WO2020037024A1 - Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer - Google Patents

Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer Download PDF

Info

Publication number
WO2020037024A1
WO2020037024A1 PCT/US2019/046467 US2019046467W WO2020037024A1 WO 2020037024 A1 WO2020037024 A1 WO 2020037024A1 US 2019046467 W US2019046467 W US 2019046467W WO 2020037024 A1 WO2020037024 A1 WO 2020037024A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
months
drug conjugate
cancer
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/046467
Other languages
English (en)
French (fr)
Inventor
Reshma A. RANGWALA
Esther C.W. BREIJ
Sandra Verploegen
Bart De Goeij
Oyewale O. ABIDOYE
Leonardo V. NICACIO
Stephen C. Alley
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genmab AS
Original Assignee
Genmab AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2019321442A priority Critical patent/AU2019321442A1/en
Priority to BR112021001691-0A priority patent/BR112021001691A2/pt
Priority to KR1020217007245A priority patent/KR20210046016A/ko
Priority to CA3109116A priority patent/CA3109116A1/en
Priority to SG11202101428UA priority patent/SG11202101428UA/en
Priority to US17/268,387 priority patent/US20210308208A1/en
Priority to CN201980054479.8A priority patent/CN112584872A/zh
Priority to EP19849100.3A priority patent/EP3836950A4/en
Application filed by Genmab AS filed Critical Genmab AS
Priority to EA202190102A priority patent/EA202190102A1/ru
Priority to MX2021001058A priority patent/MX2021001058A/es
Priority to JP2021507775A priority patent/JP2021534165A/ja
Publication of WO2020037024A1 publication Critical patent/WO2020037024A1/en
Priority to IL280617A priority patent/IL280617A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6869Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of the reproductive system: ovaria, uterus, testes, prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/05Dipeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/07Tetrapeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/545Heterocyclic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/36Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]

Definitions

  • the present invention relates to anti-tissue factor (TF) antibody-drag conjugates and methods of using the same to treat cancer, such as ovarian cancer, peritoneal cancer, and fallopian tube cancer.
  • cancer such as ovarian cancer, peritoneal cancer, and fallopian tube cancer.
  • Tissue factor also called thromboplastin, factor III or CD 142 is a protein present in subendothelial tissue, platelets, and leukocytes necessary for the initiation of thrombin formation from the zymogen prothrombin. Thrombin formation ultimately leads to the coagulation of blood.
  • TF enables cells to initiate the blood coagulation cascade, and it functions as the high-affinity receptor for the coagulation factor Vila (FVIIa), a serine protease.
  • FVIIa coagulation factor Vila
  • the resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, TF is a potent initiator that is fully functional when expressed on cell surfaces.
  • TF is the cell surface receptor for the serine protease factor Vila (FVIIa). Binding of FVIIa to TF starts signaling processes inside the cell, said signaling function playing a role in angiogenesis.
  • angiogenesis is a normal process in growth and development, as well as in wound healing, it is also a fundamental step in the transition of tumors from a dormant state to a malignant state.
  • cancer cells gain the ability to produce proteins that participate in angiogenesis (i.e., angiogenic growth factors), these proteins are released by the tumor into nearby tissues, thereby stimulating new blood vessels to sprout from existing healthy blood vessels toward and into the tumor. Once new blood vessels enter the tumor, the tumor can rapidly expand its size and invade local tissue and organs. Through the new blood vessels, cancer cells may further escape into the circulation and lodge in other organs to form new tumors, also known as metastasis.
  • TF expression is observed in many types of cancer, and is associated with more aggressive disease. Furthermore, human TF also exists in a soluble alternatively-spliced form, asHTF. It has been found that asHTF promotes tumor growth (Hobbs et al. , 2007, Thrombosis Res. 120(2):S13-S21).
  • epithelial ovarian cancer The most common type of ovarian cancer is epithelial ovarian cancer.
  • epithelial ovarian cancers There are a variety of types of epithelial ovarian cancers, including serous, mucinous, endometroid, clear cell, and others.
  • the stages and treatment are the same for epithelial ovarian, fallopian tube, and primary peritoneal cancers.
  • Platinum doublets are standard of care in first-line advanced ovarian cancer. Almost all patients with advanced disease will receive initial treatment with chemotherapy, and a median overall survival (OS) of nearly four years can be achieved in patients treated with carboplatin plus paclitaxel.
  • OS median overall survival
  • ovarian cancer The greatest unmet need in ovarian cancer is therapy for patients who are resistant to or cannot tolerate platinum-based therapy. These patients have very few treatment options.
  • Single-agent therapies used to treat this subset of patients include paclitaxel, pegylated liposomal doxorubicin (PLD) and topotecan. Response rate is in the 10-15% range and overall survival is approximately 12 months.
  • the combination of avastin with chemotherapy enhanced the progression-free survival (PFS) time from 3.4 months for chemotherapy alone to 6.8 months.
  • PFS progression-free survival
  • the present invention meets the need for improved treatment of ovarian cancer, peritoneal cancer, and fallopian tube cancer by providing highly specific and effective anti-TF antibody-drug conjugates.
  • RNA-drug conjugate that binds to tissue factor (TF)
  • the antibody-drug conjugate comprises an anti-TF antibody or an antigen-binding fragment thereof conjugated to a monomethyl auristatin or a functional analog thereof or a functional derivative thereof
  • the antibody-drug conjugate is administered at a dose ranging from about 0.65 mg/kg to about 2.1 mg/kg.
  • the dose is about 2.0 mg/kg. In some embodiments, the dose is 2.0 mg/kg.
  • the antibody-drug conjugate is administered once about every 3 weeks. In some of any of the embodiments herein, the antibody-drug conjugate is administered once every 3 weeks. In some of any of the embodiments herein, the dose is about 0.65 mg/kg. In some of any of the embodiments herein, the dose is 0.65 mg/kg. In some of any of the embodiments herein, the dose is about 0.9 mg/kg. In some of any of the embodiments herein, the dose is 0.9 mg/kg. In some of any of the embodiments herein, the antibody-drug conjugate is administered once every week. In some of any of the embodiments herein, the antibody-drug conjugate is administered once about every' week.
  • the antibody-drug conjugate is administered once about every 1 week for 3 consecutive weeks followed by about a 1 week resting period during which the antibody-drug conjugate is not administered. In some of any of the embodiments herein, the antibody-drug conjugate is administered once every 1 week for three consecutive weeks followed by a one week resting period during which the antibody-drug conjugate is not administered. In some of any of the embodiments herein, the antibody-drug conjugate is administered on about days 1, 8, and 15 of about a 4-week cycle. In some of any of the embodiments herein, the antibody-drug conjugate is administered on days 1, 8, and 15 of a 4-week cycle.
  • the subject has been previously treated with one or more therapeutic agents and did not respond to the treatment, wherein the one or more therapeutic agents is not the antibody-drug conjugate. In some of any of the embodiments herein, the subject has been previously treated with one or more therapeutic agents and relapsed after the treatment, wherein the one or more therapeutic agents is not the antibody-drug conjugate. In some of any of the embodiments herein, the subject has been previously treated with one or more therapeutic agents and has experienced disease progression during treatment, wherein the one or more therapeutic agents is not the antibody-drug conjugate. In some of any of the embodiments herein, the subject has been previously treated with a platinum-based therapy. In some of any of the embodiments herein, the cancer is platinum-resistant.
  • the subject experienced disease progression or relapsed 2 or more months after treatment with the platinum- based therapy. In some of any of the embodiments herein, the subject experienced disease progression or relapsed within 6 months after treatment with the platinum-based therapy. In some of any of the embodiments herein, the subject experienced disease progression or relapsed between 2 months and 6 months after treatment with the platinum-based therapy. In some of any of the embodiments herein, cancer is not platinum-refractory. In some of any of the
  • the subject did not experience disease progression or relapse within 2 months after treatment with the platinum-based therapy.
  • the subject has been previously treated with a VEGF antagonist.
  • the VEGF antagonist is an anti -VEGF antibody.
  • the anti- VEGF antibody is bevacizumab.
  • the subject received prior systemic therapy and experienced disease progression on or after the systemic therapy.
  • the subject received 1, 2, 3, 4 or 5 rounds of prior systemic therapy.
  • the rounds of prior systemic therapy are in the platinum resistant setting.
  • the prior systemic therapy is a chemotherapy regimen and wherein poly ADP ribose polymerase (PARP) inhibitors are not chemotherapy.
  • the cancer is ovarian cancer.
  • the ovarian cancer is epithelial ovarian cancer.
  • the cancer is peritoneal cancer.
  • the peritoneal cancer is primary peritoneal cancer.
  • the cancer is fallopian tube cancer.
  • the cancer is an advanced stage cancer.
  • the advanced stage cancer is a stage 3 or stage 4 cancer. In some of any of the embodiments herein, the advanced stage cancer is metastatic cancer. In some of any of the embodiments herein, the cancer is recurrent cancer. In some of any of the embodiments herein, the monomethyl auristatin is monomethyl auri statin E (MMAE).
  • the anti-TF antibody or antigen-binding fragment thereof of the antibody-drug conjugate is a monoclonal antibody or a monoclonal antigen-binding fragment thereof. In some of any of the embodiments herein, the anti-TF antibody or antigen-binding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region and a light chain variable region, wherein die heavy chain variable region comprises:
  • the anti-TF antibody or antigen-binding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO:7 and a light chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO:8.
  • the anti-TF antibody or antigen-binding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
  • the anti-TF antibody of the antibody-drug conjugate is tisotumab.
  • the antibody-drug conjugate further comprises a linker between the anti-TF antibody or antigen-binding fragment thereof and the monomethyl auristatin.
  • the linker is a cleavable peptide linker.
  • the cleavable peptide linker has a formula: -MC-vc- PAB-, wherein:
  • vc is the dipeptide valine-citrulline
  • the linker is attached to sulphydiyl residues of the anti-TF antibody obtained by partial reduction or full reduction of the anti-TF antibody or antigen-binding fragment thereof. In some of any of the embodiments herein, the linker is attached to monomethyl auristatin E (MMAE), wherein the antibody-drug conjugate has the following structure:
  • p denotes a number from 1 to 8
  • S represents a sulphydiyl residue of the anti-TF antibody
  • Ab designates the anti-TF antibody or antigen-binding fragment thereof.
  • the average value of p in a population of the antibody-drug conjugates is about 4.
  • the antibody-drug conjugate is tisotumab vedotin.
  • the route of administration for the antibody-drug conjugate is intravenous.
  • one or more therapeutic effects in the subject is improved after administration of the antibody-drug conjugate relative to a baseline.
  • the one or more therapeutic effects is selected from tire group consisting of: size of a tumor derived from the cancer, objective response rate, duration of response, time to response, progression free survival, overall survival and CA-125 level.
  • the size of a tumor derived from the cancer is reduced by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the size of the tumor derived from the cancer before administration of the antibody-drug conjugate.
  • the objective response rate is at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80%.
  • the subject exhibits progression-free survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody-drug conjugate.
  • the subject exhibits overall survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody-drug conjugate.
  • the duration of response to the antibody-drug conjugate is at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody -drug conjugate.
  • the subject exhibits a reduction in CA-125 level in a blood sample from the subject by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the CA-125 level in a blood sample obtained from the subject before administration of the antibody-drag conjugate.
  • the subject has one or more adverse events and is further administered an additional therapeutic agent to eliminate or reduce the severity of the one or more adverse events.
  • the subject is at risk of developing one or more adverse events and is further administered an additional therapeutic agent to prevent or reduce the severity of the one or more adverse events.
  • the one or more adverse events is anaphylaxis, anemia, abdominal pain, hypokalemia, hyponatremia, severe hypersensitivity, epistaxis, an infusion-related reaction, fatigue, nausea, alopecia, conjunctivitis, keratitis, symblepharon, constipation, decreased appetite, diarrhea, vomiting, peripheral neuropathy, or general physical health deterioration.
  • the one or more adverse events is a grade 3 or greater adverse event.
  • the one or more adverse events is a serious adverse event.
  • the one or more adverse events is conjunctivitis and/or keratitis and the additional agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor and/or a steroid eye drop.
  • the antibody-drag conjugate is administered as a monotherapy. In some of any of the embodiments herein, the subject is a human. In some of any of the embodiments herein, the antibody-drag conjugate is in a pharmaceutical composition comprising the antibody- drag conjugate and a pharmaceutical acceptable carrier.
  • kits comprising:
  • FIG. 1 is a diagram showing the mechanism of action (MOA) of the antibody-drag conjugate tisotumab vedotin.
  • FIG. 2 shows an overview of the study design of a clinical trial of tisotumab vedotin administered once every three weeks (Q3W regimen) or on days 1, 8, and 15 of each 28-day cycle (dose dense regimen).
  • FIG. 3 shows in vivo anti-tumor activity of tisotumab vedotin in a SKOV-3 xenograft model in SCID mice.
  • Tumor size was assessed by caliper measurement. Error bars indicate standard error of the mean (S.E.M.).
  • FIG. 4 shows in vivo anti-tumor activity of tisotumab vedotin in an ovarian cancer patient-derived xenograft model in nude mice.
  • Tumor size was assessed by caliper measurement. Error bars indicate standard error of the mean (S.E.M.).
  • FIG. 5 A shows in vivo anti-tumor activity of tisotumab vedotin in an ovarian cancer patient-derived xenograft model in nude mice. Average tumor size in the CTG-0956 patient- derived xenograft model in athymic nude mice after treatment with tisotumab vedotin (2 mg/kg) or an isotype control (2 mg/kg). Tumor size was assessed by caliper measurement. Error bars indicate standard error of the mean (S.E.M.).
  • FIG 5B shows the weight of the mice after treatment with tisotumab vedotin (2 mg/kg) or an isotype control (2 mg/kg).
  • FIG. 6A shows in vivo anti-tumor activity of tisotumab vedotin in an ovarian cancer patient-derived xenograft model in nude mice. Average tumor size in the CTG-1086 patient- derived xenograft model in athymic nude mice after treatment with tisotumab vedotin (2 mg/kg) or an isotype control (2 mg/kg). Tumor size was assessed by caliper measurement. Error bars indicate standard error of the mean (S.E.M.).
  • FIG 6B shows the weight of the mice after treatment with tisotumab vedotin (2 mg/kg) or an isotype control (2 mg/kg).
  • tissue factor tissue factor
  • TF tissue factor
  • CD142 tissue factor antigen
  • TF antigen tissue factor antigen
  • CD 142 antigen any variants, isoforms and species homologs of human tissue factor which are naturally expressed by- cells or are expressed on cells transfected with the tissue factor gene.
  • tissue factor comprises the amino acid sequence found under Genbank accession NP_001984.
  • immunoglobulin refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four inter-connected by disulfide bonds.
  • L light
  • H heavy
  • each heavy chain typically is comprised of a heavy chain variable region (abbreviated herein as VH or VH) and a heavy chain constant region (CH or CH).
  • VH or VH heavy chain variable region
  • CH heavy chain constant region
  • the heavy chain constant region typically is comprised of three domains, CHI, CH2, and CH3.
  • the heavy chains are generally inter-connected via disulfide bonds in the so-called“hinge region.”
  • Each light chain typically is comprised of a tight chain variable region (abbreviated herein as VL or VL) and a tight chain constant region (CL or CL).
  • the tight chain constant region typically is comprised of one domain, CL.
  • the CL can be of k (kappa) or l (lambda) isotype.
  • the terms“constant domain” and“constant region” are used interchangeably herein. Unless stated otherwise, the numbering of amino acid residues in the constant region is according to the EU-index as described in Kabat etal, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD.
  • An immunoglobulin can derive from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG, and lgM.
  • IgG subclasses are also well known to those in the art and include but are not limited to human IgGl , IgG2, IgG3 and IgG4.
  • immunotype refers to the antibody class or subclass (e.g., IgM or IgGl) that is encoded by the heavy chain constant region genes.
  • variable region or‘Variable domain” refers to the domain of an antibody heavy' or light chain that is involved in binding the antibody to antigen.
  • variable regions of the heavy chain and light chain (VH and VL, respectively) of a native antibody may be further subdivided into regions of hypervariability (or hypervariable regions, which may be
  • CDRs complementarity-determining regions
  • FRs framework regions
  • HVRs hypervariable regions
  • CDR-H1, CDR.-H2, CDR-H3 there are three CDRs in each heavy chain variable region
  • CDR-L1, CDR-L2, CDR-L3 three CDRs in each heavy chain variable region
  • CDR-L1, CDR-L2, CDR-L3 three CDRs in each light chain variable region
  • “Framework regions” and“FR” are known in the art to refer to the non-CDR portions of the variable regions of the heavy and light chains.
  • FR-H1, FR-H2, FR-H3, and FR-H4 there are four FRs in each full-length heavy chain variable region (FR-H1, FR-H2, FR-H3, and FR-H4), and four FRs in each full-length light chain variable region (FR-L1, FR-L2, FR-L3, and FR-L4).
  • three CDRs and four FRs are typically arranged from amino- terminus to carboxy-terminus in the fallowing order: FR1, CDR
  • antibody in the context of the present invention refers to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half-life of significant periods of time, such as at least about 30 min, at least about 45 min, at least about one horn- (h), at least about two hours, at least about four hours, at least about eight horns, at least about 12 hours (h), about 24 hours or more, about 48 hours or more, about three, four, five, six, seven or more days, etc., or any other relevant functionally- defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an effector activity).
  • variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as Cl q, the first component in the classical pathway of complement activation.
  • An antibody may also be a bispecific antibody, diabody, multispecific antibody or similar molecule.
  • the term "monoclonal antibody” as used herein refers to a preparation of antibody molecules that are recombinantly produced with a single primary amino acid sequence.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
  • the human monoclonal antibodies may be generated by a hybridoma which includes a B cell obtained from a transgenic or
  • transchromosomal non-human animal such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
  • an "isolated antibody” refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that binds specifically to TF is substantially free of antibodies that bind specifically to antigens other than TF).
  • An isolated antibody that binds specifically to TF can, however, have cross-reactivity to other antigens, such as TF molecules from different species.
  • an isolated antibody can be substantially free of other cellular material and/or chemicals.
  • an isolated antibody includes an antibody conjugate attached to another agent (e.g., small molecule drug).
  • an isolated anti-TF antibody includes a conjugate of an anti-TF antibody with a small molecule drag (e.g, MMAE or MMAF).
  • a “human antibody” refers to an antibody having variable regions in which both the FRs and CDRs are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
  • the human antibodies of the disclosure can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • the term "human antibody,” as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • humanized antibody refers to a genetically engineered non-human antibody, which contains human antibody constant domains and non-human variable domains modified to contain a high level of sequence homology to human variable domains. This can be achieved by grafting of the six non-human antibody complementarity-determining regions (CDRs), which together form the antigen binding site, onto a homologous human acceptor framework region (FR) (see W092/22653 and EP0629240). In order to fully reconstitute the binding affinity and specificity of the parental antibody, the substitution of framework residues from the parental antibody (i.e. the non-human antibody) into the human framework regions (back-mutations) may be required.
  • CDRs complementarity-determining regions
  • FR homologous human acceptor framework region
  • a humanized antibody may comprise non-human CDR sequences, primarily human framework regions optionally comprising one or more amino acid back-mutations to the non-human amino acid sequence, and fully human constant regions.
  • additional amino acid modifications which are not necessarily back-mutations, may be applied to obtain a humanized antibody with preferred characteristics, such as affinity and biochemical properties.
  • chimeric antibody refers to an antibody wherein the variable region is derived from a non-human species (e.g. derived from rodents) and the constant region is derived from a different species, such as human.
  • Chimeric antibodies may be generated by antibody engineering.“Antibody engineering” is a term used generic for different kinds of modifications of antibodies, and which is a well-known process for the skilled person.
  • a chimeric antibody may be generated by using standard DNA techniques as described in Sambrook et al, 1989, Molecular Cloning: A laboratory Manual, New York: Cold Spring Harbor Laboratory Press, Ch. 15.
  • the chimeric antibody may be a genetically or an enzymatically engineered recombinant antibody.
  • Chimeric monoclonal antibodies for therapeutic applications are developed to reduce antibody immunogenicity. They may typically contain non-human (e.g. murine) variable regions, which are specific for the antigen of interest, and human constant antibody heavy and light chain domains.
  • the terms“variable region” or‘Variable domains” as used in the context of chimeric antibodies, refers to a region which comprises the CDRs and framework regions of both the heavy and light chains of the immunoglobulin.
  • an anti-antigen antibody refers to an antibody that binds to the antigen.
  • an anti-TF antibody is an antibody that binds to the antigen TF.
  • an "antigen-binding portion" or antigen-binding fragment” of an antibody refers to one or more fragments of an antibody that retain the ability to bind specifically to the antigen bound by the whole antibody.
  • antibody fragments include but are not limited to Fv, Fab, Fab', Fab’-SH, F(ab')2; diabodies; linear antibodies;
  • single-chain antibody molecules e.g. scFv
  • multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called“Fab” fragments, each with a single antigen-binding site, and a residual“Fc” fragment, whose name reflects its ability to crystallize readily.
  • Pepsin treatment yields an F(ab’)2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
  • Percent (%) sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • % sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
  • binding typically is a binding with an affinity corresponding to a KD of about 10 "6 M or less, e.g.
  • the amount with which the KD of binding is lower is dependent on tire KD of the antibody, so that when the KD of the antibody is very low, then the amount with which the KD of binding to the antigen is lower than the KD of binding to a non-specific antigen may be at least 10,000-fold (that is, the antibody is highly specific).
  • KD refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. Affinity, as used herein, and KD are inversely related, that is that higher affinity is intended to refer to lower KD, and lower affinity is intended to refer to higher KD.
  • ADC refers to an antibody-drug conjugate, which in the context of the present invention refers to an anti-TF antibody, which is coupled to a drug moiety (e.g, MMAE or MMAF) as described in the present application.
  • a drug moiety e.g, MMAE or MMAF
  • PAB refers to the self-immolative spacer
  • MC refers to the stretcher maleimidocaproyl :
  • the term“Ab-MC-vc-PAB-MMAE” refers to an antibody conjugated to the drug MMAE through a MC-vc-PAB linker.
  • A“platinum-based therapy” refers to treatment with a platinum-based agent.
  • a “platinum-based agent” refers to a molecule or a composition comprising a molecule containing a coordination complex comprising the chemical element platinum and useful as a
  • Platinum-based agents generally act by inhibiting DNA synthesis and some have alkylating activity. Platinum-based agents encompass those that are currently being used as part of a chemotherapy regimen, those that are currently in development, and those that may be developed in the future. Platinum-based therapies may include, but are not limited to, carboplatin, cisplatin, oxaliplatin, nedaplatin, triplatin tetranitrate, phenanthriplatin, picoplatin and satraplatin.
  • a “cancer” refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body.
  • a “cancer” or “cancer tissue” can include a tumor. Unregulated cell division and growth results in the formation of malignant tumors that invade neighboring tissues and can also metastasize to distant parts of the body through the lymphatic system or bloodstream. Following metastasis, the distal tumors can be said to be “derived from” the pre-metastasis tumor.
  • Treatment refers to any type of intervention or process performed on, or the administration of an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, slowing down, or preventing the onset, progression, development, severity, or recurrence of a symptom, complication, condition, or biochemical indicia associated with a disease.
  • the disease is cancer.
  • a "subject” includes any human or non-human animal.
  • the term “non-human animal” includes, but is not limited to, vertebrates such as non-human primates, sheep, dogs, and rodents such as mice, rats, and guinea pigs.
  • the subject is a human.
  • the terms "subject” and “patient” and“individual” are used interchangeably herein.
  • An“effective amount” or “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, protects a subject against the onset of a disease or promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
  • the ability of a therapeutic agent to promote disease regression can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
  • a therapeutically effective amount of a drug includes a "prophylactically effective amount," which is any amount of the drug that, when administered alone or in combination with an anti-cancer agent to a subject at risk of developing a cancer (e.g, a subject having a pre-malignant condition) or of suffering a recurrence of cancer, inhibits the development or recurrence of the cancer.
  • a drug e.g, an anti-TF antibody-drug conjugate
  • prophylactically effective amount is any amount of the drug that, when administered alone or in combination with an anti-cancer agent to a subject at risk of developing a cancer (e.g, a subject having a pre-malignant condition) or of suffering a recurrence of cancer, inhibits the development or recurrence of the cancer.
  • the prophylactically effective amount prevents the development or recurrence of the cancer entirely.
  • “Inhibiting" the development or recurrence of a cancer means either lessening the likelihood of the cancer’s development or recurrence, or preventing the development or recurrence of the cancer entirely.
  • subtherapeutic dose means a dose of a therapeutic compound (e.g., an anti-TF antibody-drug conjugate) that is lower than the usual or typical dose of the therapeutic compound when administered alone for the treatment of a hyperproliferative disease (e.g., cancer).
  • a therapeutic compound e.g., an anti-TF antibody-drug conjugate
  • a hyperproliferative disease e.g., cancer
  • an "anti-cancer agent” promotes cancer regression in a subject.
  • a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer.
  • Promoted cancer regression means that administering an effective amount of the drug, alone or in combination with an anti-cancer agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
  • the terms "effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safety.
  • Pharmacological effectiveness refers to the ability of the drag to promote cancer regression in the patient.
  • Physiological safety refers to the level of toxicity or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
  • sustained response refers to the sustained effect on reducing tumor growth after cessation of a treatment.
  • the tumor size may remain to be the same or smaller as compared to the size at the beginning of the administration phase.
  • the sustained response has a duration that is at least the same as the treatment duration, or at least 1.5, 2.0, 2.5, or 3 times longer than the treatment duration.
  • complete response or “CR” refers to disappearance of all target lesions
  • partial response or “PR” refers to at least a 30% decrease in the sum of the longest diameters (SLD) of target lesions, taking as reference the baseline SLD
  • stable disease or “SD” refers to neither sufficient shrinkage of target lesions to qualify for PR, nor sufficient increase to qualify for PD (progressive disease), taking as reference the smallest SLD since the treatment started.
  • progression free survival refers to the length of time during and after treatment during which the disease being treated (e.g, cancer) does not get worse. Progression-free survival may include the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
  • ORR all response rate
  • OS all survival
  • weight-based dose means that a dose administered to a patient is calculated based on the weight of the patient. For example, when a patient with 60 kg body weight requires 2 mg/kg of an anti-TF antibody-drug conjugate, one can calculate and use the appropriate amount of the anti-TF anti body -drug conjugate 120 mg) for administration.
  • flat dose means a dose that is administered to a patient without regard for the weight or body surface area (BSA) of the patient.
  • the flat dose is therefore not provided as a mg/kg dose, but rather as an absolute amount of the agent (e.g., the anti-TF antibody-drug conjugate).
  • an antibody-drug conjugate e.g., 240 mg of an anti-TF antibody-drug conjugate.
  • phrases "pharmaceutically acceptable” indicates that the substance or composition must be compatible chemically and-'or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
  • Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate "mesylate", ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate (i.e., 4,4’-methylene-bis -(2-hydroxy-3-naphthoate)) salts, alkali metal (e g., sodium and potassium) salts, alkaline
  • a phamiaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
  • the counter ion may be any organic or inorganic moiety that stabilizes the charge on the parent compound.
  • pharmaceutically acceptable salt may have more than one charged atom in its structure.
  • a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
  • administering refers to the physical introduction of a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art.
  • Exemplary routes of administration for the anti-TF antibody-drug conjugate include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, for example by injection or infusion (e.g., intravenous infusion).
  • parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intrade rmal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion, as well as in vivo electroporation.
  • a therapeutic agent can be administered via a non-parenteral route, or orally.
  • Other non-parenteral routes include a topical, epidermal or mucosal route of
  • administration for example, intranasally, vaginally, rectally, sublingually or topically.
  • Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
  • baseline or “baseline value” used interchangeably herein can refer to a measurement or characterization of a symptom before the administration of the therapy (e.g., an antibody-drug conjugate as described herein) or at the beginning of administration of the therapy.
  • the baseline value can be compared to a reference value in order to determine the reduction or improvement of a symptom of a TF-associated disease contemplated herein (e.g., ovarian cancer, peritoneal cancer, or fallopian tube cancer).
  • reference or “reference value” used interchangeably herein can refer to a measurement or characterization of a symptom after administration of the therapy (e.g., an antibody-drug conjugate as described herein).
  • the reference value can be measured one or more times during a dosage regimen or treatment cycle or at the completion of the dosage regimen or treatment cycle.
  • a "reference value” can be an absolute value; a relative value; a value that has an upper and/or lower limit; a range of values; an average value; a median value: a mean value; or a value as compared to a baseline value.
  • a “baseline value” can be an absolute value; a relative value; a value that has an upper and/or lower limit; a range of values; an average value; a median value; a mean value; or a value as compared to a reference value.
  • the reference value and/or baseline value can be obtained from one individual, from two different individuals or from a group of individuals (e.g., a group of two, three, four, five or more individuals).
  • the term“monotherapy” as used herein means that the antibody drug conjugate is the only anti-cancer agent administered to the subject during the treatment cycle.
  • Other therapeutic agents can be administered to the subject.
  • inflammation, pain, weight loss, and general malaise can be administered during the period of monotherapy.
  • An "adverse event” as used herein is any unfavorable and generally unintended or undesirable sign (including an abnormal laboratory finding), symptom, or disease associated with the use of a medical treatment.
  • a medical treatment can have one or more associated AEs and each AE can have the same or different level of severity.
  • Reference to methods capable of "altering adverse events” means a treatment regime that decreases the incidence and/or severity of one or more AEs associated with the use of a different treatment regime.
  • A“serious adverse event” or“SAE” as used herein is an adverse event that meets one of the following criteria:
  • Requires inpatient hospitalization or prolongation of existing hospitalization excluding the following: 1) routine treatment or monitoring of the underlying disease, not associated with any deterioration in condition, 2) elective or pre-planned treatment for a pre-existing condition that is unrelated to the indication under study and has not worsened since signing the informed consent, and social reasons and respite care in the absence of any deterioration in the patient’s general condition.
  • a dosing interval of once about every six weeks or once about every- twelve weeks means that the first dose can be administered any day in the first week, and then the next dose can be administered any day in the sixth or twelfth week, respectively.
  • a dosing interval of once about every six weeks or once about every twelve weeks means that the first dose is administered on a particular day of the first week ( e.g . , Monday) and then the next dose is administered on the same day of the sixth or twelfth weeks (i.e., Monday), respectively.
  • any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
  • the present invention provides an anti-TF antibody-drug conjugate that binds to TF for use in the treatment of ovarian cancer, peritoneal cancer, or fallopian tube cancer in a subject, wherein the antibody-drug conjugate comprises an anti-TF antibody or an antigenbinding fragment thereof conjugated to a monomethyl auristatin or a functional analog thereof or a functional derivative thereof.
  • the cancer is ovarian cancer.
  • the ovarian cancer is epithelial ovarian cancer.
  • the cancer is peritoneal cancer.
  • the peritoneal cancer is primary peritoneal cancer.
  • the cancer is fallopian tube cancer.
  • the ovarian cancer, peritoneal cancer, or fallopian tube cancer is a metastatic cancer.
  • the subject has relapsed, recurrent and/or metastatic ovarian cancer, peritoneal cancer, or fallopian tube cancer.
  • the subject has been previously treated with a platinum-based therapy.
  • the cancer is platinum-resistant, wherein platinum-resistant cancer means that the subject experienced disease progression or relapsed between 2 months and 6 months after treatment with the platinum-based therapy.
  • the cancer is not platinum-refractory, wherein platinum-refractory means that the subject experienced disease progression or relapse within 2 months after treatment with the platinum-based therapy.
  • anti-TF antibodies of the disclosure bind TF, e.g, human TF, and exert cytostatic and cytotoxic effects on malignant cells, such as ovarian cancer cells.
  • Anti-TF antibodies of the disclosure are preferably monoclonal, and may be multispecific, human, humanized or chimeric antibodies, single chain antibodies, Fab fragments, F(ab') fragments, fragments produced by a Fab expression library, and TF binding fragments of any of the above.
  • the anti-TF antibodies of the disclosure specifically bind TF.
  • the immunoglobulin molecules of the disclosure can be of any type (e.g, IgG, IgE, IgM, lgD, IgA and IgY), class (e.g, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
  • type e.g, IgG, IgE, IgM, lgD, IgA and IgY
  • class e.g, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2
  • subclass of immunoglobulin molecule e.g, immunoglobulin molecule.
  • the anti-TF antibodies are antigen-binding fragments (e.g., human antigen-binding fragments) as described herein and include, but are not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide- linked Fvs (sdFv) and fragments comprising either a VL or VH domain.
  • Antigen-binding fragments, including single-chain antibodies may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CHI, CH2, CH3 and CL domains.
  • antigen-binding fragments comprising any combination of variable region(s) with a hinge region, CHI, CH2, CH3 and CL domains.
  • the anti-TF antibodies or antigen-binding fragments thereof are human, murine (e.g, mouse and rat), donkey, sheep, rabbit, goat, guinea pig, camelid, horse, or chicken.
  • the anti-TF antibodies of the present disclosure may be monospecific, bispecific, trispecific or of greater multi specificity. Multispecific antibodies may be specific for different epitopes of TF or may be specific for both TF as well as for a heterologous protein. See, e.g., PCT publications WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt, etal, 1991, J. Immunol. 147:60 69; U.S. Pat. Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920;
  • Anti-TF antibodies of the present disclosure may be described or specified in terms of the particular CDRs they comprise.
  • the precise amino acid sequence boundaries of a given CDR or FR can be readily determined using any of a number of well-known schemes, including those described by Rabat etal. (1991),“Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (“Rabat” numbering scheme); Al-Lazikani etal, (1997) JMB 273,927-948 (“Chothia” numbering scheme);
  • a“CDR” or“complementary determining region,” or individual specified CDRs (e.g., CDR-H1, CDR-H2, CDR-H3), of a given antibody or region thereof (e.g., variable region thereof) should be understood to encompass a (or the specific)
  • a particular CDR e.g, a CDR-H3
  • a CDR-H3 contains the amino acid sequence of a corresponding CDR in a given VH or VL region amino acid sequence
  • a CDR has a sequence of the corresponding CDR (e.g, CDR-H3) within the variable region, as defined by any of the aforementioned schemes.
  • the scheme for identification of a particular CDR or CDRs may be specified, such as the CDR as defined by the Rabat, Chothia, AbM or IMGT method.
  • CDR sequences provided herein are according to the IMGT method as described in
  • antibodies of the disclosure comprise one or more CDRs of the antibody 011. See WO 2011/157741 and WO 2010/066803.
  • the disclosure encompasses an antibody or derivative thereof comprising a heavy or light chain variable domain, said variable domain comprising (a) a set of three CDRs, in which said set of CDRs are from monoclonal antibody Oi l, and (b) a set of four framework regions, in which said set of framework regions differs from tire set of framework regions in monoclonal antibody Oil, and in which said antibody or derivative thereof binds to TF.
  • said antibody or derivative thereof specifically binds to TF.
  • the anti-TF antibody is 011.
  • the antibody 011 is also known as tisotumab.
  • anti-TF antibodies that compete with tisotumab binding to TF are also provided herein.
  • Anti-TF antibodies that bind to the same epitope as tisotumab are also provided herein.
  • an anti-TF antibody comprising 1, 2, 3, 4, 5, or 6 of the CDR sequences of tisotumab.
  • an anti-TF antibody comprising a heavy chain variable region and a light chain variable region
  • the heavy chain variable region comprises (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:2, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:3
  • the light chain variable region comprises (i) CDR-L1 comprising the amino acid sequence of SEQ ID NO:4, (ii) CDR-L2 comprising the amino acid sequence of SEQ ID NO:5, and (iii) CDR-L3 comprising the amino acid sequence of SEQ ID NO:6.
  • an anti-TF antibody described herein may comprise any suitable framework variable domain sequence, provided that the antibody retains the ability' to bind TF (e.g., human TF).
  • heavy chain framework regions are designated "HC-FR1-FR4”
  • light chain framework regions are designated "LC-FR1-FR4.”
  • the anti-TF antibody comprises a heavy chain variable domain framework sequence of SEQ ID NO:9, 10, 1 1 , and 12 (HC-FR1, HC-FR2, HC-FR3, and HC-FR4, respectively).
  • the anti-TF antibody comprises a light chain variable domain framework sequence of SEQ ID NO: 13, 14, 15, and 16 (LC-FR1, LC-FR2, LC-FR3, and LC-FR4, respectively).
  • the heavy chain variable domain comprises the amino acid sequence of
  • EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSSISGSGDYT YYTDSVKGRFnSRDNSKNTLYLQMNSLRAEDTAVYYCARSPWGYYLDSWGQGTLVT VSS (SEQ ID NO:7) and the light chain variable domain comprises the amino acid sequence of DIQMTQSPPSLSASAGDRVTITCRASQGISSRLAWYQQKPEKAPKSLrYAASSLQSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPYTFGQGTKLEIK (SEQ ID NO:8).
  • the heavy chain CDR sequences comprise the following:
  • the heavy chain FR sequences comprise the following:
  • HC-FR1 (EVQLLESGGGLVQPGGSLRLSCAAS (SEQ ID N0:9));
  • CDR sequences comprise the following:
  • the light chain FR sequences comprise the following:
  • an anti-TF antibody that binds to TF (e.g., human TF), wherein the antibody comprises a heavy chain variable region and a light chain variable region, wherein the antibody comprises:
  • HC-FR1 comprising the amino acid sequence of SEQ ID NO:9;
  • HC-FR4 comprising the amino acid sequence of SEQ P) NO: 12, and/or
  • a light chain variable domain comprising: (1) an LC-FR1 comprising the amino acid sequence of SEQ ID NO: 13;
  • an anti-TF antibody comprising a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:7 or comprising a light chain variable domain comprising the amino acid sequence of SEQ ID NO:8.
  • an anti-TF antibody comprising a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:7 and comprising a light chain variable domain comprising the amino acid sequence of SEQ ID NO:8.
  • an anti-TF antibody comprising a heavy chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO:7.
  • a heavy chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%,
  • the anti-TF antibody comprises a heavy chain variable domain sequence of SEQ ID NO:7 including post-translational modifications of that sequence.
  • the heavy chain variable domain comprises one, two or three CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of SEQ ID NO:l, (b) CDR-H2 comprising the amino acid sequence of SEQ ID NO:2, and (c) CDR-H3 comprising the amino acid sequence of SEQ ID NO:3.
  • an anti-TF antibody comprising a light chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 8.
  • a light chain variable domain comprising an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%,
  • amino acid sequence of SEQ ID NO: 8 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence and retains the ability to bind to a TF (e.g., human TF).
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO:8.
  • substitutions, insertions, or deletions e.g, 1, 2, 3, 4, or 5 amino acids
  • the anti-TF antibody comprises a tight chain variable domain sequence of SEQ ID NO:8 including post-translational modifications of that sequence.
  • the tight chain variable domain comprises one, two or three CDRs selected from: (a) CDR-L1 comprising the amino acid sequence of SEQ ID NO:4, (b) CDR-L2 comprising the amino acid sequence of SEQ ID NO:5, and (c) CDR-L3 comprising the amino acid sequence of SEQ ID NO:6.
  • the anti-TF antibody comprises a heavy chain variable domain as in any of the embodiments provided above, and a light chain variable domain as in any of the embodiments provided above.
  • the antibody comprises the heavy- chain variable domain sequence of SEQ ID NO:7 and the light chain variable domain sequence of SEQ ID NO: 8, including post-translational modifications of those sequences.
  • the anti-TF antibody of the anti-TF antibody-drug conjugate comprises: i) a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 2, a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and ii) a tight chain CDRl comprising the amino acid sequence of SEQ ID NO: 4, a tight chain CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a tight chain CDRS comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TF antibody of the anti-TF antibody-drug conjugate comprises: i) an amino acid sequence having at least 85% sequence identity to a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7, and ii) an amino acid sequence having at least 85% sequence identity- to a tight chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
  • the anti-TF antibody of the anti-TF antibody-drug conjugate is a monoclonal antibody.
  • the anti-TF antibody of the anti-TF antibody-drug conjugate is tisotumab, which is also known as antibody 011 as described in WO 2011/157741 and WO 2010/066803.
  • Anti-TF antibodies of the present invention may also be described or specified in terms of their binding affinity to TF (e.g. , human TF).
  • Preferred binding affinities include those
  • IgA immunoglobulins
  • IgD immunoglobulins
  • IgE immunoglobulins
  • IgG immunoglobulins
  • IgG immunoglobulins
  • IgG2 immunoglobulins
  • IgG3 immunoglobulins
  • IgA2 immunoglobulins
  • IgG3 immunoglobulins
  • IgA2 immunoglobulins
  • IgG3 immunoglobulins
  • IgGl antibodies can exist in multiple polymorphic variants termed allotypes (reviewed in Jeflferis and Lefranc 2009. mAbs Vol 1 Issue 4 1-7) any of which are suitable for use in some of the embodiments herein.
  • the antibody may comprise a heavy chain Fc region comprising a human IgG Fc region.
  • the human IgG Fc region comprises a human IgGl .
  • the antibodies also include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from binding to TF or from exerting a cytostatic or cytotoxic effect on HD cells.
  • the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, PEGylation, phosphylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
  • the anti-TF antibody-drug conjugates described herein comprise a linker between an anti-TF antibody or antigen-binding fragment thereof as described herein and a cytostatic or cytotoxic drug.
  • the linker is a non-cleavable linker.
  • the linker is a cleavable linker.
  • the linker is a cleavable peptide linker comprising maleimido caproyl (MC), the dipeptide valine-citrulline (vc) and p-aminobenzylcaibamate (PAB).
  • the cleavable peptide linker has the formula: MC-vc-RAB-, wherein:
  • the linker is a cleavable peptide linker comprising maleimido caproyl (MC).
  • MC maleimido caproyl
  • the cleavable peptide linker has the formula: MC-, wherein:
  • the linker is attached to sulphydiyl residues of the anti-TF antibody or antigen-binding fragment thereof obtained by partial or foil reduction of the anti-TF antibody or antigen-binding fragment thereof. In some embodiments, the linker is attached to sulphydryl residues of the anti-TF antibody or antigen-binding fragment thereof obtained by partial reduction of the anti-TF antibody or antigen-binding fragment thereof. In some embodiments, the linker is attached to sulphydryl residues of the anti-TF antibody or antigenbinding fragment thereof obtained by foil reduction of the anti-TF antibody or antigen-binding fragment thereof.
  • the anti-TF antibody-drug conjugates described herein comprise a linker as described herein between an anti-TF antibody or antigen-binding fragment thereof as described herein and a cytostatic or cytotoxic drug.
  • Auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis and nuclear and cellular division ( See Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12): 3580-3584) and have anti-cancer (See U.S. Patent Nos. 5663149) and antifungal activity ( See Pettit etal, (1998 ) Antimicrob. Agents and Chemother. 42: 2961-2965.
  • auristatin E can be reacted with para-acetyl benzoic acid or benzoylvaleric acid to produce AEB and AEVB, respectively.
  • Other typical auristatin derivatives include AFP, MMAF (monomethyl auristatin F), and MMAE (monomethyl auristatin E).
  • Suitable auristatins and auristatin analogs, derivatives and prodrugs, as well as suitable linkers for conjugation of auristatins to Abs, are described in, e.g, U.S. Patent Nos.
  • the cytostatic or cytotoxic drag is an auristatin or a functional analog thereof (e.g, functional peptide thereof) or a functional derivative thereof.
  • the auristatin is a monomethyl auristatin or a functional analog thereof (e.g, functional peptide thereof) or a functional derivative thereof.
  • the auristatin is monomethyl auristatin E (MMAE):
  • the auristatin is monomethyl auristatin F (MMAF):
  • the cleavable peptide linker has the formula: MC-vc-RAB-, and is attached to MMAE.
  • the resulting linker-auristadn, MC-vc-PAB-MMAE is also designated vcMMAE.
  • the vcMMAE drug linker moiety and conjugation methods are disclosed in W02004010957, US7659241, US7829531 and US7851437.
  • vcMMAE is attached to an anti-TF antibody or antigen-binding fragment thereof as described herein, the resulting structure is:
  • p denotes a number from 1 to 8, e.g., 1, 2, 3, 4, 5, 6, 7 or 8, e.g., p may be from 3-5
  • S represents a sulphydryl residue of the anti-TF antibody and Ab designates an anti-TF antibody or antigen-binding fragment thereof as described herein.
  • the average value of p in a population of antibody-drug conjugates is about 4.
  • p is measured by hydrophobic interaction chromatography (HIC), for example by resolving drag- loaded species based on the increasing hydrophobicity with the least hydrophobic, unconjugated form eluting first and the most hydrophobic, 8-drag form eluting last with the area percentage of a peak representing the relative distribution of the particular drag-loaded antibody-drag conjugate species.
  • HIC hydrophobic interaction chromatography
  • p is measured by reversed phase high- performance liquid chromatography (RP-HPLC), for example by first performing a reduction reaction to completely dissociate the heavy and light chains of the ADC, then separating the light and heavy chains and their corresponding drag-loaded forms on an RP column, where the percentage peak are from integration of the light chain and heavy chain peaks, combined with the assigned drug load for each peak, is used to calculate the weighted average drug to antibody ration.
  • RP-HPLC reversed phase high- performance liquid chromatography
  • the cleavable peptide linker has the formula: MC-vc-RAB-, and is attached to MMAF.
  • the resulting linker-auri statin, MC-vc-PAB-MMAF is also designated vcMMAF.
  • a non-cleavable linker MC is attached to MMAF.
  • the resulting linker-auristatin MC-MMAF is also designated mcMMAF.
  • vcMMAF and mcMMAF drug linker moieties and conjugation methods are disclosed in W02005081711 and US7498298.
  • vcMMAF or mcMMAF is attached to an anti-TF antibody or antigen-binding fragment thereof as described herein, the resulting structure is:
  • p denotes a number from 1 to 8, e.g., 1, 2, 3, 4, 5, 6, 7 or 8, e.g., p may be from 3-5
  • S represents a sulphydryl residue of the anti-TF antibody and Ab or mAb designates an anti-TF antibody or antigen-binding fragment thereof as described herein.
  • the average value of p in a population of antibody-drug conjugates is about 4.
  • p is measured by hydrophobic interaction chromatography (HIC), for example by resolving drug-loaded species based on the increasing hydrophobicity with the least hydrophobic, unconjugated form eluting first and the most hydrophobic, 8-drug form eluting last with the area percentage of a peak representing the relative distribution of the particular drug- loaded antibody-drug conjugate species.
  • HIC hydrophobic interaction chromatography
  • p is measured by reversed phase high-performance liquid chromatography (RP-HPLC), for example by first performing a reduction reaction to completely dissociate the heavy and light chains of the ADC, then separating the light and heavy chains and their corresponding drug-loaded forms on an RP column, where the percentage peak are from integration of the light chain and heavy chain peaks, combined with the assigned drug load for each peak, is used to calculate the weighted average drug to antibody ration.
  • RP-HPLC reversed phase high-performance liquid chromatography
  • the antibody-drug conjugate is tisotumab vedotin.
  • nucleic acids encoding an anti-TF antibody or antigen-binding fragment thereof as described herein are nucleic acids encoding an anti-TF antibody or antigen-binding fragment thereof as described herein.
  • vectors comprising the nucleic acids encoding an anti-TF antibody or antigen-binding fragment thereof as described herein.
  • host cells expressing the nucleic acids encoding an anti-TF antibody or antigen-binding fragment thereof as described herein.
  • host cells comprising the vectors comprising the nucleic acids encoding an anti-TF antibody or antigen-binding fragment thereof as described herein. Methods of producing an anti-TF antibody, linker and anti-TF antibody-drag conjugate are described in U.S. Pat. No. 9,168,314.
  • the anti-TF antibodies described herein may be prepared by well-known recombinant techniques using well known expression vector systems and host cells.
  • the antibodies are prepared in a CHO cell using the GS expression vector system as disclosed in De la Cruz Edmunds etal., 2006, Molecular Biotechnology 34; 179-190, EP216846, U.S. Pat. No. 5,981,216, WO 87/04462, EP323997, U.S. Pat. No. 5,591,639, U.S. Pat. No. 5,658,759, EP338841, U.S. Pat. No. 5,879,936, and U.S. Pat. No. 5,891,693.
  • Monoclonal anti-TF antibodies described herein may e.g. be produced by the hybridoma method first described by Kohler et al. , Nature, 256, 495 (1975), or may be produced by recombinant DNA methods. Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al, Nature, 352, 624-628 (1991) and Marks etal, JMol, Biol, 222(3):581-597 (1991). Monoclonal antibodies may be obtained from any suitable source.
  • monoclonal antibodies may be obtained from hybridomas prepared from murine splenic B cells obtained from mice immunized with an antigen of interest, for instance in form of cells expressing the antigen on the surface, or a nucleic acid encoding an antigen of interest.
  • Monoclonal antibodies may also be obtained from hybridomas derived from antibody-expressing cells of immunized humans or non-human mammals such as rats, dogs, primates, etc.
  • the antibody (e.g., anti-TF antibody) of the invention is a human antibody.
  • Human monoclonal antibodies directed against TF may be generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system.
  • transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as“transgenic mice”.
  • the HuMAb mouse contains a human immunoglobulin gene minilocus that encodes unrearranged human heavy (m and g) and k light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous m and k chain loci (Lonberg, N. et al, Nature, 368, 856-859 (1994)). Accordingly, the mice exhibit reduced expression of mouse IgM or k and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG,K monoclonal antibodies (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N.
  • HuMAb mice The preparation of HuMAb mice is described in detail in Taylor, L. et al, Nucleic Acids Research. 20:6287-6295 (1992), Chen, J. etal, International Immunology. 5:647-656 (1993), Tuaillon at al., J. Immunol, 152:2912-2920 (1994), Taylor, L. et al, International Immunology, 6:579-591 (1994), Fishwild, D.
  • mice have a JKD disruption in their endogenous light chain (kappa) genes
  • the HCol7 transgenic mouse strain (see also US 2010/0077497) was generated by coinjection of the 80 kb insert of pHC2 (Taylor et al. (1994) Int. Immunol., 6:579-591), the Kb insert of pVX6, and a -460 kb yeast artificial chromosome fragment of the y!gH24
  • mice comprising the CMD mutation (described in Example 1 ofPCT Publication WO 01109187), the JKD mutation (Chen et al, (1993) EMBO J 12:811-820), and the (KC05) 9272 transgene (Fishwild etal. (1996) Nature Biotechnology, 14:845-851).
  • the resulting mice express human immunoglobulin heavy and kappa tight chain transgenes in a background homozygous for disruption of the endogenous mouse heavy and kappa tight chain loci.
  • the HCo20 transgenic mouse strain is the result of a co-injection of minilocus 30 heavy chain transgene pHC2, the germline variable region (Vh)-containing YAC ylgHIO, and the minilocus construct pVx6 (described in W009097006).
  • the (HCo20) line was then bred with mice comprising the CMD mutation (described in Example 1 ofPCT Publication WO 01/09187), the JKD mutation (Chen etal. (1993; EMBOJ. 12:811-820), and the (KC05) 9272 trans gene (Fishwild eta). (1996) Nature Biotechnology, 14:845-851).
  • the resulting mice express human 10 immunoglobulin heavy and kappa light chain transgenes in a background homozygous for disruption of the endogenous mouse heavy- and kappa tight chain loci.
  • HuMab mice were crossed with KCO05 [MIK] (Balb) mice which were generated by backcrossing the KC05 strain (as described in Fishwild etal. (1996) Nature Biotechnology, 14:845-851) to wild-type Balb/c mice to generate mice as described in W009097006. Using this crossing Balb/c hybrids were created for HCol2, HCol7, and HCo20 strains.
  • Splenocytes from these transgenic mice may be used to generate hybridomas that secrete human monoclonal antibodies according to well-known techniques, Human monoclonal or polyclonal antibodies of the present invention, or antibodies of the present invention originating from other species may also be generated transgenically through the generation of another non-human mammal or plant that is transgenic for the immunoglobulin heavy and light chain sequences of interest and production of the antibody in a recoverable form therefrom.
  • antibodies may be produced in, and recovered from, the milk of goats, cows, or other mammals. See for instance U.S. Pat. No.
  • human antibodies of the present invention or antibodies of the present invention from other species may be generated through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, and other techniques, using techniques well known in the art and the resulting molecules may be subjected to additional maturation, such as affinity maturation, as such techniques are well known in the art (See for instance Hoogenboom etal., J. Mol, Biol. 227(2):381-388 (1992) (phage display), Vaughan et al.
  • ovarian cancer The most common type of ovarian cancer is epithelial ovarian cancer.
  • epithelial ovarian cancers There are a variety of types of epithelial ovarian cancers, including serous, mucinous, endometroid, clear cell, and others. Cancers of the ovary, fallopian tube and of peritoneal origin in women exhibit similar clinical characteristics and behavior. The stages and treatment are the same for epithelial ovarian, fallopian tube, and primary peritoneal cancers. In 2015, 1.2 million women were estimated to be living with ovarian cancer, and ovarian cancer resulted in 161,100 deaths worldwide. Chemotherapy, typically consisting of platins combined with non-platins, has been a general standard of care for ovarian cancer for decades.
  • the invention provides methods for treating cancer in a subject with an anti-TF antibody-drug conjugate described herein, wherein the cancer is ovarian cancer, peritoneal cancer or fallopian tube cancer.
  • the cancer is ovarian cancer.
  • the ovarian cancer is epithelial ovarian cancer.
  • the cancer is peritoneal cancer.
  • the peritoneal cancer is primary peritoneal cancer.
  • the cancer is fallopian tube cancer.
  • the ovarian cancer, peritoneal cancer, or fallopian tube cancer is a metastatic cancer.
  • the subject has relapsed, recurrent and/or metastatic ovarian cancer, peritoneal cancer, or fallopian tube cancer.
  • the antibody-drug conjugate is tisotumab vedotin.
  • the subject is a human.
  • the present invention provides an antibody-drug conjugate that binds to TF for use in the treatment of cancer
  • the antibody-drug conjugate comprises an anti-TF antibody or an antigen-binding fragment thereof conjugated to a monomethyl auristatin or a functional analog thereof or a functional derivative thereof and wherein the cancer is ovarian cancer, peritoneal cancer or fallopian tube cancer.
  • the cancer is ovarian cancer.
  • the ovarian cancer is epithelial ovarian cancer.
  • the cancer is peritoneal cancer.
  • the peritoneal cancer is primary peritoneal cancer.
  • the cancer is fallopian tube cancer.
  • the ovarian cancer, peritoneal cancer, or fallopian tube cancer is a metastatic cancer.
  • the subject has relapsed, recurrent and/or metastatic ovarian cancer, peritoneal cancer, or fallopian tube cancer.
  • the antibody-drug conjugate is tisotumab vedotin.
  • the subject is a human.
  • the subject has been previously treated for the ovarian cancer, peritoneal cancer or fallopian tube cancer.
  • the subject did not respond to the treatment (e g., the subject experienced disease progression during treatment).
  • the subject relapsed after the treatment.
  • the subject experienced disease progression after the treatment.
  • the treatment previously administered to the subject was not an anti-TF antibody-drug conjugate as described herein.
  • the invention provides methods for treating ovarian cancer, peritoneal cancer or fallopian tube cancer with an antibody-drug conjugate described herein.
  • the antibody-drug conjugates described herein are for use in a method of treating ovarian cancer, peritoneal cancer or fallopian tube cancer in a subject.
  • the antibody-drug conjugate is tisotumab vedotin.
  • the subject has not been previously treated far the ovarian cancer, peritoneal cancer or fallopian tube cancer.
  • the cancer is ovarian cancer.
  • the ovarian cancer is epithelial ovarian cancer.
  • the cancer is peritoneal cancer.
  • the peritoneal cancer is primary peritoneal cancer. In some embodiments, the cancer is fallopian tube cancer. In some embodiments, the ovarian cancer, peritoneal cancer, or fallopian tube cancer is a metastatic cancer. In some embodiments, the subject has relapsed, recurrent and/or metastatic ovarian cancer, peritoneal cancer, or fallopian tube cancer. In some embodiments, the subject has received at least one previous treatment for the ovarian cancer, peritoneal cancer or fallopian tube cancer. In some embodiments, the subject received prior systemic therapy for the ovarian cancer, peritoneal cancer or fallopian tube cancer. In some embodiments, the subject experienced disease progression on or after the systemic therapy.
  • the subject received no more than 5 rounds of prior systemic therapy. In some embodiments, the subject received 1, 2, 3, 4 or 5 rounds of prior systemic therapy. In some embodiments, the subject received 1, 2, 3, 4 or 5 rounds of prior systemic therapy in the platinum resistant setting. In some embodiments, the rounds of prior systemic therapy were for the treatment of platinum- resistant ovarian cancer (PROC). In some embodiments, the subject received 1 round of prior systemic therapy. In some embodiments, the subject received 2 rounds of prior systemic therapy. In some embodiments, the subject received 3 rounds of prior systemic therapy. In some embodiments, the subject received 4 rounds of prior systemic therapy. In some embodiments, the subject received 5 rounds of prior systemic therapy. In some embodiments, the prior systemic therapy is a chemotherapy regimen.
  • treatment with a poly ADP ribose polymerase (PARP) inhibitor regimen is not a chemotherapy regimen.
  • the subject has been previously treated with a platinum-based therapy.
  • the cancer is platinum-resistant, wherein the subject experienced disease progression or relapsed between 2 months and 6 months after treatment with the platinum-based therapy.
  • the cancer is not platinum-refractory, wherein the subject experienced disease progression or relapse within 2 months after treatment with the platinum- based therapy.
  • the subject has been previously treated with a VEGF antagonist.
  • the subject has been previously treated with bevacizumab.
  • the ovarian cancer, peritoneal cancer or fallopian tube cancer is an advanced stage cancer.
  • the advanced stage cancer is a stage 3 or 4 cancer.
  • the advanced stage cancer is a metastatic cancer.
  • the ovarian cancer, peritoneal cancer or fallopian tube cancer is a recurrent cancer.
  • the subject is a human.
  • the percentage of cells that express TF is determined using flow cytometry. In some embodiments, the percentage of cells that express TF is determined using an enzyme-linked immunosorbent assay (ELISA).
  • An anti-TF antibody-drug conjugate or antigen-binding fragment thereof described herein can be administered by any suitable route and mode. Suitable routes of administering antibody-drug conjugate of the present invention are well known in the art and may be selected by those of ordinary skill in the art. In one embodiment, the antibody-drug conjugate is administered parenterally.
  • Parenteral administration refers to modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrastemal injection and infusion.
  • the route of administration of an anti-TF antibody-drug conjugate or antigen-binding fragment described herein is intravenous injection or infusion.
  • the route of administration of an anti-TF antibody-drug conjugate or antigen-binding fragment described herein is intravenous infusion.
  • the present invention provides for methods of treating a subject with ovarian cancer, peritoneal cancer, or fallopian tube cancer as described herein with a particular dose of an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein, wherein the subject is administered the antibody-drug conjugate or antigen-binding fiagment thereof as described herein with a particular frequency.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose ranging from about 0.65 mg/kg to about 2.1 mg/kg of the subject’s body weight.
  • the dose is about 0.65 mg/kg, about 0.7 mg/kg, about 0.75 mg/kg, about 0.8 mg/kg, about 0.85 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, about 2.0 mg/kg or about 2.1 mg/kg.
  • the dose is about 0.65 mg/kg.
  • the dose is about 0.9 mg/kg.
  • the dose is about 1.3 mg/kg.
  • the dose is about 2.0 mg/kg.
  • the dose is 0.65 mg/kg, 0.7 mg/kg, 0.75 mg/kg, 0.8 mg/kg, 0.85 mg/kg, 0.9 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg or 2.1 mg/kg.
  • the dose is 0.65 mg/kg.
  • the dose is 0.9 mg/kg.
  • the dose is 1.3 mg/kg.
  • the dose is 2.0 mg/kg.
  • the dose is 0.65 mg/kg and the anti-TF antibody-drug conjugate is tisotumab vedotin. In some embodiments, the dose is 0.9 mg/kg and the anti-TF antibody-drug conjugate is tisotumab vedotin. In some
  • the dose is 1.3 mg/kg and the anti-TF antibody-drug conjugate is tisotumab vedotin. In some embodiments, the dose is 2.0 mg/kg and the anti-TF antibody-drug conjugate is tisotumab vedotin. In some embodiments, for a subject weighing more than 100 kg, the dose of the anti-TF antibody-drug conjugate administered is the amount that would be administered if the subject weighed 100 kg. In some embodiments, for a subject weighing more than 100 kg, the dose of the anti-TF antibody-drug conjugate administered is 65 mg, 90 mg, 130 mg, or 200 mg.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject once about every 1 to 4 weeks. In certain embodiments, an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered once about every 1 week, once about every 2 weeks, once about every 3 weeks or once about every 4 weeks. In one embodiment, an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered once about every 3 weeks. In one embodiment, an anti-TF antibody -drug conjugate or antigen-binding fragment thereof as described herein is administered once every 3 weeks.
  • the dose is about 0.65 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 0.65 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.65 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.65 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 0.7 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 0.65 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.65 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.65 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 0.7 mg/kg and is administered once about every 1 week. In some
  • the dose is about 0.7 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.7 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.7 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 0.75 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 0.75 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.75 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.75 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 0.8 mg/kg and is administered once about every 1 week.
  • the dose is about 0.8 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.8 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.8 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 0.85 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 0.85 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.85 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.85 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 0.9 mg/kg and is administered once about every 1 week.
  • the dose is about 0.9 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 0.9 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 0.9 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.0 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 1.0 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.0 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.0 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.1 mg/kg and is administered once about every 1 week.
  • the dose is about 1.1 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.1 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.1 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.2 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 1.2 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.2 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.2 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.3 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 1.1 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.1 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.3 mg/kg and is administered once about every 1 week. In some embodiments, the
  • the dose is about 1.3 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.3 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.3 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.4 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 1.4 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.4 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.4 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.5 mg/kg and is administered once about every 1 week.
  • the dose is about 1.5 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.5 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.5 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.6 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 1.6 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.6 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.6 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.7 mg/kg and is administered once about every 1 week.
  • the dose is about 1.7 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.7 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.7 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.8 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 1.8 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.8 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.8 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 1.9 mg/kg and is administered once about every 1 week.
  • the dose is about 1.9 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 1.9 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 1.9 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 2.0 mg/kg and is administered once about every 1 week. In some embodiments, the dose is about 2.0 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 2.0 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 2.0 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is about 2.1 mg/kg and is administered once about every 1 week.
  • the dose is about 2.1 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is about 2.1 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is about 2.1 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 0.65 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 0.65 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 0.65 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 0.65 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 0.7 mg/kg and is administered once about every 1 week.
  • the dose is 0.7 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 0.7 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 0.7 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 0.75 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 0.75 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 0.75 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 0.75 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 0.8 mg/kg and is administered once about every 1 week.
  • the dose is 0.8 mg/kg and is administered once about every' 2 weeks. In some embodiments, the dose is 0.8 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 0.8 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 0.85 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 0.85 mg/kg and is administered once about every- 2 weeks. In some embodiments, the dose is 0.85 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 0.85 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 0.9 mg/kg and is administered once about every 1 week.
  • the dose is 0.9 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 0.9 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 0.9 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.0 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 1.0 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.0 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.0 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.1 mg/kg and is administered once about every 1 week.
  • the dose is 1.1 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.1 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.1 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.2 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 1.2 mg/kg and is administered once about every- 2 weeks. In some embodiments, the dose is 1.2 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.2 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.3 mg/kg and is administered once about every 1 week.
  • the dose is 1.3 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.3 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.3 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.4 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 1.4 mg/kg and is administered once about every- 2 weeks. In some embodiments, the dose is 1.4 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.4 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.5 mg/kg and is administered once about every 1 week.
  • the dose is 1.5 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.5 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.5 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.6 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 1.6 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.6 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.6 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.7 mg/kg and is administered once about every 1 week.
  • the dose is 1.7 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.7 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.7 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.8 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 1.8 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 1.8 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.8 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 1.9 mg/kg and is administered once about every 1 week.
  • the dose is 1.9 mg/kg and is administered once about every' 2 weeks. In some embodiments, the dose is 1.9 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 1.9 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 2.0 mg/kg and is administered once about every 1 week. In some embodiments, the dose is 2.0 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 2.0 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 2.0 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 2.1 mg/kg and is administered once about every 1 week.
  • the dose is 2.1 mg/kg and is administered once about every 2 weeks. In some embodiments, the dose is 2.1 mg/kg and is administered once about every 3 weeks. In some embodiments, the dose is 2.1 mg/kg and is administered once about every 4 weeks. In some embodiments, the dose is 2.0 mg/kg and is administered once about every 3 weeks (e.g., ⁇ 3 days). In some embodiments, the dose is 2.0 mg/kg and is administered once every' 3 weeks. In some embodiments, the dose is 2.0 mg/kg and is administered once every 3 weeks and tire antibody-drug conjugate is tisotumab vedotin.
  • the dose is 2.0 mg/kg and is administered once every 3 weeks and the antibody-drug conjugate is tisotumab vedotin and the dose is decreased to 1.3 mg/kg if one or more adverse events occur. In some embodiments, the dose is 1.3 mg/kg and is administered once every 3 weeks. In some embodiments, the dose is 1.3 mg/kg and is administered once every 3 weeks and the antibody- drug conjugate is tisotumab vedotin. In some embodiments, the dose is 1.3 mg/kg and is administered once every 3 weeks and the antibody-drug conjugate is tisotumab vedotin and the dose is decreased to 0.9 mg/kg if one or more adverse events occur.
  • the dose is about 0.9 mg/kg and is administered once about every week and the antibody-drug conjugate is tisotumab vedotin. In some embodiments, the dose is 0.9 mg/kg and is administered once every week and the antibody-drug conjugate is tisotumab vedotin. In some embodiments, the dose is 0.9 mg/kg and is administered on about days 1, 8, and 15 of about a 4- week cycle and the antibody-drug conjugate is tisotumab vedotin.
  • the dose is 0.9 mg/kg and is administered on days 1 , 8, and 15 of a 4-week cycle and the antibody- drug conjugate is tisotumab vedotin. In some embodiments, the dose is 0.9 mg/kg and is administered on about days 1, 8, and 15 of about a 4-week cycle and the antibody drug conjugate is tisotumab vedotin and the dose is decreased to 0.65 mg/kg if one or more adverse events occur.
  • the dose is 0.9 mg/kg and is administered on days 1, 8, and 15 of a 4-week cycle and the antibody drag conjugate is tisotumab vedotin and the dose is decreased to 0.65 mg/kg if one or more adverse events occur.
  • the dose is about 0.65 mg/kg and is administered once about every week and the antibody-drug conjugate is tisotumab vedotin.
  • the dose is 0.65 mg/kg and is administered once every week and the antibody-drug conjugate is tisotumab vedotin.
  • the dose is 0.65 mg/kg and is administered on about days 1, 8, and 15 of about a 4-week cycle and the antibody drug conjugate is tisotumab vedotin. In some embodiments, the dose is 0.65 mg/kg and is administered on days 1, 8, and 15 of a 4-week cycle and the antibody drag conjugate is tisotumab vedotin. In some embodiments, for a subject weighing more than 100 kg, the dose of the anti-TF antibody-drug conjugate administered is the amount that would be administered if the subject weighed 100 kg. In some embodiments, for a subject weighing more than 100 kg, the dose of the anti-TF antibody-drug conjugate administered is 65 mg, 90 mg, 130 mg, or 200 mg.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period.
  • an anti- TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject once every 1 week for 3 consecutive weeks followed by a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is 28 days including the resting period.
  • a dosing regimen is provided where the subject to be treated is dosed with a single weekly dose for three consecutive weeks followed by a resting week.
  • This treatment schedule may also be referred to as a "dose-dense schedule" herein and is the same as "the 4-week (28 days) cycle" and "3Q4W".
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject on about days 1, 8, and 15 of about a 4-week cycle. In one embodiment, an anti-TF antibody-drug conjugate or antigenbinding fragment thereof as described herein is administered to the subject on days 1, 8, and 15 of a 4-week cycle.
  • the present invention encompasses embodiments wherein the subject remains on the 3Q4W treatment cycle for at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles.
  • the subject remains on the 3Q4W treatment cycle for between 2 and 48 cycles, such as between 2 and 36 cycles, such as between 2 and 24 cycles, such as between 2 and 15 cycles, such as between 2 and 12 cycles, such as 2 cycles, 3 cycles, 4 cycles, 5 cycles, 6 cycles, 7 cycles, 8 cycles, 9 cycles, 10 cycles, 11 cycles or 12 cycles wherein each cycle is 28 days as described above.
  • the subject remains on the 3Q4W treatment cycle for 12 cycles or more, such as 16 cycles or more, such as 24 cycles or more, such as 36 cycles or more.
  • the 3Q4W treatment cycle is administered for no more than 3, no more than 4, no more than 5, or no more than 6 four-week treatment cycles.
  • an anti- TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.9 mg/kg once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.9 mg/kg once every 1 week for 3 consecutive weeks followed by a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is 28 days including the resting period.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.9 mg/kg on about days 1, 8, and 15 of about a 4-week cycle.
  • an anti-TF antibody -drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.9 mg/kg on days 1, 8, and 15 of about a 4-week cycle. In some embodiments, an anti- TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.9 mg/kg once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.9 mg/kg once every 1 week for 3 consecutive weeks followed by a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is 28 days including the resting period.
  • an anti- TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.9 mg/kg on about days 1 , 8, and 15 of about a 4-week cycle.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.9 mg/kg on days 1, 8, and 15 of about a 4-week cycle. In some embodiments, an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.65 mg/kg once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drag conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.65 mg/kg once every 1 week for 3 consecutive weeks followed by a 1 week rest period without any administration of the anti- TF antibody-drag conjugate or antigen-binding fragment thereof so that each cycle time is 28 days including the resting period.
  • an anti-TF antibody-drag conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.65 mg/kg on about days 1, 8, and 15 of about a 4-week cycle.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of about 0.65 mg/kg on days 1, 8, and 15 of about a 4-week cycle.
  • an anti-TF antibody-drag conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.65 mg/kg once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drag conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.65 mg/kg once every 1 week for 3 consecutive weeks followed by a 1 week rest period without any administration of the anti-TF antibody-drag conjugate or antigen-binding fragment thereof so that each cycle time is 28 days including the resting period.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.65 mg/kg on about days 1, 8, and 15 of about a 4-week cycle.
  • an anti-TF antibody- drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a dose of 0.65 mg/kg on days 1, 8, and 15 of about a 4-week cycle.
  • the dose is 0.9 mg/kg and is administered on about days 1, 8, and 15 of about a 4- week cycle and the antibody drug conjugate is tisotumab vedotin.
  • the dose is 0.9 mg/kg and is administered on days 1, 8, and 15 of a 4-week cycle and the antibody drug conjugate is tisotumab vedotin.
  • the dose is 0.9 mg/kg and is administered on about days 1, 8, and 15 of about a 4-week cycle and the antibody drug conjugate is tisotumab vedotin and the dose is decreased to 0.65 mg/kg if one or more adverse events occur. In some embodiments, the dose is 0.9 mg/kg and is administered on days 1, 8, and 15 of a 4-week cycle and the antibody drug conjugate is tisotumab vedotin and the dose is decreased to 0.65 mg/kg if one or more adverse events occur. In some embodiments, the dose is 0.65 mg/kg and is administered on about days 1, 8, and 15 of about a 4-week cycle and the antibody drug conjugate is tisotumab vedotin.
  • the dose is 0.65 mg/kg and is administered on days 1, 8, and 15 of a 4-week cycle and the antibody drug conjugate is tisotumab vedotin.
  • the dose of the anti-TF antibody-drug conjugate administered is the amount that would be administered if the subject weighed 100 kg.
  • the dose of the anti-TF antibody-drug conjugate administered is 65 mg, 90 mg, 130 mg, or 200 mg.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a flat dose ranging from about 50 mg to about 200 mg such as at a flat dose of about 50 mg or a flat dose of about 60 mg or a flat dose of about 70 mg or a flat dose of about 80 mg or a flat dose of about 90 mg or a flat dose of about 100 mg or a flat dose of about 110 mg or a flat dose of about 120 mg or a flat dose of about 130 mg or a flat dose of about 140 mg or a flat dose of about 150 mg or a flat dose of about 160 mg or a flat dose of about 170 mg or a flat dose of about 180 mg or a flat dose of about 190 mg or a flat dose of about 200 mg.
  • the flat dose is administered to the subject once about every 1 to 4 weeks. In certain embodiments, the flat dose is administered to the subject once about every' 1 week, once about every 2 weeks, once about every 3 weeks or once about every 4 weeks. In some embodiments, the flat dose is administered to the subject once about every 3 weeks (e.g, ⁇ 3 days). In some embodiments, the flat dose is administered to the subject once every 3 weeks. In some embodiments, the flat dose is administered to the subject once every 3 weeks and the antibody-drug conjugate is tisotumab vedotin. In some embodiments, the flat does is administered to the subject once about every week (e.g, ⁇ 1 day). In some
  • the flat does is administered to the subject once every w'eek.
  • the flat dose is administered to the subject once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period. In some embodiments, the flat dose is administered to the subject once every 1 week for 3 consecutive weeks followed by a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is 28 days including the resting period. In some embodiments, the flat dose is administered to the subject on about days 1 , 8, and 15 of about a 4-week cycle. In some embodiments, the flat dose is administered to the subject on days 1, 8, and 15 of a 4- week cycle. In some embodiments, the flat dose is administered to the subject on days 1, 8, and 15 of a 4-week cycle and the antibody-drug conjugate is tisotumab vedotin.
  • an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein is administered to the subject at a flat dose ranging from 50 mg to 200 mg such as at a flat dose of 50 mg or a flat dose of 60 mg or a flat dose of 70 mg or a flat dose of 80 mg or a flat dose of 90 mg or a flat dose of 100 mg or a flat dose of 110 mg or a flat dose of 120 mg or a flat dose of 130 mg or a flat dose of 140 mg or a flat dose of 150 mg or a flat dose of 160 mg or a flat dose of 170 mg or a flat dose of 180 mg or a flat dose of 190 mg or a flat dose of 200 mg.
  • the flat dose is administered to the subject once about every 1 to 4 weeks. In certain embodiments, the flat dose is administered to the subject once about every 1 week, once about every' 2 weeks, once about every' 3 weeks or once about every 4 weeks. In some embodiments, the flat dose is administered to the subject once about every- 3 weeks (e.g, ⁇ 3 days). In some embodiments, the flat dose is administered to the subject once every 3 weeks. In some embodiments, the flat dose is administered to the subject once every 3 weeks and the antibody-drug conjugate is tisotumab vedotin. In some embodiments, the flat does is administered to the subject once about every week (e.g., ⁇ 1 day).
  • the flat does is administered to the subject once every week. In some embodiments, the flat dose is administered to the subject once about every 1 week for 3 consecutive weeks followed by about a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fragment thereof so that each cycle time is about 28 days including the resting period. In some embodiments, the flat dose is administered to the subject once every 1 week far 3 consecutive weeks fallowed by a 1 week rest period without any administration of the anti-TF antibody-drug conjugate or antigen-binding fiagment thereof so that each cycle time is 28 days including the resting period. In some embodiments, the flat dose is administered to the subject on about days 1, 8, and 15 of about a 4-week cycle.
  • the flat dose is administered to the subject on days 1, 8, and 15 of a 4-week cycle. In some embodiments, the flat dose is administered to the subject on days 1, 8, and 15 of a 4-week cycle and the antibody- drug conjugate is tisotumab vedotin.
  • a method of treatment or use or product for use described herein further comprises the administration of one or more additional therapeutic agents.
  • the one or mote additional therapeutic agents are administered
  • simultaneous means that the anti-TF antibody-drug conjugate and the one or more additional therapeutic agents are administered to the subject less than one hour apart, such as less than about 30 minutes span, less than about 15 minutes apart, less than about 10 minutes apart or less than about 5 minutes apart.
  • sequential administration means that the anti-TF antibody-drug conjugate and the one or more additional therapeutic agents are administered a least 1 hour apart, at least 2 hours apart, at least 3 hours apart, at least 4 hours apart, at least 5 hours apart, at least 6 hours apart, at least 7 hours apart, at least 8 hours apart, at least 9 hours apart, at least 10 hours apart, at least 11 hours apart, at least 12 hours apart, at least 13 hours apart, at least 14 horns apart, at least 15 hours apart, at least 16 hours apart, at least 17 hours apart, at least 18 hours apart, at least 19 hours apart, at least 20 hours apart, at least 21 hours apart, at least 22 hours apart, at least 23 hours apart, at least 24 hours apart, at least 2 days apart, at least 3 days apart, at least 4 days apart, at least 5 days apart, at least 5 days apart, at least 7 days apart, at least 2 weeks apart, at least 3 weeks apart or at least 4 weeks apart.
  • a method of treating ovarian cancer, peritoneal cancer, or fallopian tube cancer with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein, such as e.g., tisotumab vedotin results in an improvement in one or more therapeutic effects in the subject after administration of the antibody-drug conjugate relative to a baseline.
  • the one or more therapeutic effects is the size of the tumor derived from the cancer, the objective response rate, the duration of response, the time to response, progression free survival, overall survival, CA-125 level, or any combination thereof.
  • the one or more therapeutic effects is the size of the tumor derived from the cancer.
  • the one or more therapeutic effects is decreased tumor size. In one embodiment, the one or more therapeutic effects is stable disease. In one embodiment, the one or more therapeutic effects is partial response. In one embodiment, the one or more therapeutic effects is complete response. In one embodiment, the one or more therapeutic effects is the objective response rate. In one embodiment, the one or more therapeutic effects is the duration of response. In one embodiment, the one or more therapeutic effects is the time to response. In one embodiment, the one or more therapeutic effects is progression free survival. In one embodiment, the one or more therapeutic effects is overall survival. In one embodiment, the one or more therapeutic effects is cancer regression. In one embodiment, the one or more therapeutic effects CA-125 level.
  • response to treatment with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof as described herein may include the following criteria (RECIST Criteria 1.1):
  • the effectiveness of treatment with an anti-TF antibody-drag conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin is assessed by measuring the objective response rate.
  • the objective response rate is the proportion of patients with tumor size reduction of a predefined amount and for a minimum period of time. In some embodiments the objective response rate is based upon RECIST vl.l.
  • the objective response rate is at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80%. In one embodiment, the objective response rate is at least about 20%-80%. In one embodiment, the objective response rate is at least about 30%- 80%. In one embodiment, the objective response rate is at least about 40%-80%. In one embodiment, the objective response rate is at least about 50%-80%. In one embodiment, the objective response rate is at least about 60%-80%. In one embodiment, the objective response rate is at least about 70%-80%. In one embodiment, the objective response rate is at least about 80%. In one embodiment, the objective response rate is at least about 85%.
  • the objective response rate is at least about 90%. In one embodiment, the objective response rate is at least about 95%. In one embodiment, the objective response rate is at least about 98%. In one embodiment, the objective response rate is at least about 99%. In one embodiment, the objective response rate is at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 60%, at least 70%, or at least 80%. In one embodiment, the objective response rate is at least 20%-80%. In one embodiment, the objective response rate is at least 30%-80%. In one embodiment, the objective response rate is at least 40%-80%. In one embodiment, the objective response rate is at least 50%-80%. In one embodiment, the objective response rate is at least 60%-80%.
  • the objective response rate is at least 70%-80%. In one embodiment, the objective response rate is at least 80%. In one embodiment, the objective response rate is at least 85%. In one embodiment, the objective response rate is at least 90%. In one embodiment, the objective response rate is at least 95%. In one embodiment, the objective response rate is at least 98%. In one embodiment, the objective response rate is at least 99%. In one embodiment, the objective response rate is 100%.
  • response to treatment with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin is assessed by measuring the size of a tumor derived from the ovarian cancer, peritoneal cancer, or fallopian tube cancer.
  • the size of a tumor derived from the cancer is reduced by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the size of the tumor derived from the cancer before administration of the anti-TF antibody-drag conjugate.
  • the size of a tumor derived from the cancer is reduced by at least aboutl0%-80%.
  • the size of a tumor derived from the cancer is reduced by at least about 20%-80%.
  • the size of a tumor derived from the cancer is reduced by at least about 30%-80%.
  • the size of a tumor derived from the cancer is reduced by at least about 40%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 50%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 60%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 70%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 85%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 90%.
  • the size of a tumor derived from the cancer is reduced by at least about 95%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 98%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least about 99%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 60%, at least 70%, or at least 80% relative to the size of the tumor derived from the cancer before
  • the size of a tumor derived from the cancer is reduced by at least l0%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 20%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 30%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 40%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 50%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 60%-80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 70%-80%.
  • the size of a tumor derived from the cancer is reduced by at least 80%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 85%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 90%. In one embodiment, tire size of a tumor derived from the cancer is reduced by at least 95%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 98%. In one embodiment, the size of a tumor derived from the cancer is reduced by at least 99%.In one embodiment, the size of a tumor derived from the cancer is reduced by 100%. In one embodiment, the size of a tumor derived from the cancer is measured by magnetic resonance imaging (MR1).
  • MR1 magnetic resonance imaging
  • the size of a tumor derived from the cancer is measured by computed tomography (CT). In one embodiment, the size of a tumor derived from the cancer is measured by positron emission tomography (PET). In one embodiment, the size of a tumor derived from the cancer is measured by ultrasound.
  • CT computed tomography
  • PET positron emission tomography
  • response to treatment with an antibody-drug conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin, promotes regression of a tumor derived from the ovarian cancer, peritoneal cancer, or fallopian tube cancer.
  • a tumor derived from the cancer regresses by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the size of the tumor derived from the cancer before administration of the anti-TF antibody-drug conjugate.
  • a tumor derived from the cancer regresses by at least about 10% to about 80%.
  • a tumor derived from the cancer regresses by at least about 20% to about 80%.
  • a tumor derived from the cancer regresses by at least about 30% to about 80%.
  • a tumor derived from the cancer regresses by at least about 40% to about 80%. In one embodiment, a tumor derived from the cancer regresses by at least about 50% to about 80%. In one embodiment, a tumor derived from the cancer regresses by at least about 60% to about 80%. In one embodiment, a tumor derived from the cancer regresses by at least about 70% to about 80%. In one embodiment, a tumor derived from the cancer regresses by at least about 80%. In one embodiment, a tumor derived from the cancer regresses by at least about 85%. In one embodiment, a tumor derived from the cancer regresses by at least about 90%.
  • a tumor derived from the cancer regresses by at least about 95%. In one embodiment, a tumor derived from the cancer regresses by at least about 98%. In one embodiment, a tumor derived from the cancer regresses by at least about 99%. In one embodiment, a tumor derived from the cancer regresses by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 60%, at least 70%, or at least 80% relative to the size of the tumor derived from the cancer before administration of the anti-TF antibody-drug conjugate. In one embodiment, a tumor derived from the cancer regresses by at least 10% to 80%.
  • a tumor derived from the cancer regresses by at least 20% to 80%. In one embodiment, a tumor derived from the cancer regresses by at least 30% to 80%. In one embodiment, a tumor derived from the cancer regresses by at least 40% to 80%. In one embodiment, a tumor derived from the cancer regresses by at least 50% to 80%. In one embodiment, a tumor derived from the cancer regresses by at least 60% to 80%. In one embodiment, a tumor derived from the cancer regresses by at least 70% to 80%. In one embodiment, a tumor derived from the cancer regresses by at least 80%.
  • a tumor derived from the cancer regresses by at least 85%. In one embodiment, a tumor derived from the cancer regresses by at least 90%. In one embodiment, a tumor derived from the cancer regresses by at least 95%. In one embodiment, a tumor derived from the cancer regresses by at least 98%. In one embodiment, a tumor derived from the cancer regresses by at least 99%. In one embodiment, a tumor derived from the cancer regresses by 100%. In one embodiment, regression of a tumor is determined by measuring the size of the tumor by magnetic resonance imaging (MRI). In one embodiment, regression of a tumor is determined by measuring the size of the tumor by computed tomography (CT). In one embodiment, regression of a tumor is determined by measuring the size of the tumor by positron emission tomography (PET). In one embodiment, regression of a tumor is determined by measuring the size of the tumor by ultrasound.
  • MRI magnetic resonance imaging
  • CT computed tomography
  • PET positron
  • response to treatment with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin, is assessed by measuring the time of progression free survival after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits progression-free survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least about 6 months after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits progression-free survival of at least about one year after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least about two years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least about three years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least about four years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least about five years after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits progression-free survival of at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least eighteen months, at least two years, at least three years, at least four years, or at least five years after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits progression-free survival of at least 6 months after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits progression-free survival of at least one year after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits progression-free survival of at least two years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least three years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least four years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits progression-free survival of at least five years after administration of the anti-TF antibody-drug conjugate.
  • response to treatment with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin, is assessed by measuring the time of overall survival after administration of the anti-TF antibody-drug conjugate.
  • the subject exhibits overall survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits overall survival of at least about 6 months after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits overall survival of at least about one year after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits overall survival of at least about two years after
  • the subject exhibits overall survival of at least about three years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits overall survival of at least about four years after administration of the anti-TF antibody-drug conjugate. In some embodiments, the subject exhibits overall survival of at least about five years after
  • the subject exhibits overall survival of at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least eighteen months, at least two years, at least three years, at least four years, or at least five years after administration of the anti-TF antibody-drag conjugate.
  • the subject exhibits overall survival of at least 6 months after administration of the anti-TF antibody-drag conjugate.
  • the subject exhibits overall survival of at least one year after administration of the anti-TF antibody-drag conjugate.
  • the subject exhibits overall survival of at least two years after administration of the anti-TF antibody-drag conjugate.
  • the subject exhibits overall survival of at least three years after
  • the subject exhibits overall survival of at least four years after administration of the anti-TF antibody-drag conjugate. In some embodiments, the subject exhibits overall survival of at least five years after administration of the anti-TF antibody-drag conjugate.
  • response to treatment with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin is assessed by measuring the duration of response to the anti-TF antibody-drug conjugate after administration of the anti-TF antibody- drug conjugate.
  • the duration of response to the anti-TF antibody-drug conjugate is at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the anti- TF antibody-drug conjugate. In some embodiments, the duration of response to the anti-TF antibody-drug conjugate is at least about 6 months after administration of the antibody-drug conjugate.
  • the duration of response to the anti-TF antibody-drug conjugate is at least about one year after administration of the antibody-drug conjugate. In some embodiments, the duration of response to the anti-TF antibody-drug conjugate is at least about two years after administration of the antibody-drug conjugate. In some embodiments, the duration of response to the anti-TF antibody-drug conjugate is at least about three years after administration of the antibody-drug conjugate. In some embodiments, the duration of response to the anti-TF antibody-drag conjugate is at least about four years after administration of the antibody-drag conjugate. In some embodiments, the duration of response to the anti-TF antibody-drag conjugate is at least about five years after administration of the antibody-drag conjugate.
  • the duration of response to the anti-TF antibody-drag conjugate is at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least eighteen months, at least two years, at least three years, at least four years, or at least five years after administration of the anti-TF antibody-drag conjugate. In some embodiments, the duration of response to the anti-TF antibody-drag conjugate is at least 6 months after administration of the antibody-drag conjugate.
  • the duration of response to the anti-TF antibody-drag conjugate is at least one year after administration of the antibody-drag conjugate. In some embodiments, the duration of response to the anti-TF antibody-drag conjugate is at least two years after administration of the antibody-drag conjugate. In some embodiments, the duration of response to the anti-TF antibody-drag conjugate is at least three years after administration of the antibody-drag conjugate. In some embodiments, the duration of response to the anti-TF antibody-drag conjugate is at least four years after administration of the antibody-drag conjugate. In some embodiments, the duration of response to the anti-TF antibody-drug conjugate is at least five years after administration of the antibody-drag conjugate.
  • response to treatment with an anti-TF antibody-drug conjugate or antigen-binding fragment thereof described herein, such as e.g., tisotumab vedotin is assessed by measuring the cancer antigen-125 (CA-125) level in a blood sample from the subject.
  • CA-125 response rate is according to Gynecologic Cancer Intergroup (GCIG) criteria. See Rustin et al., 2011, Int. J. Gynecol. Cancer 21(2)413-23.
  • the subject exhibits a reduction in CA-125 level in a blood sample from the subject by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the CA-125 level in a blood sample from the subject obtained before administration of the antibody-drug conjugate.
  • a method of treating ovarian cancer with an anti-TF antibody-drug conjugates or antigen-binding fragments thereof described herein, such as e.g., tisotumab vedotin results in the subject developing one or more adverse events.
  • the subject is administered an additional therapeutic agent to eliminate or reduce the severity of the adverse event.
  • the one or more adverse events the subject develops is anaphylaxis, anemia, abdominal pain, hypokalemia, hyponatremia, severe hypersensitivity, epistaxis, an infusion-related reaction, fatigue, nausea, alopecia, conjunctivitis, symblepharon, constipation, decreased appetite, diarrhea, vomiting, peripheral neuropathy, general physical health deterioration, or any combination thereof.
  • the one or more adverse events is a grade 1 or greater adverse event.
  • the one or more adverse events is a grade 2 or greater adverse event.
  • the one or more adverse events is a grade 3 or greater adverse event.
  • the one or more adverse events is a grade 1 adverse event.
  • the one or more adverse events is a grade 2 adverse event. In some embodiments, the one or more adverse events is a grade 3 adverse event. In some embodiments, the one or more adverse events is a grade 4 adverse event. In some embodiments, the one or more adverse events is a serious adverse event. In some embodiments, the one or more adverse events is conjunctivitis, conjunctival ulceration, and/or keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is conjunctivitis, conjunctival ulceration, and keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is conjunctivitis and keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is conjunctivitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular
  • the subject is administered a treatment with the additional therapeutic agent to eliminate or reduce the severity of the adverse event (e.g. , conjunctivitis, conjunctival ulceration, and/or keratitis).
  • the treatment is eye cooling pads (e.g.
  • the one or more adverse events is a recurrent infusion related reaction and the additional therapeutic agent is an antihistamine, acetaminophen and/or a corticosteroid. In some embodiments, the one or more adverse events is neutropenia and the additional therapeutic agent is growth factor support (G-CSF).
  • G-CSF growth factor support
  • the subject treated with an anti-TF antibody-drag conjugates or antigen-binding fragments thereof described herein, such as e.g., tisotumab vedotin, is at risk of developing one or more adverse events.
  • the subject is administered an additional therapeutic agent to prevent the development of the adverse event or to reduce the severity of the adverse event.
  • the one or more adverse events the subject is at risk of developing is anaphylaxis, anemia, abdominal pain, hypokalemia, hyponatremia, severe hypersensitivity, epistaxis, an infusion-related reaction, fatigue, nausea, alopecia, conjunctivitis, keratitis, symblepharon, constipation, decreased appetite, diarrhea, vomiting, peripheral neuropathy, general physical health deterioration, or any combination thereof.
  • the one or more adverse events is a grade 1 or greater adverse event. In some embodiments, the one or more adverse events is a grade 2 or greater adverse event. In some embodiments, the one or more adverse events is a grade 3 or greater adverse event.
  • the one or mote adverse events is a grade 1 adverse event. In some embodiments, the one or more adverse events is a grade 2 adverse event. In some embodiments, the one or more adverse events is a grade 3 adverse event. In some embodiments, the one or mote adverse events is a grade 4 adverse event. In some embodiments, the one or more adverse events is a serious adverse event. In some embodiments, the one or more adverse events is conjunctivitis, conjunctival ulceration, and/or keratitis and the additional therapeutic agent is a preservative-firee lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is conjunctivitis, conjunctival ulceration, and keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is conjunctivitis and keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is conjunctivitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the one or more adverse events is keratitis and the additional therapeutic agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor, an antibiotic, a steroid eye drop, or any combination thereof.
  • the subject is administered a treatment with the additional therapeutic agent to prevent the development of the adverse event or to reduce the severity of the adverse event (e.g, conjunctivitis, conjunctival ulceration, and/or keratitis).
  • the treatment is eye cooling pads (e.g. THERA PEARL Eye Mask or similar).
  • the one or more adverse events is a recurrent infusion related reaction and the additional therapeutic agent is an antihistamine, acetaminophen and/or a corticosteroid.
  • the one or more adverse events is neutropenia and the additional therapeutic agent is growth factor support (G-CSF).
  • compositions e.g., pharmaceutical compositions and therapeutic formulations
  • Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington: The Science and Practice of Pharmacy, 20th Ed.,
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers, antioxidants including ascorbic acid, methionine, Vitamin E, sodium metabisulfite; preservatives, isotonicifiers, stabilizers, metal complexes (e.g. Zn-protein complexes); chelating agents such as EDTA and/or non-ionic surfactants.
  • Buffers can be used to control the pH in a range which optimizes the therapeutic effectiveness, especially if stability is pH dependent. Buffers can be present at concentrations ranging from about 50 mM to about 250 mM. Suitable buffering agents for use with the present invention include both organic and inorganic acids and salts thereof. For example, citrate, phosphate, succinate, tartrate, fumarate, gluconate, oxalate, lactate, acetate. Additionally, buffers may be comprised of histidine and trimethylamine salts such as Tris. [0152] Preservatives can be added to prevent microbial growth, and are typically present in a range from about 0.2%- 1.0% (w/v).
  • Suitable preservatives for use with the present invention include octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium halides (e.g, chloride, bromide, iodide), benzethonium chloride; thimerosal, phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol;
  • Tonicity agents can be present to adjust or maintain the tonicity' of liquid in a composition.
  • stabilizers When used with large, charged biomolecules such as proteins and antibodies, they are often termed “stabilizers” because they can interact with the charged groups of the amino acid side chains, thereby lessening the potential for inter and intramolecular interactions.
  • Tonicity agents can be present in any amount between about 0.1% to about 25% by weight or between about 1% to about 5% by weight, taking into account the relative amounts of the other ingredients.
  • tonicity agents include polyhydric sugar alcohols, trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
  • Additional excipients include agents which can serve as one or more of the following: (1) bulking agents, (2) solubility enhancers, (3) stabilizers and (4) and agents preventing denaturation or adherence to the container wall.
  • excipients include: polyhydric sugar alcohols (enumerated above); amino acids such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, threonine, etc.; organic sugars or sugar alcohols such as sucrose, lactose, lactitol, trehalose, stachyose, mannose, sorbose, xylose, ribose, ribitol, myoinisitose, myoinisitol, galactose, galactitol, glycerol, cyclitols (e.g., inosi
  • Non-ionic surfactants or detergents can be present to help solubilize the therapeutic agent as well as to protect the therapeutic protein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stress without causing denaturation of the active therapeutic protein or antibody.
  • Non-ionic surfactants are present in a range of about 0.05 mg/ml to about 1.0 mg/ml or about 0.07 mg/ml to about 0.2 mg/ml. In some embodiments, non-ionic surfactants are present in a range of about 0.001% to about 0.1% w/v or about 0.01% to about 0.1% w/v or about 0.01% to about 0.025% w/v.
  • Suitable non-ionic surfactants include polysorbates (20, 40, 60, 65, 80, etc.), polyoxamers (184, 188, etc.), PLURONIC® polyols, TRITON®, polyoxyethylene sorbitan monoethers (TWEEN®-20, TWEEN®-80, etc.), lauromacrogol 400, polyoxyl 40 stearate, polyoxyethylene hydrogenated castor oil 10, 50 and 60, glycerol monostearate, sucrose fatty acid ester, methyl celluose and carboxymethyl cellulose.
  • Anionic detergents that can be used include sodium lauryl sulfate, dioctyle sodium sulfosuccinate and dioctyl sodium sulfonate.
  • Cationic detergents include benzalkonium chloride or benzethonium chloride.
  • an anti-TF antibody-drug conjugate described herein is in a formulation comprising the anti-TF antibody drug conjugate, histidine, sucrose, and D-mannitol, wherein the formulation has a pH of about 6.0.
  • an anti-TF antibody-drug conjugate described herein is in a formulation comprising the anti-TF antibody drug conjugate at a concentration of about 10 mg/ml, histidine at a concentration of about 30 rtiM, sucrose at a concentration of about 88 mM, D-mannitol at a concentration of about 165 mM, wherein the formulation has a pH of about 6.0.
  • an anti-TF antibody-drug conjugate described herein is in a formulation comprising the anti-TF antibody drug conjugate at a concentration of 10 mg/ml, histidine at a concentration of 30 mM, sucrose at a concentration of 88 mM, D-mannitol at a concentration of 165 mM, wherein the formulation has a pH of 6.0.
  • the formulation comprises tisotumab vedotin at a concentration of 10 mg/ml, histidine at a concentration of 30 mM, sucrose at a concentration of 88 mM, D-mannitol at a concentration of 165 mM, wherein the formulation has a pH of 6.0.
  • a formulation comprising the anti-TF antibody-conjugate described herein does not comprise a surfactant (i.e., is free of surfactant).
  • the formulations In order for the formulations to be used for in vivo administration, they must be sterile.
  • the formulation may be rendered sterile by filtration through sterile filtration membranes.
  • the therapeutic compositions herein generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • the route of administration is in accordance with known and accepted methods, such as by single or multiple bolus or infusion over a long period of time in a suitable manner, e.g. , injection or infusion by subcutaneous, intravenous, intraperitoneal, intramuscular, intraarterial, intralesional or intraarticular routes, topical administration, inhalation or by sustained release or extended-release means.
  • the formulation herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • the composition may comprise a cytotoxic agent, cytokine or growth inhibitory agent.
  • cytotoxic agent cytokine or growth inhibitory agent.
  • Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
  • compositions comprising a population of anti-TF antibody- drug conjugates or antigen-binding fragments thereof as described herein for use in a method of treating ovarian cancer as described herein.
  • compositions comprising a population of antibody-drug conjugates, wherein the antibody-drug conjugates comprise a linker attached to MMAE, wherein is the antibody-drug conjugate has the following structure:
  • p denotes a number from 1 to 8, e.g., 1, 2, 3, 4, 5, 6, 7 or 8
  • S represents a sulphydryl residue of the anti-TF antibody or antigen-binding fragment thereof
  • Ab designates the anti- TF antibody or antigen-binding fragment thereof as described herein, such as tisotumab.
  • p denotes a number from 3 to 5.
  • the average value of p in the composition is about 4.
  • the population is a mixed population of antibody-drug conjugates in which p varies from 1 to 8 for each antibody-drug conjugate.
  • the population is a homogenous population of antibody-drag conjugates with each antibody-drag conjugate having the same value for p.
  • a composition comprising an anti-TF antibody-drug conjugate as described herein, such as e.g., tisotumab vedotin, is coadministered with one or more additional therapeutic agents.
  • the coadministration is simultaneous or sequential.
  • the anti-TF antibody-drug conjugate as described herein is administered simultaneously with the one or more additional therapeutic agents.
  • simultaneous means that the anti-TF antibody-drug conjugate and the one or more additional therapeutic agents are administered to the subject less than about one hour apart, such as less than about 30 minutes apart, less than about 15 minutes apart, less than about 10 minutes apart or less than about 5 minutes apart.
  • simultaneous means that the anti-TF antibody-drug conjugate and the one or more additional therapeutic agents are administered to the subject less than one hour apart, such as less than 30 minutes apart, less than 15 minutes apart, less than 10 minutes apart or less than 5 minutes apart. In some embodiments, the anti-TF antibody-drug conjugate is administered sequentially with the one or more additional therapeutic agents.
  • sequential administration means that the anti-TF antibody-drug conjugate and the one or more additional therapeutic agents are administered a least 1 hour apart, at least 2 hours apart, at least 3 hours apart, at least 4 hours apart, at least 5 hours apart, at least 6 hours apart, at least 7 hours apart, at least 8 hours apart, at least 9 hours apart, at least 10 hours apart, at least 11 hours apart, at least 12 hours apart, at least 13 hours apart, at least 14 hours apart, at least 15 hours apart, at least 16 hours apart, at least 17 hours apart, at least 18 hours apart, at least 19 hours apart, at least 20 hours apart, at least 21 hours apart, at least 22 hours apart, at least 23 hours apart, at least 24 hours apart, at least 2 days apart, at least 3 days apart, at least 4 days apart, at least 5 days apart, at least 5 days apart, at least 7 days apart, at least 2 weeks apart, at least 3 weeks apart or at least 4 weeks apart.
  • a composition comprising an anti-TF antibody-drug conjugate as described herein, such as e.g., tisotumab vedotin, is coadministered with one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events.
  • the coadministration is simultaneous or sequential.
  • the anti-TF antibody-drug conjugate is administered simultaneously with the one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events.
  • simultaneous means that the anti-TF antibody-drug conjugate and the one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events are administered to the subject less than about one hour apart, such as less than about 30 minutes apart, less than about 15 minutes apart, less than about 10 minutes apart or less than about 5 minutes apart. In some embodiments, simultaneous means that the anti-TF antibody-drug conjugate and the one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events are administered to the subject less than one hour apart, such as less than 30 minutes apart, less than 15 minutes apart, less than 10 minutes apart or less than 5 minutes apart. In some embodiments, the anti-TF antibody-drug conjugate is administered sequentially with the one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events.
  • sequential administration means that the anti-TF antibody-drug conjugate and the one or more therapeutic agents are administered a least 1 hour apart, at least 2 hours apart, at least 3 hours apart, , at least 4 hours apart, at least 5 hours apart, at least 6 hours apart, at least 7 hours apart, at least 8 horns apart, at least 9 hours apart, at least 10 hours apart, at least 11 hours apart, at least 12 hours apart, at least 13 hours apart, at least 14 hours apart, at least 15 hours apart, at least 16 hours apart, at least 17 hours apart, at least 18 hours apart, at least 19 hours apart, at least 20 hours apart, at least 21 hours apart, at least 22 hours apart, at least 23 hours apart, at least 24 hours apart, at least 2 days apart, at least 3 days apart, at least 4 days apart, at least 5 days apart, at least 5 days apart, at least 7 days apart, at least 2 weeks apart, at least 3 weeks apart or at least 4 weeks apart.
  • the anti-TF antibody-drug conjugate is administered prior to the one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events. In some embodiments, the one or more therapeutic agents to eliminate or reduce the severity of one or more adverse events is administered prior to the anti-TF antibody-drug conjugate.
  • an article of manufacture or kit which comprises an anti-TF antibody-drug conjugate described herein, such as e.g., tisotumab vedotin.
  • the article of manufacture or kit may further comprise instructions for use of the anti-TF antibody-drug conjugate in the methods of the invention.
  • the article of manufacture or kit comprises instructions for the use of an anti-TF antibody-drug conjugate in methods for treating ovarian cancer in a subject comprising administering to the subject an effective amount of an anti-TF antibody-drug conjugate.
  • the subject is a human.
  • the article of manufacture or kit may further comprise a container.
  • Suitable containers include, for example, bottles, vials (e.g., dual chamber vials), syringes (such as single or dual chamber syringes) and test tubes.
  • the container is a vial.
  • the container may be formed from a variety of materials such as glass or plastic. The container holds the formulation.
  • the article of manufacture or kit may further comprise a label or a package insert, which is on or associated with the container, may indicate directions for reconstitution and/or use of the formulation.
  • the label or package insert may further indicate that the formulation is useful or intended for subcutaneous, intravenous (e g., intravenous infusion), or other modes of administration for treating ovarian cancer as described herein in a subject.
  • the container holding the formulation may be a single-use vial or a multi-use vial, which allows for repeat administrations of the reconstituted formulation.
  • the article of manufacture or kit may further comprise a second container comprising a suitable diluent.
  • the article of manufacture or kit may further include other materials desirable from a commercial, therapeutic, and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • the article of manufacture or kit herein optionally further comprises a container comprising a second medicament, wherein the anti-TF antibody-drug conjugate is a first medicament, and which article or kit further comprises instructions on the label or package insert for treating the subject with the second medicament, in an effective amount.
  • the label or package insert indicates that the first and second medicaments are to be administered sequentially or simultaneously, as described herein.
  • the label or package insert indicates that the first medicament is to be administered prior to the administration of the second medicament.
  • tire label or package insert indicates that second medicament is to be administered prior to the first medicament.
  • the article of manufacture or kit herein optionally further comprises a container comprising a second medicament, wherein the second medicament is for eliminating or reducing the severity of one or more adverse events, wherein the anti-TF antibody-drug conjugate is a first medicament, and which article or kit further comprises instructions on the label or package insert for treating the subject with the second medicament, in an effective amount.
  • the label or package insert indicates that the first and second medicaments are to be administered sequentially or simultaneously, as described herein.
  • the label or package insert indicates that the first medicament is to be administered prior to the administration of the second medicament.
  • the label or package insert indicates that second medicament is to be administered prior to the first medicament.
  • the anti-TF antibody-drug conjugate is present in the container as a lyophilized powder.
  • the lyophilized powder is in a hermetically sealed container, such as a vial, an ampoule or sachette, indicating the quantity of the active agent.
  • an ampoule of sterile water for injection or saline can be, for example, provided, optionally as part of the kit, so that the ingredients can be mixed prior to administration.
  • kits can further include, if desired, one or more of various conventional pharmaceutical components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers, etc., as will be readily apparent to those skilled in the art.
  • Printed instructions either as inserts or as labels, indicating quantities of the components to be administered, guidelines for administration, and/or guidelines for mixing the components can also be included in the kit.
  • a method of treating ovarian cancer, peritoneal cancer or fallopian tube cancer in a subject comprising administering to the subject an antibody-drug conjugate that binds to tissue factor (TF), wherein the antibody-drug conjugate comprises an anti-TF antibody or an antigen-binding fragment thereof conjugated to a monomethyl auristatin or a functional analog thereof or a functional derivative thereof, wherein the antibody-drug conjugate is administered at a dose ranging from about 0.65 mg/kg to about 2.1 mg/kg.
  • TF tissue factor
  • the anti-TF antibody or antigenbinding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises:
  • the anti-TF antibody or antigenbinding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ ID NO:7 and a light chain variable region comprising an amino acid sequence at least 85% identical to the amino acid sequence of SEQ P) NO:8.
  • the anti-TF antibody or antigenbinding fragment thereof of the antibody-drag conjugate comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:8.
  • the antibody-drag conjugate further comprises a linker between the anti-TF antibody or antigen-binding fragment thereof and the monomethyl auristatin.
  • vc is the dipeptide valine-citrulline
  • PAB is:
  • S represents a sulphydryl residue of the anti-TF antibody
  • Ab designates the anti-TF antibody or antigen-binding fragment thereof.
  • the one or more therapeutic effects is selected from the group consisting of: size of a tumor derived from the cancer, objective response rate, duration of response, time to response, progression free survival, overall survival and CA-125 level.
  • any one of embodiments 1-57 wherein the size of a tumor derived from the cancer is reduced by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the size of the tumor derived from the cancer before administration of the antibody-drug conjugate.
  • 60 The method of any one of embodiments 1-59, wherein the subject exhibits progression-free survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody- drug conjugate.
  • 61 The method of any one of embodiments 1-60, wherein the subject exhibits overall survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody- drug conjugate.
  • the duration of response to the antibody-drug conjugate is at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody-drug conjugate.
  • a kit comprising:
  • An antibody-drag conjugate that binds to TF for use in the treatment of ovarian cancer, peritoneal cancer or fallopian tube cancer in a subject wherein the antibody-drag conjugate comprises an anti-TF antibody or an antigen-binding fragment thereof conjugated to a monomethyl auristatin or a functional analog thereof or a functional derivative thereof, wherein the antibody-drag conjugate is administered at a dose ranging from about 0.65 mg/kg to about 2.1 mg/kg.
  • the antibody-drug conjugate for use of any one of embodiments 74 or 79-82, wherein the antibody-drug conjugate is administered once about every 1 week for 3 consecutive weeks followed by about a 1 week resting period during which the antibody-drug conjugate is not administered.
  • the antibody-drug conjugate for use of any one of embodiments 74 or 79-82, wherein the antibody-drug conjugate is administered once every 1 week for three consecutive weeks followed by a one week resting period during which the antibody-drug conjugate is not administered.
  • the antibody-drug conjugate for use of any one of embodiments 74-88, wherein the subject has been previously treated with one or more therapeutic agents and relapsed after the treatment, wherein the one or more therapeutic agents is not the antibody-drug conjugate.
  • MMAE monomethyl auristatin E
  • the antibody-drug conjugate for use of any one of embodiments 74-117, wherein the anti- TF antibody or antigen-binding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:8.
  • the antibody-drug conjugate for use of any one of embodiments 74-119, wherein the antibody-drug conjugate further comprises a linker between the anti-TF antibody or antigenbinding fragment thereof and the monomethyl auri statin.
  • vc is tiie dipeptide valine-citrulline
  • PAB is:
  • MMAE monomethyl auristatin E
  • S represents a sulphydryl residue of the anti-TF antibody
  • Ab designates the anti-TF antibody or antigen-binding fragment thereof.
  • the antibody-drug conjugate for use of any one of embodiments 74-125, wherein the antibody-drug conjugate is tisotumab vedotin.
  • the antibody-drug conjugate for use of any one of embodiments 74-127, wherein at least about 0.1%, at least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 6%, at least about 7%, at least about 8%, at least about 9%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% of the cancer cells express TF.
  • the antibody-drug conjugate for use of embodiment 129, wherein the one or more therapeutic effects is selected from the group consisting of: size of a tumor derived from the cancer, objective response rate, duration of response, time to response, progression free survival, overall survival and CA-125 level.
  • the antibody -drag conjugate for use of any one of embodiments 74-130, wherein the size of a tumor derived from the cancer is reduced by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the size of the tumor derived from the cancer before administration of the antibody-drag conjugate.
  • the antibody-drag conjugate for use of any one of embodiments 74-133, wherein the subject exhibits overall survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody-drag conjugate.
  • the antibody-drag conjugate for use of any one of embodiments 74-134, wherein the duration of response to the antibody-drag conjugate is at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody-drag conjugate.
  • the duration of response to the antibody-drag conjugate is at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about
  • hyponatremia severe hypersensitivity, epistaxis, an infusion-related reaction, fatigue, nausea, alopecia, conjunctivitis, keratitis, symblepharon, constipation, decreased appetite, diarrhea, vomiting, peripheral neuropathy, or general physical health deterioration.
  • the antibody-drug conjugate for use of any one of embodiments 137-141, wherein the one or more adverse events is conjunctivitis and/or keratitis and the additional agent is a preservative-free lubricating eye drop, an ocular vasoconstrictor and/or a steroid eye drop.
  • 145 The antibody-drug conjugate for use of any one of embodiments 74-144, wherein the antibody-drug conjugate is in a pharmaceutical composition comprising the antibody-drug conjugate and a pharmaceutical acceptable carrier.
  • 146 Use of an antibody-drug conjugate that binds to tissue factor (TF) for the manufacture of a medicament for treating ovarian cancer, peritoneal cancer or fallopian tube cancer in a subject, wherein tire antibody-drug conjugate comprises an anti-TF antibody or an antigen-binding fragment thereof conjugated to a monomethyl auristatin or a functional analog thereof or a functional derivative thereof, wherein the antibody-drug conjugate is administered at a dose ranging from about 0.65 mg/kg to about 2.1 mg/kg.
  • TF tissue factor
  • embodiment 165 wherein the subject experienced disease progression or relapsed 2 or more months after treatment with the platinum-based therapy.
  • embodiment 165 wherein the subject experienced disease progression or relapsed within 6 months after treatment with the platinum-based therapy.
  • embodiment 165 wherein the subject experienced disease progression or relapsed between 2 months and 6 months after treatment with the platinum-based therapy.
  • VEGF antagonist is an anti-VEGF antibody.
  • embodiment 177 wherein the ovarian cancer is epithelial ovarian cancer.
  • embodiment 182 wherein the advanced stage cancer is a stage 3 or stage 4 cancer.
  • any one of embodiments 146-187, wherein the anti-TF antibody or antigenbinding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises:
  • any one of embodiments 146-189, wherein the anti-TF antibody or antigenbinding fragment thereof of the antibody-drug conjugate comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:8.
  • vc is the dipeptide valine-citrulline
  • PAB is:
  • S represents a sulphydryl residue of the anti-TF antibody
  • Ab designates the anti-TF antibody or antigen-binding fragment thereof.
  • any one of embodiments 146-199 wherein at least about 0.1%, at least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 6%, at least about 7%, at least about 8%, at least about 9%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% of the cancer cells express TF.
  • embodiment 201 wherein the one or more therapeutic effects is selected from the group consisting of: size of a tumor derived from the cancer, objective response rate, duration of response, time to response, progression free survival, overall survival and CA-125 level.
  • 203 The use of any one of embodiments 146-202, wherein the size of a tumor derived from the cancer is reduced by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the size of the tumor derived from the cancer before administration of the antibody-drug conjugate.
  • any one of embodiments 146-203, wherein the objective response rate is at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80%.
  • any one of embodiments 146-205 wherein the subject exhibits overall survival of at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody- drug conjugate.
  • any one of embodiments 146-206, wherein the duration of response to the antibody-drug conjugate is at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after administration of the antibody-drug conjugate.
  • any one of embodiments 146-207 wherein the subject exhibits a reduction in CA-125 level in a blood sample from the subject by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, or at least about 80% relative to the CA-125 level in a blood sample obtained from the subject before
  • embodiment 209 or embodiment 210 wherein the one or more adverse events is anaphylaxis, anemia, abdominal pain, hypokalemia, hyponatremia, severe hypersensitivity, epistaxis, an infusion-related reaction, fatigue, nausea, alopecia, conjunctivitis, keratitis, symblepharon, constipation, decreased appetite, diarrhea, vomiting, peripheral neuropathy, or general physical health deterioration.
  • the one or more adverse events is anaphylaxis, anemia, abdominal pain, hypokalemia, hyponatremia, severe hypersensitivity, epistaxis, an infusion-related reaction, fatigue, nausea, alopecia, conjunctivitis, keratitis, symblepharon, constipation, decreased appetite, diarrhea, vomiting, peripheral neuropathy, or general physical health deterioration.
  • Tisotumab vedotin is an antibody-drug conjugate comprising a TF -targeted human monoclonal immunoglobulin G1 (subtype K) conjugated via a protease-cleavablc valine citrulline linker to the drug monomethyl auristatin E (MMAE), a dolastatin 10 analog.
  • MMAE monomethyl auristatin E
  • Tisotumab vedotin selectively targets TF to deliver a clinically validated toxic payload to tumor cells (FIG. 1). See Breij EC et al. Cancer Res. 2014;74(4): 1214-1226 and Chu AJ. lntJlnflam. 2011, 2011: Article ID 367284;
  • Dolastafins and auristatins belong to a class of chemotherapies that act as microtubule disrupting agents.
  • a phase I/II single arm, multicenter clinical trial investigated the efficacy, safety and tolerability of 2.0 mg/kg Q3W tisotumab vedotin in patients with relapsed, advanced and/or metastatic cancer.
  • Each eligible patient received intravenous (IV) infusion of tisotumab vedotin at a dose of 2.0 mg/kg on day 1 of each 21-day cycle (i.e., each treatment cycle was 3 weeks (Q3W)).
  • the reconstituted tisotumab vedotin was diluted into a 0.9% NaCl 100 mL infusion bag according to the dose calculated for the patient to receive 2.0 mg/kg tisotumab vedotin.
  • Intravenous infusion was completed within 24 hours after the tisotumab vedotin vial had been reconstituted.
  • a 0.2 pm in-line filter was used for the intravenous infusion.
  • the entire 100 mL volume from the prepared infusion bag was administered. No dead volume was provided.
  • a primary objective of the study was to assess safety and tolerability of tisotumab vedotin.
  • Adverse event (AE) severity was graded according to CTCAE version 4.03.
  • the following subjects were eligible for the study: (1) subjects with relapsed, advanced and/or metastatic cancer and had foiled available standard treatments, or were not candidates for standard therapy; (2) subjects with measurable diseases; (3) subjects who were at least 18 years old; (4) subjects with acceptable renal function, liver function, hematological status (without hematologic support), and acceptable coagulation status; (5) subjects with Eastern Cooperative Oncology Group (ECOG) performance status of 0 or 1; (6) subjects with life expectancy of at least three months; (7) subjects with negative serum pregnancy test results, if the subjects were female and between 18-55 years old; (8) subjects who were not pregnant or breast feeding women; (9) subjects, both females and males, of reproductive potential that agreed to use adequate contraception during and for six months after the last infusion of tisotumab vedotin; and (10) subjects that provided signed informed consent
  • Example 2 Phase I/II clinical study of dose-dense tisotumab vedotin treatment in subjects with relansed. advanced and/or metastatic cancer.
  • a phase I/II single arm, multicenter clinical trial investigated the efficacy, safety and tolerability of 1.2 mg/kg 3Q4W tisotumab vedotin in patients with recurrent, advanced and/or metastatic cancer.
  • Each eligible patient received intravenous (IV) infusion of tisotumab vedotin at a dose of 1.2 mg/kg on days 1, 8 and 15 of each 28-day cycle (i.e ., each treatment cycle was 4 weeks (3Q4W); also referred herein as “dose-dense schedule”).
  • IV intravenous
  • tisotumab vedotin a dose of 1.2 mg/kg on days 1, 8 and 15 of each 28-day cycle (i.e ., each treatment cycle was 4 weeks (3Q4W); also referred herein as “dose-dense schedule”).
  • One patient was switched onto 2.0 mg/kg tisotumab vedotin Q3W beginning at Cycle 6, after her response had been recorded.
  • the reconstituted tisotumab vedotin was diluted into a 0.9% NaCl 100 mL infusion bag according to the dose calculated for the patient to receive 1.2 mg/kg tisotumab vedotin.
  • Intravenous infusion was completed within 24 hours after the tisotumab vedotin vial had been reconstituted.
  • a 0.2 pm in-line filter was used for the intravenous infusion.
  • the entire 100 mL volume from the prepared infusion bag was administered. No dead volume was provided.
  • a primary objective of the study was to assess safety and tolerability of tisotumab vedotin.
  • Adverse events were measured throughout the trial from the first treatment until the end of the trial.
  • Adverse event (AE) severity was graded according to CTCAE version 4.03.
  • Secondary objectives of the study included assessment of the pharmacokinetic profile of tisotumab vedotin and preliminary assessment of the efficacy of the dose-dense regimen of tisotumab vedotin in treating ovarian cancer.
  • subjects with relapsed, advanced and/or metastatic cancer and had failed available standard treatments, or were not candidates for standard therapy were not candidates for standard therapy; (2) subjects with measurable diseases; (3) subjects who were at least 18 years old; (4) subjects with acceptable renal function, liver function, hematological status (without hematologic support), and acceptable coagulation status; (5) subjects with ECOG performance status of 0 or 1; (6) subjects with life expectancy of at least three months; (7) subjects with negative serum pregnancy test results, if the subjects were female and between 18- 55 years old; (8) subjects who were not pregnant or breast feeding women; (9) subjects, both females and males, of reproductive potential that agreed to use adequate contraception during and for six months after the last infusion of tisotumab vedotin; and (10) subjects that provided signed informed consent.
  • seropositivity subjects with positive serology (unless due to vaccination or passive immunization due to Ig therapy) for hepatitis B; (23) subjects with positive serology for hepatitis C based on test at screening; (24) subjects with inflammatory bowel disease including Crohn's disease and colitis ulcerosa; (25) subjects with inflammatory lung disease including moderate and severe asthma and chronic obstructive pulmonary disease (COPD) requiring chronic medical therapy; or (26) subjects with ongoing acute or chronic inflammatory skin disease.
  • COPD chronic obstructive pulmonary disease
  • This randomized, open label, multicenter trial is designed to evaluate the safety, antitumor activity, and pharmacokinetics of tisotumab vedotin (TV) administered every 3 weeks (Q3W) or on days 1, 8, and 15 of every 4-week cycle (3Q4W [dose-dense regimen]) for the treatment of various types of platinum-resistant ovarian cancer.
  • the study has an initial safety run-in period fallowed by a phase 2 period.
  • Eligible patients are at least 18 years of age, must have PROC, be eligible for single agent chemotherapy, and must have previously received a bevacizumab-containing treatment regimen for ovarian cancer, if eligible.
  • Safety run-in patients may have received up to 5 prior systemic treatment regimens far ovarian cancer.
  • Phase 2 patients must have received at most 1 prior cytotoxic chemotherapy regimen in the PROC setting.
  • Approximately 142 patients may be enrolled in the study. This includes 6-12 patients in the safety run-in phase as well as approximately 30 patients in each of two phase 2 cohorts with a possible expansion of up to approximately 70 additional patients in one of the two phase 2 cohorts.
  • Inclusion criteria and exclusion criteria for patients enrolled in trial are shown in Table 1.
  • Criteria or fallopian tube cancer (excluding carcinosarcoma, mucinous, and low grade serous histologies), hereafter referred to as“ovarian cancer”.
  • Platinum-resistant ovarian cancer which is defined as having progressed or relapsed within 6 months after previous platinum-containing chemotherapy and for which single agent chemotherapy is appropriate. Progression or relapse must be documented radiographically using RECIST vl.l criteria. The patient may have received up to 5 prior systemic treatment regimens for ovarian cancer.
  • the patient must have received at most 1 prior cytotoxic chemotherapy regimen in the PROC setting.
  • Patients eligible to receive a PARP inhibitor may have received such therapy; PARP inhibitors are not considered cytotoxic chemotherapy regimens for the purposes of this study.
  • Lymph node lesion >15 mm in the shortest diameter from a non- irradiated area.
  • ECOG Eastern Cooperative Oncology Group
  • FIG. 2 shows a schematic of the study design.
  • the safety run-in period evaluates the safety of the dose-dense regimen in at least 6 patients. If no more than 1 patient experiences a DLT among all safety run-in patients given 0.9 mg/kg on a dose-dense schedule, patients will be randomized in the phase II portion to receive tisotumab vedotin 2.0 mg/kg intravenously (IV) every 3 weeks (Q3W regimen) or 0.9 mg/kg on Days 1, 8, and 15 of every 4-week cycle (dose- dense regimen).
  • the dose of tisotumab vedotin will be de-escalated to 0.65 mg/kg and 6 more patients will be enrolled at this dose on the dose-dense schedule. If an additional two more patients experience DLTs with the dose-dense regimen at 0.65 mg/kg tisotumab vedotin, the phase 2 portion of the study will be a single arm study of the Q3W regimen.
  • Randomization will be stratified by first line vs. second line PROC and histology (serous vs. non-serous). Tisotumab vedotin dosing is capped at the 100 kg patient weight equivalent in all cohorts. If tolerability of the dose-dense schedule is not confirmed after the safety run-in portion, the phase 2 portion will consist of a single arm study of the Q3W dosing regimen.
  • Lyophilized vials containing 40 mg of tisotumab vedotin are stored in a refrigerator at 2°C to 8°C.
  • Tisotumab vedotin is reconstituted in 4 ml of water leading to a reconstituted solution comprising 10 mg/mL tisotumab vedotin, 30 mM histidine, 88 raM sucrose, and 165 mM D-mannitol.
  • the reconstituted antibody drug-conjugate solution has a pH of 6.0.
  • the reconstituted tisotumab vedotin is diluted into a 0.9% NaCl 100 mL infusion bag according to the dose calculated for the patient.
  • Intravenous infusion is completed within 24 hours after the tisotumab vedotin vial had been reconstituted. A 0.2 pm in-line filter is used for the intravenous infusion. The entire 100 mL volume from the prepared infusion bag is administered. No dead volume is provided. The infusion is given over approximately 30 minutes in the absence of infusion-related reactions (IRRs).
  • IRRs infusion-related reactions
  • the confirmed objective response rate is defined as the proportion of patients who achieve a confirmed CR or PR according to RECIST vl.1 as assessed by the investigator. Patients who do not have at least 2 post-baseline response assessments (initial response and confirmation scan) are counted as non-responders.
  • Confirmed and unconfirmed ORR is defined as the proportion of patients who achieve a CR or PR according to RECIST vl .1 as assessed by the investigator. These include patients with confirmed responses as well as those whose responses were not confirmed or had not yet been assessed for confirmation. DOR is defined as the time from the first documentation of objective response (CR or PR that is subsequently confirmed) to the first documentation of PD or death due to any cause, whichever comes first. Patients who do not have at least 1 postbaseline response assessment are counted as non-responders.
  • CA-125 response rate is defined as the proportion of patients who have at least a 50% reduction in CA-125 value from baseline. The response must be confirmed in a subsequent sample collected >28 days after the prior sample. The absolute value of the confirmatory sample must be ⁇ 110% of the prior sample. Only patients who have an elevated baseline CA- 125 value of >2 x ULN and within 2 weeks prior to the first dose of study drug are included in the analysis.
  • the combined RECIST/CA-125 overall response is defined as the proportion of patients whose best response is a CR or PR according to the Gynecological Cancer Intergroup (GCIG) combined RECIST and CA-125 criteria (Rustin GJ. et al, Int. J. Gynecol. Cancer 21(2): 419-23 (2011)).
  • DCR is defined as the proportion of patients who achieve a CR or PR according to RECIST v 1.1 as assessed by the investigator, or meet the SD criteria at least once after start of study treatment at a minimum interval of 12 weeks (-1 week window). Patients who do not have at least 1 post-baseline response assessment are counted as non-responders.
  • DOR is defined as the time from the first documentation of objective response (CR or PR that is subsequently confirmed) to the first documentation of PD or death due to any cause, whichever comes first. DOR is only calculated for patients who achieve a confirmed CR or PR according to RECIST vl .1 as assessed by the investigator.
  • TTR is defined as the time from the start of study treatment to the first
  • TTR is only calculated for patients who achieve a confirmed CR or PR, and is summarized with descriptive statistics.
  • PFS is defined as the time from the start of study treatment to the first documentation of PD or death due to any cause, whichever comes first. Patients who are known to have died and who do not have an evaluation of tumor response after their first dose of study drug are censored at Day 1.
  • OS is defined as the time from the start of study treatment to date of death due to any cause. In the absence of death, survival time will be censored at the last date the patient is known to be alive (i.e., date of last contact).
  • the 2-sided 95% exact confidence interval (Cl) using the Clopper-Pearson method are calculated for the response rates where applicable (e.g., ORR).
  • the median survival time is estimated using the Kaplan-Meier method; the associated 95% Cl is calculated based on the complementary log-log transformation.
  • Patients continue to receive tisotumab vedotin treatment until disease progression, unacceptable toxicity', investigator decision, consent withdrawal, start of a subsequent anticancer therapy, study termination by the sponsor, pregnancy, or death, whichever comes first.
  • Response is assessed every 6 weeks for the first 6 months, every 12 weeks for the next 6 months, and then every 6 months after that.
  • RECIST vl.l is used by the investigator to score responses for primary and secondary endpoints as well as progression. Objective responses are confirmed with repeat scans 4-6 weeks after the first documentation of response. The study is closed 3 years after the last patient enrolled or when no patients remain in long-term follow-up, whichever comes first. Additionally, the sponsor may terminate the study at any time.
  • Biomarker analysis is not to be utilized for patient selection.
  • Biomarker assessments in tumor tissue may include, but are not limited to: measurement of TF protein, mRNA expression, disease subtype, tumor immune microenvironment, and tumor mutational load.
  • Assessments in blood may include, but are not limited to: cancer markers such as CA-125, cytokine measurements, abundance and phenotypes of immune cell subsets, and circulating nucleic acids.
  • Methods of analysis may include immunohistochemistry (IHC), PCR and T-cell receptor beta chain sequencing, multiplex immune histofluoresccnce , mutation and gene expression profiling, Next Generation Sequencing, flow cytometry, and proteomic
  • Safety assessments include the surveillance and recording of AEs, physical examination findings, eye examinations, vital signs, electrocardiograms (ECGs), concomitant medications, pregnancy testing, and laboratory tests. Safety assessments are performed while the patient continues to receive treatment. After discontinuation of study treatment, patients are followed every 12 weeks for subsequent cancer therapies and survival.
  • ECGs electrocardiograms
  • the primary analysis of the study is performed when all treated patients have been followed for at least 6 months or come off study, whichever comes first. Patients enrolled in the safety run-in and phase 2 portions of the study are summarized separately. Safety measurements is summarized by descriptive statistics based on the safety analysis set. The safety analysis set includes all patients who received any amount of study treatment.
  • Subgroup analyses may be conducted for selected endpoints.
  • Subgroups may include but are not limited to the following: platinum-free interval, histology, first line vs. second line PROC, TF expression, prior treatment with checkpoint inhibitors (CPIs) and prior treatment with PARP inhibitors.
  • platinum-free interval platinum-free interval
  • histology histology
  • first line vs. second line PROC TF expression
  • CPIs checkpoint inhibitors
  • PARP inhibitors prior treatment with PARP inhibitors.
  • Adverse events of special interest include ocular adverse events, infusion-related reactions, increased bleeding, hemorrhage, elevated liver enzymes, mucositis, neutropenia, and peripheral neuropathy.
  • ocular pre-medication guidelines are followed: (1) Administration of local ocular vasoconstrictor before infusion (brimonidine tartrate or similar) for a total of 72 hours (3 days) after each infusion. Immediately prior to the start of each infusion, 3 drops must be given in each eye. For the next 2 days 1 drop must be administered in each eye, 3 times daily or they may otherwise be used in accordance with the product prescribing information.
  • steroid eye drops (dexamethasone 0.1% eye drops or equivalent) before and after each infusion for a total of 3 days. The first drops are to be given 24 hours prior to start of infusion. Continue treatment for 48 hours thereafter. Steroid eye drops should be administered as 1 drop in each eye, 3 times daily, or used in accordance with the product prescribing information.
  • Eye cooling pads during infusion e.g., Cardinal Health cold packs, refrigerator-based THERA PEARL Eye Mask, or similar.
  • Lubricating eye drops should be administered according to the product prescribing information. (5) It is recommended that patients not wear contact lenses while being treated with tisotumab vedotin from the first dose until 30 days after the last dose of study drug.
  • Tisotumab vedotin may cause Infusion-Related Reactions including severe hypersensitivity or anaphylaxis. Signs and symptoms usually develop during or shortly after drag infusion. In case any clinical significant IRR is observed during or after the first infusion of tisotumab vedotin or at subsequent treatment cycles, the patient should be observed for 2 hours after the end of tisotumab vedotin administration for all subsequent infusions. At all times during infusion, immediate emergency treatment of an anaphylactic reaction according to institutional standards must be assured. In order to treat possible anaphylactic reactions, for instance, dexamethasone 10 mg and epinephrine in a 1: 1000 dilution or equivalents must always be available along with equipment for assisted ventilation.
  • Example 4 Anti-tumor activity of tisotumab vedotin in xenograft models of ovarian cancer.
  • mice were randomized into groups of 7 mice with equal tumor size distribution and treated with by intraperitoneal injection of tisotumab vedotin (1 or 4 mg/kg), an isotype control antibody (the HIV gp 120-specific human IgGl antibody IgGl-bl2) conjugated with MMAE (IgGl-bl2-MMAE, 4 mg/kg) or an unconjugated isotype control IgGl (IgGl-bl2, 4 mg/kg) diluted in PBS (final volume IOOmI). Treatment was repeated on day 44.
  • an isotype control antibody the HIV gp 120-specific human IgGl antibody IgGl-bl2 conjugated with MMAE (IgGl-bl2-MMAE, 4 mg/kg)
  • MMAE IgGl-bl2-MMAE, 4 mg/kg
  • PBS final volume IOOmI
  • tisotumab vedotin significantly inhibited tumor growth, as demonstrated by reduced tumor size in animals treated with tisotumab vedotin compared to the IgGl-bl2 control (p ⁇ 0.01, Mann-Whitney) but not the isotype control ADC (IgGl-bl2- MMAE) (FIG. 3).
  • mice were randomized and treated intravenously with 4 mg/kg tisotumab vedotin, the isotype control ADC IgGl-bl2-MMAE or the unconjugated isotype control antibody IgGl-b 12 diluted in PBS. The day of randomization and first treatment was designated day 0.
  • Tumor growth was assessed every 3-4 days by two-dimensional measurement with a caliper.
  • Example 5 Anti-tumor activity of tisotumab vedotin in xenograft models of ovarian cancer.
  • the in vivo anti-tumor efficacy of tisotumab vedotin was tested in two xenograft mouse models for ovarian cancer from human ovarian cancer tumor specimens (patient-derived xenograft models CTG-0956 and CTG-1086).
  • Tumors were grown in stock animals until they reached a size of 1.0-1.5 cm 3 , at which point they were harvested and re-implanted into pre-study animals. Pre-study animals were implanted unilaterally on the left flank with tumor fragments harvested from stock animals. Pre-study tumor volumes were recorded for each experiment beginning seven to ten days after implantation. When tumors reached an average tumor volume of 150-300 mm 3 animals were matched by tumor volume into treatment or control groups. Dosing was initiated on Day 0. For each animal model, 8 mice were treated with 2 mg/kg tisotumab vedotin or 2 mg/kg of an isotype control antibody diluted in PBS every 7 days for four doses.
  • mice were weighed twice weekly and mice exhibiting >20% net weight loss for a period of 7 days or exhibiting >30% net weight loss when compared to Day 0 were euthanized.
  • tisotumab vedotin significantly inhibited tumor growth in both the CTG-0956 and CTG-1086 patient-derived xenograft models, as demonstrated by reduced tumor size in animals treated with tisotumab vedotin compared to the isotype control antibody (FIG. 5A and FIG. 6A).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Reproductive Health (AREA)
  • Hematology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2019/046467 2018-08-16 2019-08-14 Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer Ceased WO2020037024A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
CN201980054479.8A CN112584872A (zh) 2018-08-16 2019-08-14 抗组织因子抗体-药物偶联物及其在癌症治疗中的用途
KR1020217007245A KR20210046016A (ko) 2018-08-16 2019-08-14 항-조직 인자 항체-약물 접합체 및 암 치료에서의 그의 용도
CA3109116A CA3109116A1 (en) 2018-08-16 2019-08-14 Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
SG11202101428UA SG11202101428UA (en) 2018-08-16 2019-08-14 Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
US17/268,387 US20210308208A1 (en) 2018-08-16 2019-08-14 Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
EP19849100.3A EP3836950A4 (en) 2018-08-16 2019-08-14 ANTI-TISSUE FACTOR ANTIBODY-DRUG CONJUGATES AND THEIR USE IN THE TREATMENT OF CANCER
EA202190102A EA202190102A1 (ru) 2018-08-16 2019-08-14 Коньюгаты антител к тканевым факторам с лекарственным средством и их применение в лечении рака
AU2019321442A AU2019321442A1 (en) 2018-08-16 2019-08-14 Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
BR112021001691-0A BR112021001691A2 (pt) 2018-08-16 2019-08-14 método de tratamento de câncer de ovário, câncer peritoneal ou câncer de trompa de falópio, e, kit
MX2021001058A MX2021001058A (es) 2018-08-16 2019-08-14 Conjugados de anticuerpo anti-factor tisular-farmaco y su uso en el tratamiento de un cancer.
JP2021507775A JP2021534165A (ja) 2018-08-16 2019-08-14 抗組織因子抗体−薬物コンジュゲートおよびがんの治療におけるその使用
IL280617A IL280617A (en) 2018-08-16 2021-02-03 Antibody-drug conjugates against tissue factor and their use for cancer treatment

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862765093P 2018-08-16 2018-08-16
US62/765,093 2018-08-16

Publications (1)

Publication Number Publication Date
WO2020037024A1 true WO2020037024A1 (en) 2020-02-20

Family

ID=69525825

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/046467 Ceased WO2020037024A1 (en) 2018-08-16 2019-08-14 Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer

Country Status (13)

Country Link
US (1) US20210308208A1 (enExample)
EP (1) EP3836950A4 (enExample)
JP (1) JP2021534165A (enExample)
KR (1) KR20210046016A (enExample)
CN (1) CN112584872A (enExample)
AU (1) AU2019321442A1 (enExample)
BR (1) BR112021001691A2 (enExample)
CA (1) CA3109116A1 (enExample)
EA (1) EA202190102A1 (enExample)
IL (1) IL280617A (enExample)
MX (1) MX2021001058A (enExample)
SG (1) SG11202101428UA (enExample)
WO (1) WO2020037024A1 (enExample)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3919077A1 (en) 2020-06-04 2021-12-08 BioInvent International AB Model for prediction of tolerability issues in connection with intravenous administration of therapeutic antibodies
WO2021245237A1 (en) 2020-06-04 2021-12-09 Bioinvent International Ab Model for prediction of tolerability issues in connection with intravenous administration of therapeutic antibodies
EP4130036A4 (en) * 2020-03-30 2024-05-15 National Cancer Center Antibody drug conjugate
US12036286B2 (en) 2021-03-18 2024-07-16 Seagen Inc. Selective drug release from internalized conjugates of biologically active compounds
US12246025B2 (en) 2018-03-21 2025-03-11 Genmab A/S Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate
US12324841B2 (en) 2018-05-07 2025-06-10 Genmab A/S Methods of treating cancer with a combination of an anti-PD-1 antibody and an anti-tissue factor antibody-drug conjugate
US12453781B2 (en) 2018-10-30 2025-10-28 Genmab A/S Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110300156A1 (en) * 2008-12-09 2011-12-08 Genmab A/S Human antibodies against tissue factor
US20160279258A1 (en) * 2013-11-21 2016-09-29 Genmab A/S Antibody-drug conjugate lyophilised formulation
US9492565B2 (en) * 2010-06-15 2016-11-15 Genmab A/S Human antibody drug conjugates against tissue factor
WO2017042352A1 (en) * 2015-09-11 2017-03-16 Genmab A/S Dosing regimens for anti-tf-antibody drug-conjugates
US20170080103A1 (en) * 2014-05-22 2017-03-23 Synthon Biopharmaceutical B.V. Site-specific conjugation of linker drugs to antibodies and resulting adcs
WO2019089973A1 (en) * 2017-11-02 2019-05-09 Genmab A/S Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019136309A1 (en) * 2018-01-04 2019-07-11 Iconic Therapeutics, Inc. Anti-tissue factor antibodies, antibody-drug conjugates, and related methods

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110300156A1 (en) * 2008-12-09 2011-12-08 Genmab A/S Human antibodies against tissue factor
US9492565B2 (en) * 2010-06-15 2016-11-15 Genmab A/S Human antibody drug conjugates against tissue factor
US20160279258A1 (en) * 2013-11-21 2016-09-29 Genmab A/S Antibody-drug conjugate lyophilised formulation
US20170080103A1 (en) * 2014-05-22 2017-03-23 Synthon Biopharmaceutical B.V. Site-specific conjugation of linker drugs to antibodies and resulting adcs
WO2017042352A1 (en) * 2015-09-11 2017-03-16 Genmab A/S Dosing regimens for anti-tf-antibody drug-conjugates
WO2019089973A1 (en) * 2017-11-02 2019-05-09 Genmab A/S Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3836950A4 *

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12246025B2 (en) 2018-03-21 2025-03-11 Genmab A/S Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate
US12324841B2 (en) 2018-05-07 2025-06-10 Genmab A/S Methods of treating cancer with a combination of an anti-PD-1 antibody and an anti-tissue factor antibody-drug conjugate
US12453781B2 (en) 2018-10-30 2025-10-28 Genmab A/S Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate
EP4130036A4 (en) * 2020-03-30 2024-05-15 National Cancer Center Antibody drug conjugate
EP3919077A1 (en) 2020-06-04 2021-12-08 BioInvent International AB Model for prediction of tolerability issues in connection with intravenous administration of therapeutic antibodies
WO2021245237A1 (en) 2020-06-04 2021-12-09 Bioinvent International Ab Model for prediction of tolerability issues in connection with intravenous administration of therapeutic antibodies
WO2021245238A1 (en) 2020-06-04 2021-12-09 Bioinvent International Ab Improving antibody tolerability associated with intravenous administration
WO2021245233A1 (en) 2020-06-04 2021-12-09 Bioinvent International Ab Improving antibody tolerabilty associated with intravenous administration
US12036286B2 (en) 2021-03-18 2024-07-16 Seagen Inc. Selective drug release from internalized conjugates of biologically active compounds

Also Published As

Publication number Publication date
CN112584872A (zh) 2021-03-30
SG11202101428UA (en) 2021-03-30
CA3109116A1 (en) 2020-02-20
EA202190102A1 (ru) 2021-07-29
EP3836950A1 (en) 2021-06-23
IL280617A (en) 2021-03-25
JP2021534165A (ja) 2021-12-09
BR112021001691A2 (pt) 2021-05-04
AU2019321442A1 (en) 2021-02-11
MX2021001058A (es) 2021-04-12
KR20210046016A (ko) 2021-04-27
EP3836950A4 (en) 2022-04-06
US20210308208A1 (en) 2021-10-07

Similar Documents

Publication Publication Date Title
US20240252673A1 (en) Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
US12246025B2 (en) Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate
AU2019231696B2 (en) Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
US12453781B2 (en) Methods of treating cancer with a combination of an anti-VEGF antibody and an anti-tissue factor antibody-drug conjugate
US20210308208A1 (en) Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
US20220387485A1 (en) Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate
HK40051932A (en) Anti-tissue factor antibody-drug conjugates and their use in the treatment of cancer
EA049124B1 (ru) Способы лечения рака с помощью комбинации антитела против vegf и конъюгата антитело против тканевого фактора-лекарственное средство
EA046283B1 (ru) Способы лечения рака с помощью комбинации средства на основе платины и конъюгата антитела к тканевому фактору с лекарственным средством
EA048671B1 (ru) Конъюгаты антител к тканевому фактору с лекарственными средствами и их применение при лечении рака
EA048942B1 (ru) Конъюгаты антитела к тканевому фактору и лекарственного средства и их применение в лечении рака

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3109116

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021001691

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019321442

Country of ref document: AU

Date of ref document: 20190814

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021507775

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20217007245

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019849100

Country of ref document: EP

Effective date: 20210316

ENP Entry into the national phase

Ref document number: 112021001691

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210129

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19849100

Country of ref document: EP

Kind code of ref document: A1

WWW Wipo information: withdrawn in national office

Ref document number: 202190102

Country of ref document: EA

WWW Wipo information: withdrawn in national office

Ref document number: 280617

Country of ref document: IL