, 1991, pages 2471 - 2476 |
DEKRUYFF ET AL., J IMMUNOL, vol. 184, no. 4, 2010, pages 1918 - 1930 |
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, no. 6428, 1993, pages 446 - 448 |
HARRIS, BIOCHEM SOCTRANS, vol. 23, no. 4, 1995, pages 1035 - 1038 |
HURLEGROSS, CURR OPIN BIOTECHNOL, vol. 5, no. 4, 1994, pages 428 - 433 |
HUSTON ET AL., PROC NATL ACAD SCI USA, vol. 85, no. 16, 1988, pages 5879 - 5883 |
JOHNSONWU: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 1 - 25 |
JONES ET AL., NATURE, vol. 321, no. 6069, 1986, pages 522 - 525 |
KARLSSON ET AL.: "Kinetic and concentration analysis using BIA technology", METHODS: A COMPANION TO METHODS ENZYMOL, vol. 6, 1994, pages 99 - 110, XP028085254, DOI: 10.1006/meth.1994.1013 |
KOYAMA ET AL., NAT COMMUN, vol. 7, 2016, pages 10501 |
LOBUGLIO ET AL., PROC NATL ACAD SCI USA, vol. 86, no. 11, 1989, pages 4220 - 4224 |
MONNEY ET AL., NATURE, vol. 415, no. 6871, 2002, pages 536 - 541 |
PRESTA, CURR OPIN BIOTECHNOL, vol. 3, no. 4, 1992, pages 394 - 398 |
RIECHMANN ET AL., NATURE, vol. 332, no. 6162, 1988, pages 323 - 327 |
See also references of EP3841125A4 |
SHAW ET AL., J IMMUNOL, vol. 138, no. 12, 1987, pages 4534 - 4538 |
SHERIFFCONSTANTINE, NAT STRUCT BIOL, vol. 3, no. 9, 1996, pages 733 - 736 |
VASWANIHAMILTON, ANN ALLERGY ASTHMA IMMUNOL, vol. 81, no. 2, 1998, pages 105 - 115 |
VERHOEYEN ET AL., SCIENCE, vol. 239, no. 4847, 1988, pages 1534 - 1536 |
WILKER ET AL., INT IMMUNOL, vol. 19, no. 6, 2007, pages 763 - 773 |
WINTER ET AL., NATURE, vol. 349, no. 6307, 1991, pages 293 - 299 |
XU ET AL., IMMUNITY, vol. 13, 2000, pages 37 - 45 |
YEUNG ET AL., J IMMUNOL, vol. 182, 2009, pages 7663 - 7671 |
ZHAO ET AL., PROC NATL ACAD SCI USA, vol. 110, no. 24, 2013, pages 9879 - 9884 |
ZHU ET AL., NAT IMMUNOL, vol. 6, no. 12, 2005, pages 1245 - 1252 |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2021175191A1 (en) * | 2020-03-02 | 2021-09-10 | 信达生物制药(苏州)有限公司 | Anti-tim-3 antibody and use thereof |
Also Published As
Publication number | Publication date |
---|---|
MX2020013428A (en) | 2021-07-16 |
BR112021003018A2 (en) | 2021-05-11 |
EP3841125A4 (en) | 2022-05-11 |
US20210198357A1 (en) | 2021-07-01 |
AU2019325558A1 (en) | 2020-12-17 |
KR20210045999A (en) | 2021-04-27 |
CN112566936A (en) | 2021-03-26 |
JP2021534735A (en) | 2021-12-16 |
SG11202012148RA (en) | 2021-01-28 |
CA3108879A1 (en) | 2020-02-27 |
IL280757A (en) | 2021-04-29 |
EP3841125A1 (en) | 2021-06-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2020041520A1 (en) | Monoclonal antibodies against human tim-3 | |
US11512137B2 (en) | Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof | |
EP4155320A1 (en) | Anti-b7h4 antibody, and bispecific antibody and use thereof | |
CA3092387A1 (en) | Anti-trem-1 antibodies and uses thereof | |
US20230303694A1 (en) | Antibodies that bind gamma-delta t cell receptors | |
JP2022529340A (en) | Antibodies targeting human CD47 | |
US20230116037A1 (en) | ANTAGONIST ANTIBODIES AGAINST HUMAN IMMUNE CHECKPOINT CEACAM1 (CD66a) AND FORMULATIONS, KITS, AND METHODS OF USE THEREOF | |
WO2019200255A1 (en) | High-affinity mycobacterium tuberculosis capsule-specific human monoclonal antibody | |
EP4155318A1 (en) | Bispecific antibody and use thereof | |
WO2022180271A1 (en) | Antibodies that bind CD123 and gamma-delta T cell receptors | |
US20220195023A1 (en) | Anti-csp antibody variants | |
RU2777336C1 (en) | Monoclonal antibodies against human tim-3 | |
KR20210116429A (en) | Pharmaceutical Compositions Comprising Bispecific Anti-CD37 Antibodies | |
EP4292610A1 (en) | Variant antibodies that bind gamma-delta t cell receptors | |
EP4292609A1 (en) | Compositions comprising antibodies that bind gamma-delta t cell receptors | |
US20230399414A1 (en) | Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof | |
US20210163578A1 (en) | High-affinity mycobacterium tuberculosis capsule-specific human monoclonal antibody | |
AU2021231712A1 (en) | Anti-CD19 antibodies and methods of using and making thereof | |
KR20240070579A (en) | Humanized anti-EGFRVIII antibodies and antigen-binding fragments thereof | |
IL305346A (en) | Antibodies that bind cd123 and gamma-delta t cell receptors |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19852182 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2019325558 Country of ref document: AU Date of ref document: 20190821 Kind code of ref document: A Ref document number: 3108879 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2021502951 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021003018 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 2019852182 Country of ref document: EP Effective date: 20210322 |
|
ENP | Entry into the national phase |
Ref document number: 112021003018 Country of ref document: BR Kind code of ref document: A2 Effective date: 20210218 |