WO2019219933A1 - An engineered combinatorial module of transcription factors to boost production of monoterpenoid indole alkaloids - Google Patents
An engineered combinatorial module of transcription factors to boost production of monoterpenoid indole alkaloids Download PDFInfo
- Publication number
- WO2019219933A1 WO2019219933A1 PCT/EP2019/062848 EP2019062848W WO2019219933A1 WO 2019219933 A1 WO2019219933 A1 WO 2019219933A1 EP 2019062848 W EP2019062848 W EP 2019062848W WO 2019219933 A1 WO2019219933 A1 WO 2019219933A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- orca3
- seq
- myc2
- bis1
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
- C12N15/8243—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
Definitions
- the present invention relates to the field of plant secondary metabolites with agricultural, pharmacological or other industrial properties, more particularly to methods of increasing the activity of specific plant secondary metabolites. Even more particularly the present invention relates to the identification of a combination of transcription factors that enhances the production of monoterpenoid indole alkaloids.
- MIAs monoterpenoid indole alkaloids
- MIA biosynthesis is regulated by the plant hormone jasmonate (JA) and serves predominantly a defensive role against insects and pathogens (De Geyter et al., 2012; Duge de Bernonville et al., 2017; Goossens et al., 2017; Roepke et al., 2010; Wasternack and Buy, 2013; Zhang et al., 2011; Zhou and Memelink, 2016).
- JA plant hormone jasmonate
- JAZ JASMONATE-ZIM DOMAIN
- TFs such as MYC2 are de-repressed, leading to transcriptional activation of their target genes (Chini et al., 2016; Goossens et al., 2017; Wasternack and Strnad, 2018; Zhou and Memelink, 2016).
- JAZ Interaction Domain JID
- Arabidopsis thaliana MYC2 Arabidopsis thaliana MYC2
- AtMYC2D105N constitutively active form
- MIA biosynthesis in C. roseus organs involves several other TFs.
- IPAP-specific MIA biosynthesis genes is controlled by the BASIC HELIX-LOOP-HELIX IRIDOID SYNTHESIS (BIS) 1 and BIS2 TFs (Fig. 1A) (Van Moerkercke et al., 2016; Van Moerkercke et al., 2015).
- the expression of the epidermis-specific genes steering the following steps leading to strictosidine is controlled by the clade of the OCTADECANOID DERIVATIVE RESPONSIVE CATHARANTHUS APETALA2- DOMAIN (ORCA) 2, ORCA3, ORCA4, and ORCA5 TFs (Menke et al., 1999; Paul et al., 2017; van der Fits and Memelink, 2000; Zhou and Memelink, 2016).
- the expression of the BIS TFs as well as the ORCA TFs can be stimulated by JAs (Paul et al., 2017; Van Moerkercke et al., 2016; Van Moerkercke et al., 2015; Zhang et al., 2011).
- the medicinal plant Catharanthus roseus (Madagascar periwinkle) produces over 130 monoterpenoid indole alkaloids (MIAs), including the anticancer compounds vinblastine and vincristine (Fig. 1A) (van der Heijden et al., 2004).
- MIAs monoterpenoid indole alkaloids
- Fig. 1A vincristine
- Developing alternatives such as biotechnology-based production methods in hairy root, suspension cell or yeast cultures has been a longstanding research subject (Facchini and De Luca, 2008; O'Connor, 2015; van der Heijden et al., 2004).
- Some precursors of vinblastine have been produced successfully in heterologous systems, including the MIA precursor strictosidine in yeast and tobacco (Brown et al., 2015; Montgomeryn et al., 2014) and vindoline in yeast after feeding with the precursor tabersonine (Qu et al., 2015).
- MIA precursor strictosidine in yeast and tobacco Bostinen et al., 2014
- vindoline in yeast after feeding with the precursor tabersonine
- yields of current approaches are suboptimal and thus it would be advantageous to find alternative strategies to boost the production of MIAs, more particular the anticancer compounds vinblastine and vincristine.
- Applicant made use of a flower petal transformation method in the medicinal plant Catharanthus roseus to shed light on the complex regulatory mechanisms steering the jasmonate-modulated biosynthesis of monoterpenoid indole alkaloids (MIAs), to which the anti-cancer compounds vinblastine and vincristine belong.
- MIAs monoterpenoid indole alkaloids
- BIS1, ORCA3 and MYC2a By combinatorial overexpression of the transcriptional activators BIS1, ORCA3 and MYC2a, an unprecedented insight into the modular transcriptional control of MIA biosynthesis is provided. Furthermore, it is shown that the expression of an engineered de-repressed MYC2a triggers a tremendous reprogramming of the MIA pathway, finally leading to massively increased accumulation of at least 23 MIAs.
- a first object of the application is a Catharanthus roseus MYC2 protein with a D to N mutation at a position relative to position 126 of SEQ ID No. 1.
- said MYC2 protein further comprises a JAZ interacting domain comprising SEQ ID No 7 and/or SEQ ID No. 8.
- said MYC2 protein has at least 90% homology to SEQ ID No. 1.
- a mutant Catharanthus roseus MYC2a protein as depicted in SEQ ID No. 2 is provided. It is also an object of the application to provide a nucleic acid molecule encoding one of the above MYC2 or MYC2a proteins.
- a third object of the application is a plant cell expressing the above described nucleic acid molecule or comprising one of the MYC2 or MYC2a proteins described.
- said plant cell further expresses the transcriptional activators BIS1 and ORCA3.
- the expression level of BIS1 and ORCA3 in said plant cell is at least 10% higher than the expression level of BIS1 and ORCA3 in a control plant cell.
- a fourth object of the application is a regulatory module comprising one of the MYC2 or MYC2a proteins described above, further comprising the transcription factors BIS1 and ORCA3, wherein said BIS1 and ORCA3 transcription factors are transcriptionally controlled by promoters different to the promoters to which they are naturally linked.
- a fifth object of the application is the use of one of the described MYC2 or MYC2a proteins or the use of the described nucleic acid molecule or the use of the described regulatory module to enhance the production of at least one monoterpenoid indole alkaloid in a plant cell with at least 10% compared to a control plant cell.
- said at least one monoterpenoid indolalkaloid is a 16- hydroxytabersonine-derived MIA and/or 19-hydroxytabersonine-derived MIA.
- said at least one MIA is selected from the list consisting of strictosidine, catharanthine, 16-hydroxytabersonine, 16-methoxylhorhammericine, horhammericine, serpentine, vindoline, vinblastine, akuammicine, isositsirikine, 16-methoxytabersonine, 3-hydroxy-16-methoxy-2,3- dihydrotabersonine, 19-hydroxytabersonine, 16-hydroxyhorhammericine, minovincinine, vincadifformine, 16-hydroxyvincadifformine, 16-hydroxy-19-0-acetyltabersonine, perivine and O- acetylstemmadine.
- a sixth object of the application is a method of producing monoterpenoid indole alkaloids, said method comprising expressing one of the MYC2 or MYC2a proteins described in this specification in a plant cell; optionally further expressing the BIS1 and/or ORCA3 transcription factors; and selecting plant cells with increased production of at least one monoterpenoid indole alkaloid compared to control plant cells not expressing one of said MYC2 of MYC2a proteins.
- MIA biosynthesis in C. rose us is regulated by CrMYC2a, BIS1 and ORCA3.
- A Pathway leading to the production of shoot-specific MIAs in C. roseus.
- B Pathway leading to the root-specific MIAs.
- Genes regulated by CrMYC2a, BIS1 and ORCA are boxed in orange, blue and green, respectively. Genes not regulated by any of these TFS are boxed in yellow.
- FIG. 2 Y2H assays to assess interaction between C. roseus JAZ and bHLH proteins.
- Transformed yeasts were spotted in 10-fold and 100- fold dilutions on control medium (-2) or selective medium (-3). Empty vectors were used as the negative control, whereas a clone with the BIS2-ACT domain was used as the positive control.
- FIG. 3 De-repressed CrMYC2aD126N transactivates the promoters of BIS1, ORCA3 and MIA biosynthesis genes.
- A De-repressed CrMYC2aD126N and AtMYC2D105N can transactivate pBISl, pORCA3 and pSTR in transient expression assays in N. tabacum protoplasts.
- the y-axis shows fold change in normalized fLUC activity relative to the control transfection with GUS.
- Statistical significance was determined by the Student's t test (* P ⁇ 0.05, **P ⁇ 0.01, *** P ⁇ 0.001).
- FIG. 4 Phylogenetic tree of A. thaliana and C. roseus bHLH proteins showing the relationship between clade III, clade IV and previously published MYC proteins. Arabidopsis bHLH proteins were used as bait to screen for clade III orthologs within the C. roseus transcriptome (http://bioinformatics.psb.ugent.be/orcae/overview/SmartCell). A neighbor-joining tree was constructed in MEGA6 based on an alignment of the full-length proteins (Tamura et al., 2013). Bootstrap analyses were performed with 1,000 bootstrap replicates. The tree was rooted on to the branch containing clade XII, IX, VI lb bHLH TFs.
- FIG. 1 Amino acid alignment showing conservation of aspartate in the JID domain. ClustalW multiple alignment of the JAZ interacting domain (JID) within C. roseus and A. thaliana MYC2 homologs. Red box indicates the mutated aspartate (D) in the de-repressed MYC2 homologs.
- FIG. 6 Expression of MIA pathway genes and metabolite profiling of C. roseus flower petals transiently overexpressing GUS, CrMYC2a, CrMYC2aD126N, AtMYC2 or AtMYCD105N under the CaMV35S promoter.
- A Expression of transcription factors, MIA pathway genes and transporters was measured by qPCR and represented in fold change compared to control samples (infiltrated with pCaMV35S::GUS constructs).
- B High abundant MIAs were measured on LC-ESI-FT-ICR-MS and expressed in average total ion current (TIC).
- D PCA plot and PC loading plot derived from LC-ESI-FT-ICR- MS metabolome data of flower petals transiently overexpressing GUS, MYC2aD126N, ORCA3, BIS1 or the combination of MYC2aD126N, ORCA3 and BIS1.
- FIG. 8 Analysis of TF amplification loops in the regulation of C. roseus MIA biosynthesis.
- Expression profile of TFs in C. roseus flower petals transiently overexpressing the combination of CrMYC2aD126N, BIS1 and ORCA3.
- FIG. 9 A simplified model illustrating the complex transcriptional regulation of the iridoid and MIA pathway.
- JAZ repressors bind the JID domain of CrMYC2a and thereby inhibit its transcriptional activity.
- JAZ proteins Upon insect feeding, wounding or JA elicitation, JAZ proteins are degraded, leading to the de-repression of CrMYC2a and consequently direct induction of the whole MIA pathway.
- active CrMYC2a induces expression of BIS and ORCA TFs, inserting a second amplification layer in the induction of the MIA pathway.
- BIS1 induces an amplification loop via BIS2, whereas ORCA3 seems to be controlled by an auto-amplification loop and potential cross-amplification loops involving other ORCA3 homologs.
- active CrMYC2a induces transcription of JAZ repressors, as in other plant species, resulting in de novo repression of CrMYC2a activity, followed by subsequent downregulation of BIS TFs, ORCA TFs and MIA pathway genes.
- the constitutive de-repression due to the D126N amino acid change in CrMYC2a the negative feedback loop of JAZ is disrupted, resulting in high transcript levels of BIS1, BIS2, ORCA3 and MIA genes.
- the whole regulatory mechanism is therefore in a free running state leading to a constant high expression of the MIA pathway genes, resulting in higher accumulation of MIAs.
- GPP geranyl diphosphate.
- a combinatorial module has been designed of 'wild-type' and engineered, i.e. gain-of-function mutant, versions of three C. roseus transcription factors (TFs) that together boost MIA biosynthesis in a coordinated manner across cell types.
- TFs C. roseus transcription factors
- Some of these MIAs have highly interesting activities on their own or are base molecules (e.g. strictosidine) for numerous pharmaceutically valuable metabolites including quinine, camptothecin, ajmalicine, serpentine, vinblastine and vincristine.
- MIA biosynthesis in C. roseus is organ and cell-type specific and compartmentalized at the cellular and subcellular level (Courdavault et al., 2014; Duge de Bernonville et al., 2015).
- bisindole alkaloids such as vinblastine and vincristine, as well as vindoline are produced exclusively in the areal parts of the plant, whereas catharanthine accumulates in all organs (Pan et al., 2016; van der Heijden et al., 2004).
- MIAs such as ajmalicine, serpentine and the tabersonine-derived MIAs horhammericine, lochnericine and 19-hydroxytabersonine are mostly present in roots (Laflamme et al., 2001; Pan et al., 2016; Rodriguez et al., 2003; van der Heijden et al., 2004).
- the first seven biosynthesis steps from geranyl diphosphate (GPP) to the iridoid loganic acid take place in internal phloem associated parenchyma (IPAP) cells and involve GERANIOL SYNTHASE (GES), 8- HYDROXYGE ANIOL OXIDOREDUCTASE (8HGO), GERANIOL 8-OXIDASE (G80), IRIDOID SYNTHASE (IS), IRIDOID OXIDASE (10), 7-DEOXYLOGANETIC ACID GLUCOSYLTRANSFERASE (7DLGT) and 7- DEOXYLOGANIC ACID HYDROXYLASE (7DLH) (Asada et al., 2013; Geu-Flores et al., 2012; Montgomeryn et al., 2014; Salim et al., 2014; Simkin et al., 2013).
- LAMT LogANIC ACID O- METHYLTRANSFERASE
- SCS SECOLOGANIN SYNTHASE
- TDC TRYPTOPHAN DECARBOXYLASE
- STR STRICTOSIDINE SYNTHASE
- NPF transporters (NPF2.4, NPF2.5, NPF2.6) (Larsen et al., 2017).
- strictosidine is exported from the epidermal vacuole by NPF2.9 (Payne et al., 2017), transported to the nucleus via a yet unknown mechanism and subsequently deglucosylated by STRICTOSIDINE B-GLUCOSIDASE (SGD), resulting in a highly reactive aglycone that can be converted to (i) the corynanthe-type ajmalicine or tetrahydroalstonine by HETEROYOHIMBINE SYNTHASE (HYS) or TETRAHYDROALSTONINE SYNTHASE (THAS), respectively, or (ii) vindoline or catharanthine by the action of multiple enzymes (Courdavault et al., 2014; Stavrinides et al., 2016) (Fig.
- the monomeric MIAs vindoline and catharanthine can dimerize to form 3',4'-anhydrovinblastine, the direct precursor of vinblastine and vincristine (van der Heijden et al., 2004).
- a Catharanthus roseus MYC2 protein is provided. More particularly said MYC2 protein has a D to N mutation at a position relative to position 126 of SEQ ID No. 1. Even more particularly, said MYC2 protein has a D to N mutation at position 126 of SEQ ID No. 1.
- polypeptide As used herein, the terms “polypeptide”, “protein, “peptide” are used interchangeably and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
- a "position relative to position 126" as used herein refers to the precise location of the D (aspartic acid) in the original sequence SEQ ID No. 1.
- the upstream amino acid sequence could be modified (e.g. by adding one or more amino acids to the N-terminal part of said MYC2) without losing the characteristics of the depressed MYC2 protein.
- position 126 does not refer anymore to the crucial D.
- said MYC2 protein further comprises a JAZ interacting domain comprising SEQ ID No 7 (VLGWGNGYYKGEEDK) and/or SEQ ID No. 8 (WTYAIFWQXS, wherein X is S or P).
- said MYC2 protein comprises a JAZ interacting domain consisting of SEQ ID No 7 (VLGWGNGYYKGEEDK) and/or SEQ ID No. 8 (WTYAIFWQXS, wherein X is S or P).
- said MYC2 protein comprises a JAZ interacting domain comprising WTYAIFWQXSXXXFXGXS (SEQ ID No.
- said MYC2 protein comprises a JAZ interacting domain comprising SEQ ID No 7 (VLGWGNGYYKGEEDK) and WTYAIFWQXSXXXFXGXS (SEQ ID No. 9), wherein X can be every amino acid or a gap.
- said MYC2 protein comprises a JAZ interacting domain comprising or consisting of SEQ ID No. 10 (WTYAIFWQSSVVEFAGPSVLGWGNGYYKGEEDK).
- JAZ interacting domain of "JID” as used herein is well-known by the skilled person as a conserved amino acid domain which is essential for interaction with JAZ proteins (Fernandez-Calvo et al., 2011 Plant Cell 23: 701-715).
- said MYC2 protein has at least 90%; at least 91%; at least 92%; at least 93%; at least 94%; at least 95%; at least 96%; at least 97%; at least 98%; at least 99% or at least 99.5% homology to SEQ ID No. 1.
- Flomologs of a protein encompass peptides, oligopeptides and polypeptides having amino acid substitutions, deletions and/or insertions, preferably by a conservative change, relative to the unmodified protein in question and having similar biological and functional activity as the unmodified protein from which they are derived; or in other words, without significant loss of function or activity.
- Orthologs and paralogs which are well-known terms by the skilled person, define subcategories of homologs and encompass evolutionary concepts used to describe the ancestral relationships of genes. Paralogs are genes within the same species that have originated through duplication of an ancestral gene; orthologs are genes from different organisms that have originated through speciation, and are also derived from a common ancestral gene.
- the "homology” or "sequence identity" of two related nucleotide or amino acid sequences refers to the number of positions in the two optimally aligned sequences which have identical residues (xlOO) divided by the number of positions compared.
- a gap i.e., a position in an alignment where a residue is present in one sequence but not in the other is regarded as a position with non-identical residues.
- the alignment of the two sequences is performed by the Needleman and Wunsch algorithm (Needleman and Wunsch (1970) J Mol Biol. 48: 443-453).
- sequence alignment can be conveniently performed using standard software program such as GAP which is part of the Wisconsin Package Version 10.1 (Genetics Computer Group, Madison, Wisconsin, USA) using the default scoring matrix with a gap creation penalty of 50 and a gap extension penalty of 3. Sequences are indicated as "essentially similar" when such sequences have a sequence identity of at least about 75%, particularly at least about 80 %, more particularly at least about 85%, quite particularly about 90%, especially about 95%, more especially about 100%, quite especially are identical.
- said MYC2 protein from the invention is a MYC2a protein, more particularly a mutant MYC2a protein, even more particularly a mutant Catharanthus roseus MYC2a protein, most particularly the mutant Catharanthus roseus MYC2a protein as depicted in SEQ ID No. 2.
- the above described MYC2 or MYC2a proteins are recombinantly produced proteins.
- a "recombinantly produced protein" refers to a protein produced by recombinant methods, e.g. recombinant DNA technology.
- recombinant means with regard to, for example, a protein, a nucleic acid sequence, a chimeric gene construct or a vector comprising said nucleic acid sequence or a cell transformed with the said nucleic acid sequences, chimeric gene constructs or vectors, all those constructions brought about by recombinant methods in which either (a) the nucleic acid sequences encoding proteins useful in the methods of the invention, or (b) genetic control sequence(s) which is operably linked with the nucleic acid sequence according to the invention, for example a promoter, or (c) a) and b) are not located in their natural genetic environment or have been modified by recombinant methods, it being possible for the modification to take the form of, for example, a substitution, addition, deletion, inversion or insertion of one or more nucleotide residues.
- the natural genetic environment is understood as meaning the natural genomic or chromosomal locus in the original plant or the presence in a genomic library.
- the natural genetic environment of the nucleic acid sequence is preferably retained, at least in part.
- the environment flanks the nucleic acid sequence at least on one side and has a sequence length of at least 50 bp, preferably at least 500 bp, especially preferably at least 1000 bp, most preferably at least 5000 bp.
- a naturally occurring expression cassette for example the naturally occurring combination of the natural promoter of the nucleic acid sequences with the corresponding nucleic acid sequence encoding one of the MYC2 or MYC2 proteins described in this specification - becomes a transgenic expression cassette when this expression cassette is modified by non-natural, synthetic ("artificial") methods such as, for example, mutagenic treatment. Suitable methods are described, for example, in US 5,565,350 or WO 00/15815.
- said recombinantly produced protein is a man-made or non-naturally occurring fusion protein.
- nucleic acid molecule is provided encoding any of the MYC2 or MYC2a proteins described in the first aspect of this specification.
- nucleic acid polynucleotide
- polynucleic acid are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown.
- Non-limiting examples of polynucleotides include a gene, a gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, control regions, isolated RNA of any sequence, nucleic acid probes, and primers.
- the polynucleotide molecule may be linear or circular.
- the polynucleotide may comprise a promoter, an intron, an enhancer region, a polyadenylation site, a translation initiation site, 5' or 3' untranslated regions, a reporter gene, a selectable marker or the like.
- the polynucleotide may comprise single stranded or double stranded DNA or RNA.
- the polynucleotide may comprise modified bases or a modified backbone.
- a nucleic acid that is up to about 100 nucleotides in length, is often also referred to as an oligonucleotide.
- said nucleic acid molecule must be linked operably to or comprise a suitable promoter which expresses said nucleic acid molecule at the right point in time and with the required spatial expression pattern.
- operably linked refers to a linkage in which the promoter or regulatory sequence is contiguous with the gene of interest to control the gene of interest (i.e. initiate the transcription of the gene of interest), as well as a promoter that act in trans or at a distance to control the gene of interest.
- a DNA sequence is operably linked to a promoter when it is ligated to the promoter downstream with respect to the transcription initiation site of the promoter and allows transcription elongation to proceed through the DNA sequence.
- Linkage of DNA sequences to regulatory sequences is typically accomplished by ligation at suitable restriction sites or adapters or linkers inserted instead of using restriction endonucleases known to one of skill in the art.
- a promoter that enables the initiation of gene transcription in a host cell is referred to as being "active".
- the promoter can be operably linked to a reporter gene after which the expression level and pattern of the reporter gene can be assayed.
- Suitable well- known reporter genes include for example beta-glucuronidase, beta-galactosidase or any fluorescent or luminescent protein.
- promoter activity refers to the extent of transcription of a polynucleotide sequence, homologue, variant or fragment thereof that is operably linked to the promoter whose promoter activity is being measured.
- the promoter activity is assayed by measuring the enzymatic activity of the beta-glucuronidase or beta-galactosidase.
- promoter strength may also be assayed by quantifying mRNA levels or by comparing mRNA levels of the nucleic acid, with mRNA levels of housekeeping genes such as 18S rRNA, using methods known in the art, such as Northern blotting with densitometric analysis of autoradiograms, quantitative real-time PCR or RT-PCR (Heid et al., 1996 Genome Methods 6: 986-994).
- the promoter linked to the nucleic acid molecule of interest can be the endogenous promoter of said nucleic acid molecule, i.e. the promoter that regulates expression of said nucleic acid molecule as found in nature.
- the promoter can be an exogenous promoter, i.e. a regulatory nucleic acid sequence which differs from the sequence to which said nucleic acid molecule is associated in nature.
- a chimeric gene is provided in this application, wherein said chimeric gene is a recombinant nucleic acid sequence comprising one of the nucleic acid molecules disclosed in this specification and a promoter or regulatory nucleic acid sequence, wherein said promoter or regulatory nucleic acid sequence of the chimeric gene is not operably linked to the said nucleic acid sequence as found in nature.
- said promoter or regulatory nucleic acid sequence to which the nucleic acid molecule is operably linked differs from the promoter or regulatory nucleic acid sequence operably linked or associated with said nucleic acid molecule in the natural environment.
- a non-limiting example of an exogenous promoter for expression of a gene of interest in plants is the 35S promoter.
- the "35S promoter” or the “cauliflower mosaic virus (CaMV) 35S promoter” is a constitutive or constant active promoter that directs high-level expression in a wide range of cells under a wide range of conditions and in most plant tissues including monocots.
- Examples of other constitutive plant promoters useful for expressing heterologous, modified or non-modified polypeptides in plant cells include, but are not limited to, the nopaline synthase promoter and the octopine synthase promoter.
- the "AOX promoter” or “AOX1 promoter” or “inducible AOX1 promoter” that originates from Pichia pastoris can be used.
- the alcohol oxidase AOX1 and AOX2 promoters are strongly inducible by methanol and are repressed by e.g. glucose. These genes allow Pichia to use methanol as a carbon and energy source.
- the gene for the desired protein is introduced under the control of the AOX1 promoter, which means that protein production can be induced by the addition of methanol.
- said chimeric gene comprising a nucleic acid molecule encoding for one of the MYC2 or MYC2a proteins described in this specification operably linked to an endogenous or exogenous promoter, further comprises a 3' polyadenylation and/or transcript termination region.
- 3' polyadenylation and transcript termination region refers a 3' end region involved in transcription termination or polyadenylation and encompasses a control sequence which is a DNA sequence at the end of a transcriptional unit which signals 3’ processing or polyadenylation of a primary transcript and is involved in termination of transcription.
- the control sequence for transcription termination or terminator can be derived from a natural gene or from a variety of genes.
- the 3’ end sequence to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic or viral gene.
- the terminator to be added may be derived from, for example, the TEF or CYC1 genes or alternatively from another yeast gene or less preferably from any other eukaryotic or viral gene.
- a vector comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins disclosed in this specification or a chimeric gene comprising said nucleic acid molecule also forms part of the present invention. Therefore, in a particular embodiment, a vector is provided comprising a nucleic acid molecule encoding any of the MYC2 or MYC2a proteins described in the first aspect of this specification or comprising a chimeric gene comprising said nucleic acid molecule.
- vector as used herein is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid molecule to which it has been linked.
- the vector may be of any suitable type including, but not limited to, a phage, virus, plasmid, phagemid, cosmid, bacmid or even an artificial chromosome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., vectors having an origin of replication which functions in the host cell).
- Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and are thereby replicated along with the host genome.
- the markers may a) code for protection against a biocide, such as antibiotics, toxins, heavy metals, certain sugars or the like; b) provide complementation, by imparting prototrophy to an auxotrophic host: or c) provide a visible phenotype through the production of a novel compound in the plant.
- a biocide such as antibiotics, toxins, heavy metals, certain sugars or the like
- genes which may be employed include neomycin phosphotransferase (NPTII), hygromycin phosphotransferase (FIPT), chloramphenicol acetyltransferase (CAT), nitrilase, and the gentamicin resistance gene.
- NPTII neomycin phosphotransferase
- FIPT hygromycin phosphotransferase
- CAT chloramphenicol acetyltransferase
- nitrilase gentamicin resistance gene.
- suitable markers are b-glucuronidase, providing indigo production, luciferase, providing visible light production, Green Fluorescent Protein and variants thereof, NPTII, providing kanamycin resistance or G418 resistance, FIPT, providing hygromycin resistance, and the mutated aroA gene, providing glyphosate resistance.
- certain preferred vectors are capable of directing the expression of certain genes of interest.
- Such vectors are referred to herein as “recombinant expression vectors” (or simply, “expression vectors”).
- Suitable vectors have regulatory sequences, such as promoters, enhancers, terminator sequences, and the like as desired and according to a particular host organism (e.g. plant cell).
- a recombinant vector according to the present invention comprises at least one "chimeric gene" or "expression cassette".
- Expression cassettes are generally DNA constructs preferably including (5' to 3' in the direction of transcription): a promoter region, a polynucleotide sequence, homologue, variant or fragment thereof of the present invention operably linked with the transcription initiation region, and a termination sequence including a stop signal for RNA polymerase and a polyadenylation signal. It is understood that all of these regions should be capable of operating in biological cells, such as plant cells, to be transformed.
- the promoter region comprising the transcription initiation region, which preferably includes the RNA polymerase binding site, and the polyadenylation signal may be native to the biological cell to be transformed or may be derived from an alternative source, where the region is functional in the biological cell.
- host cells comprising one of the MYC2 or MYC2a proteins disclosed in this specification or comprising a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or comprising a chimeric gene comprising said nucleic acid molecule or comprising a vector comprising said nucleic acid molecule or said chimeric gene form part of the present invention. Therefore, in other particular embodiments, host cells are provided comprising any of the MYC2 or MYC2a proteins described in the first aspect of this specification of comprising a nucleic acid sequence encoding said MYC2 or MYC2a protein.
- said host cell is a eukaryotic cell.
- Eukaryotic cells provided in this application can be of any unicellular or multicellular eukaryotic organism, but in particular embodiments yeast, plant, and algal cells are envisaged, in most particular embodiments, plant cells are envisaged.
- the nature of the cells used will typically depend on the ease and cost of producing monoterpenoid indole alkaloids (MIAs). It is clear for the skilled person that when using non-plant host cells the necessary molecular framework to produce plant-derived MIAs should be introduced or engineered in said non plant host cells. Therefore, in a preferred embodiment, said host cell is a plant cell.
- plant refers to vascular plants (e.g.
- a "plant cell” is understood, according to the invention, as being any cell which is derived from or found in a plant and which is able to form or is part of undifferentiated tissues, such as calli or cell cultures, differentiated tissues such as embryos, parts of plants, plants or seeds.
- MYC2 or MYC2a proteins described in this specification or the triple transcription factor cassette would not work well in other MIA-producing plants, for example to stimulate the production of valuable compounds such as reserpine in Rauwolfia serpentina, camptothecin in Camptotheca acuminata or quinine in Cinchona officinalis (Aerts et al., 1994; Deepthi and Satheeshkumar, 2017; Gundlach et al., 1992; Song and Byun, 1998).
- Plants that are particularly suitable for the production of MIAs are plants from the genus selected from the group consisting of Catharanthus, Medicago, Rauwolfia, Camptothecal, Cinchona, Arabidopsis and Nicotiana. Plants or plant cells that are also relevant to this application include, but are not limited to, plants or plant cells of agronomically important crops which are or are not intended for animal or human nutrition, such as maize or corn, wheat, barley, oat, Brassica spp.
- plants such as Brassica napus or Brassica juncea, soybean, bean, alfalfa, pea, rice, sugarcane, beetroot, tobacco, sunflower, cotton, vegetable plants such as cucumber, leek, carrot, tomato, lettuce, peppers, melon, watermelon, diverse herbs such as oregano, basilicum and mint. It may also be applied to plants that produce valuable compounds, e.g.
- ajmalicine useful as for instance pharmaceuticals, as ajmalicine, vinblastine, vincristine, ajmaline, reserpine, rescinnamine, camptothecine, ellipticine, quinine, and quinidine, taxol, morphine, scopolamine, atropine, cocaine, sanguinarine, codeine, genistein, daidzein, digoxin, calystegins or as food additives such as anthocyanins, vanillin; including but not limited to the classes of compounds mentioned above.
- Examples of such plants include, but not limited to, Papaver spp., Rauwolfia spp., Taxus spp., Cinchona spp., Eschscholtzia californica, Camptotheca acuminata, Hyoscyamus spp., Berberis spp., Coptis spp., Datura spp., Atropa spp., Thalictrum spp., Peganum spp.
- Preferred members of the genus Taxus comprise Taxus brevifolia, Taxus baccata, Taxus cuspidata, Taxus canadensis and Taxus floridana.
- the eukaryotic cells as used to produce the MIAs are not plant cells but for example algal or yeast cells.
- the yeast cell is a yeast cell of a Saccharomyces species (e.g. Saccharomyces cerevisiae), a Hansenula species (e.g. Hansenula polymorpha), a Yarrowia species (e.g. Yarrowia lipolytica), a Kluyveromyces species (e.g. Kluyveromyces lactis), a Pichia species (e.g. Pichia pastoris) or a Candida species (e.g. Candida utilis).
- Saccharomyces species e.g. Saccharomyces cerevisiae
- a Hansenula species e.g. Hansenula polymorpha
- a Yarrowia species e.g. Yarrowia lipolytica
- Kluyveromyces species e.g. Kluyveromyces lactis
- the algal cells are derived from algae of the genus selected from the group comprising Dunaliella, Chlorella, or Chlamydomonas.
- said host cell is a microbial cell.
- the microbial cells particularly envisioned in current application are bacterial cells and yeast cells.
- the prokaryotic or eukaryotic host cells as used herein themselves do not naturally produce the MIAs of the application, but may do so after genetic engineering.
- host cells artificially producing MIAs of the application refers to cells that, while not naturally having the ability to synthesize the MIAs of the application, have acquired such ability by means of genetic modification processes including transgenesis. Therefore, in another particular embodiment, said host cell is a recombinant host cell.
- the term "recombinant host cell" ("expression host cell”, “expression host system”, “expression system” or simply “host cell", as used herein, is intended to refer to a cell into which a recombinant vector has been introduced.
- a recombinant host cell may be an isolated cell or cell line grown in culture or may be a cell which resides in a living tissue or organism. Host cells can be of bacterial, fungal, plant or mammalian origin.
- the plant cell as used may be a genetically engineered plant cell, which is a plant cell derived from a recombinant or genetically engineered plant.
- a "recombinant plant” or a “genetically engineered plant”, as used herein, refers to a plant comprising a recombinant polynucleotide and/or a recombinant polypeptide resulting in the expression of one of the MYC2 or MYC2a proteins as disclosed in the first aspect of this specification.
- a recombinant plant cell comprising one of the MYC2 or MYC2a proteins described in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins.
- a recombinant plant refers to a whole plant as well as to a plant part, such as seed, fruit, leaf, or root, plant tissue, plant cells or any other plant material, and progeny thereof.
- a recombinant plant can be obtained by transforming a plant cell with an expression cassette and regenerating such plant cell into a transgenic, cisgenic or intragenic plant. Such plants can be propagated vegetatively or reproductively.
- the transforming step may be carried out by any suitable means, including by Agrobacterium-mediated transformation and non-Agrobacterium-med ⁇ ated transformation, as discussed further below. Plants can be regenerated from the transformed cell (or cells) by techniques known to those skilled in the art.
- plants in which all cells are transformed may be regenerated from chimeric plants having transformed germ cells, as is known in the art.
- Methods that can be used to transform plant cells or tissue with expression vectors include both Agrobacterium and non -Agrobacterium vectors.
- Agrobacterium- mediated gene transfer exploits the natural ability of Agrobacterium tumefaciens to transfer DNA into plant chromosomes and is described in detail in Gheysen, G., Angenon, G. and Van Montagu, M. 1998.
- Agrobacterium- mediated plant transformation a scientifically interesting story with significant applications. In K. Lindsey (Ed.), Transgenic Plant Research. Harwood Academic Publishers, Amsterdam, pp.
- a second group of transformation methods is the non -Agrobacterium mediated transformation and these methods are known as direct gene transfer methods.
- An overview is brought by Barcelo, P. and Lazzeri, P.A. (1998) Direct gene transfer: chemical, electrical and physical methods.
- Methods include particle gun delivery, microinjection, electroporation of intact cells, polyethyleneglycol-mediated protoplast transformation, electroporation of protoplasts, liposome-mediated transformation, silicon- whiskers mediated transformation etc.
- a suitable control plant would include a genetically unaltered or non-transgenic plant of the parental line (wild type) used to generate a transgenic plant herein.
- hairy root cultures that can be obtained by transformation with virulent strains of Agrobacterium rhizogenes, and can produce high levels of MIAs of current application.
- Protocols used for establishing of hairy root cultures vary, as well as the susceptibility of plant species to infection by Agrobacterium (Toivounen et al. 1993; Vanhala et al. 1995). It is possible by systematic clone selection e.g. via protoplasts, to find high yielding, stable, and from single cell derived-hairy root clones. This is possible because the hairy root cultures possess a great somaclonal variation. Another possibility of transformation is the use of viral vectors (Turpen 1999).
- Any plant tissue or plant cell capable of subsequent clonal propagation, whether by organogenesis or embryogenesis, may be transformed with an expression vector of interest.
- organogenesis' means a process by which shoots and roots are developed sequentially from meristematic centers; the term 'embryogenesis' means a process by which shoots and roots develop together in a concerted fashion (not sequentially), whether from somatic cells or gametes.
- the particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed.
- Exemplary tissue targets include protoplasts, leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g. apical meristems, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyls meristem).
- existing meristematic tissue e.g. apical meristems, axillary buds, and root meristems
- induced meristem tissue e.g., cotyledon meristem and hypocotyls meristem.
- MIAs can then be extracted or isolated from the whole plant or from easily accessible tissue, e.g. leaves.
- cell suspension cultures of plant cells expressing one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing the triple transcription factor cassette (see later) of current application are also particularly useful for current application.
- Suitable cell culture media for eukaryotic cells in particular plant cells and microbial cells, are known in the art.
- eukaryotic cells in particular plant cells and microbial cells
- Exemplary media include standard growth media, many of which are commercially available (e.g., Sigma Chemical Co., St. Louis, Mo.).
- Examples include Schenk-Hildebrandt (SH) medium, Linsmaier-Skoog (LS) medium, Murashige and Skoog (MS) medium, Gamborg’s B5 medium, Nitsch & Nitsch medium, White's medium, and other variations and supplements well known to those of skill in the art (see, e.g., Plant Cell Culture, Dixon, ed. I RL Press, Ltd. Oxford (1985) and George et al., Plant Culture Media, Vol 1, Formulations and Uses Exegetics Ltd. Wilts, UK, (1987)). (see, e.g., Plant Cell Culture, Dixon, ed. I RL Press, Ltd.
- yeast cells include standard growth media, many of which are commercially available (e.g., Clontech, Sigma Chemical Co., St. Louis, Mo.). Examples include Yeast Extract Peptone Dextrose (YPD or YPED) medium, Yeast Extract Peptone Glycerol (YPG or YPEG) medium, Hartwell's complete (HC) medium, Synthetic complete (SC) medium, Yeast Nitrogen Base (YNB), and other variations and supplements well known to those of skill in the art (see, Yeast Protocol Handbook, Clontech).
- YPD or YPED Yeast Extract Peptone Dextrose
- YPG or YPEG Yeast Extract Peptone Glycerol
- HC Hartwell's complete
- SC Synthetic complete
- Yeast Nitrogen Base YNB
- the incubation conditions (temperature, photoperiod, shaking, auxin/cytokine hormone ratio, promoter inducing conditions, promoter repressing conditions, etc.) will depend, among other factors, on the cells to be incubated and are standard techniques in the art.
- a plant cell comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses the transcriptional activators BIS1 and/or ORCA3.
- said transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by promoters different to the promoters to which they are naturally associated or linked.
- said transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by exogenous promoters.
- said transcriptional activator BIS1 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 18.
- said transcriptional activator ORCA3 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No.22.
- the plant cell of the third aspect of this specification is a recombinant or genetically engineered plant cell.
- the plant cell of the third aspect of this specification comprises or expresses an exogenous or wholly exogenous MYC2, BIS1 and ORCA3.
- exogenous or heterologous as used herein is any material originated outside of an organism, tissue, or cell, but that is present (and typically can become active) in that organism, tissue, or cell.
- endogenous refers to substances (e.g. genes) originating from within an organism, tissue, or cell.
- whole exogenous refers to a wholly exogenous protein and means that the whole protein (especially relevant in case of fusion proteins) is exogenous.
- a plant protein endogenous to a specific plant species will become exogenous after fusion of said endogenous protein with an exogenous protein, for example but without the purpose of limiting the green fluorescent protein (GFP).
- GFP green fluorescent protein
- whole exogenous is used when every functional fragment of a fusion protein is exogenous to a specific host.
- a plant cell comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses an orthologue of the Catharanthus roseus transcriptional activator BIS1 and/or an orthologue of the Catharanthus roseus transcriptional activator ORCA3.
- said orthologues of the transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by promoters different to the promoters to which they are naturally associated or linked.
- said orthologues of the transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by exogenous promoters.
- Orthologues of BIS1 that are particularly envisaged are the Medicago truncatula TRITERPENE SAPONIN BIOSYNTHESIS ACTIVATING REGULATOR1 (TSAR1) and TSAR2 proteins (see also Mertens et al 2016 Plant Physiol 170:194-210).
- said orthologue of the Catharanthus roseus transcriptional activator BIS1 is MtTSARl defined by SEQ ID No. 29 or MtTSAR2 defined by SEQ ID No. 30.
- Orthologues of ORCA3 can be identified by the presence of one or more conserved domains.
- said orthologue of the Catharanthus roseus transcriptional activator ORCA3 comprises one AP2/ERF domain as defined by SEQ ID No. 24.
- said ORCA3 orthologue further comprises a C-terminal domain as defined by SEQ ID No. 25 and/or a nuclear localization sequence as defined by SEQ ID No. 26 and/or an acidic domain as defined by SEQ ID No. 27 and/or a serine-rich domain as defined by SEQ ID No. 28.
- the plant cell of the third aspect of this specification wherein BIS1 or an orthologue thereof and ORCA3 or an orthologue thereof are overexpressed.
- Overexpression of a gene of interest can be achieved by adding additional copies of said gene in the host cell of interest.
- the additional copies of the gene of interest e.g. BIS1 and/or ORCA3
- BIS1 and/or ORCA3 can be transcriptionally regulated by their endogenous promoter but more preferably by a non-endogenous promoter.
- the result of said overexpression is that the expression level of a gene of interest exceeds the expression level of said gene in a control host cell.
- this application also provides a plant cell comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses the transcriptional activators BIS1 or an orthologue thereof and/or ORCA3 or an orthologue thereof, wherein the expression levels of BIS1 and/or ORCA3 or said orthologues thereof are at least 10% higher, at least 20% higher, at least 30% higher, at least 40% higher, at least 50% higher, at least 60% higher, at least 70% higher, at least 80% higher, at least 90% higher, at least 100% higher, at least 2-fold higher, at least 3-fold higher, at least 5-fold higher, at least 10-fold higher, between 30% and 150% higher, between 50% and 200% higher or between 2-fold and 8-fold higher than the corresponding expression level of BIS1 and/or ORCA3 of said orthologues thereof in a control plant cell.
- a plant cell comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses the transcriptional activators BIS2 and ORCA3 or BIS2 and ORCA2 or BIS1 and ORCA2.
- said transcriptional activators BIS1 and/or BIS2 and/or ORCA2 and/or ORCA3 are transcriptionally controlled by promoters different to the promoters to which they are naturally associated or linked.
- said transcriptional activators BIS1 and/or BIS2 and/or ORCA2 and/or ORCA3 are transcriptionally controlled by exogenous promoters.
- BIS2 is a homologue of BIS1 in C. roseus and defined by SEQ ID No. 19, while ORCA2 is a homologue of ORCA3 in C. roseus and defined by SEQ ID No. 31.
- a regulatory module comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification and further comprising the transcription factors BIS1 and/or ORCA3, wherein said BIS1 and ORCA3 are transcriptionally controlled by promoters different to the promoters to which BIS1 and ORCA3 are naturally linked or associated.
- a “regulatory module” as used herein refers to a combination of at least two transcription factors controlling the expression of one or more genes within one molecular pathway, for example the pathway that leads to the production of monoterpenoid indole alkaloids.
- the at least two transcription factors can be introduced into a host cell using one or more vectors. Therefore, in one embodiment, a vector is provided comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins described in the first aspect of this specification and a nucleic acid molecule encoding BIS1.
- a vector comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins described in the first aspect of this specification and a nucleic acid molecule encoding ORCA3.
- a vector is provided comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins described in the first aspect of this specification, a nucleic acid molecule encoding BIS1 and a nucleic acid molecule encoding ORCA3.
- said regulatory module is a triple transcription factor cassette, consisting of one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification and the transcription factors BIS1 and ORCA3.
- Said triple transcription factor cassette can consist of one vector, two vector or three vectors.
- said transcriptional activator BIS1 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 18.
- said transcriptional activator ORCA3 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No.
- said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22.
- said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No. 22.
- the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or of the above described regulatory module is provided to produce at least one monoterpenoid indole alkaloid in a plant cell. Also the use of one of the plant cells described in the third aspect of this specification is provided for the production of at least one MIA.
- the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or of the above described regulatory module is provided to enhance the production of at least one monoterpenoid indole alkaloid in a plant cell with at least 10% compared to a control plant cell.
- said use is provided to enhance the production of at least one monoterpenoid indole alkaloids in a plant cell with at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, at least 10-fold, at least 50-fold, at least 100-fold, between 2- fold and 10-fold or between 5-fold and 100-fold or between 50-fold and 1000-fold compared to a control plant cell.
- said control plant cell is a plant cell without one of said MYC2 or MYC2a proteins or without the nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or without the above described regulatory module.
- the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins is provided in combination with the expression of the C. roseus BIS1 or an orthologue thereof and/or the C. roseus ORCA3 or an orthologue thereof to produce at least one MIA in a host cell or the increase the production of at least one MIA in a plant cell.
- the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins is provided in combination with the expression of the C. roseus BIS2 and ORCA3 or of the C. roseus BIS2 and ORCA2 or of the C. roseus BIS1 and ORCA2 to produce at least one MIA in a host cell or the increase the production of at least one MIA in a plant cell.
- Said increase in production is defined as at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, at least 10-fold, at least 50-fold, at least 100-fold, between 2-fold and 10-fold or between 5-fold and 100-fold or between 50-fold and 1000- fold higher compared to a control plant cell.
- BIS1, BIS2, ORCA2, ORCA3 and their orthologues are defined as described in the third aspect of this specification.
- the at least one monoterpenoid indole alkaloid is a 16-hydroxytabersonine-derived MIA and/or 19-hydroxytabersonine- derived MIA.
- the at least one monoterpenoid indole alkaloids is selected from the list consisting of strictosidine, catharanthine, 16-hydroxytabersonine, 16- methoxylhorhammericine, horhammericine, serpentine, vindoline, vinblastine, akuammicine, isositsirikine, 16-methoxytabersonine, 3-hydroxy-16-methoxy-2,3-dihydrotabersonine, 19- hydroxytabersonine, 16-hydroxyhorhammericine, minovincinine, vincadifformine, 16- hydroxyvincadifformine, 16-hydroxy-19-0-acetyltabersonine, perivine and O-acetylstemmadine.
- a method is provided of producing at least one monoterpenoid indole alkaloid in a host cell, comprising:
- a method is provided of increasing the production of at least one monoterpenoid indole alkaloid in a host cell, comprising:
- methods are provided of producing at least one monoterpenoid indole alkaloid in a host cell, said method comprises expressing one of the MYC2 or MYC2a proteins described in the first aspect of this specification in a host cell, expressing the C. roseus BIS1 transcription factor or an orthologue thereof and/or the C. roseus BIS2 transcription factor or an orthologue thereof and/or the C. roseus ORCA2 transcription factor or an orthologue thereof and/or the C. roseus ORCA3 transcription factor or an orthologue thereof, and selecting host cells that produce at least one monoterpenoid indole alkaloid.
- method of increasing the production of at least one monoterpenoid indole alkaloid in a host cell, said method comprises expressing one of the MYC2 or MYC2a proteins described in the first aspect of this specification in a host cell, expressing the C. roseus BIS1 transcription factor or an orthologue thereof and/or the C. roseus BIS2 transcription factor or an orthologue thereof and/or the C. roseus ORCA2 transcription factor or an orthologue thereof and/or the C. roseus ORCA3 transcription factor or an orthologue thereof, and selecting host cells with increased production of at least one monoterpenoid indole alkaloid compared to control cells not expressing one of said MYC2 of MYC2a proteins.
- said host cell is a eukaryotic cell, more particularly a plant or yeast cell, even more particularly a plant cell.
- increased production of at least one MIA means that the production level of said at least one MIA in the selected host cells is at least 10% higher than that of control cells.
- said production level is at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 2-fold, at least 5- fold, at least 10-fold, at least 50-fold, at least 100-fold, or between 2-fold and 10-fold, between 10-fold and 100-fold or between 50-fold and 1000-fold higher than that of control cells.
- BIS1, BIS2, ORCA2, ORCA3 and their orthologues are defined as described in the third aspect of this specification.
- Example 1 A protoplast-based screen for transcriptional regulator(s) of BIS1 yields no hits from a collection of 'wild-type' C. roseus TFs
- JAZ-interacting TFs have been identified, mainly in Arabidopsis, including bHLH TFs from the same or other bHLH clades than MYC2, namely clades lllb (the 'ICE' TFs), llld (the 'JAM' TFs), llle (the 'MYC2' TFs) and lllf (the 'GL' TFs)
- bHLH TFs from the same or other bHLH clades than MYC2
- clades lllb the 'ICE' TFs
- llld the llld
- llle the 'MYC2' TFs
- lllf the 'GL' TFs
- CrMYC2a was discovered in a yeast-one hybrid (Y1H) screen for activators of the STR promoter (pSTR), but has so far not been shown to transactivate pSTR in any plant system (Chatel et al., 2003; Paul et al., 2017; Pre et al., 2000; Zhang et al., 2011).
- Y1H yeast-one hybrid
- AtMYC2D105N and CrMYC2aD126N can transactivate pSTR in tobacco protoplasts, contrary to the wild-type versions (Fig. 3A). Together, this also supports a role for CrMYC2a as a direct regulator of MIA biosynthesis gene expression.
- AtMYC2 and CrMYC2a mutants were transiently overexpressed in C. roseus flower petals using Agrobacterium tumefaciens infiltration.
- overexpression of de-repressed AtMYC2 or CrMYC2a mutants resulted in a strong upregulation of MIA pathway genes in comparison to control petals transformed with a pCaMV35S::GUS construct (Fig. 6A and data not shown).
- TABERSONINE 19-HYDROXYLASE T19H
- MINOVINCININE-19-O-ACETYLTRANSFERASE MAT
- TAT homolog TABERSONINE DERIVATIVE 19-O-ACETYLTRANSFERASE
- TABERSONINE 16-HYDROXYLASE 2 T16H2
- TABERSONINE 16-0- METHYLTRANSFERASE T160MT
- DESACETOXYVINDOLINE 4-HYDROXYLASE D4H
- DEACETYLVINDOLINE O-ACETYLTRANSFERASE DAT
- the expression profile of the epidermis-specific late iridoid and MIA pathway genes did not significantly differ between control flowers or those overexpressing wild-type MYC2s, which correlates with the lack of induction of ORCA2 or ORCA3 (Fig. 6 and data not shown).
- LC-FT-ICR-MS liquid chromatography Fourier-transform ion cyclotron resonance mass spectrometry
- LC-FT-ICR-MS data were used for a principal component analysis (PCA) (Fig. 6C).
- PCA principal component analysis
- the metabolomes of the various petal samples clustered in two distinguishable groups with one group containing the samples from flowers transformed with the pCaMV35S::GUS, pCaMV35S::CrMYC2a and pCaMV35S::AtMYC2 constructs and the other group containing those from flowers transformed with pCaMV35S::CrMYC2aD126N or pCaMV35S::AtMYC2D105N.
- n n D4H 1 ⁇ 0.22 1.74 ⁇ 0.05* 0.95 ⁇ 0.14 0.67 ⁇ 0.11 0.95 ⁇ 0.39 1.12 ⁇ 0.13 0.44 ⁇ 0.02* o- DAT 1 ⁇ 0.05 0.88 ⁇ 0.1 0.7 ⁇ 0.09* 0.77 ⁇ 0.1 0.62 ⁇ 0.09* 1.53 ⁇ 0.37 0.57 ⁇ 0.09**
- ORCA3 overexpression similar to CrMYC2aD126N overexpression but distinct from BIS1 overexpression, clearly induced the seco-iridoid and MIA pathway genes downstream from 7DLH, as well as of the (seco-)iridoid and strictosidine transporters NPF2.6 and NPF2.9 and MIA pathway genes such as GS1, GS2, T19H and MAT (Fig. 7A). Further comparison of expression profiles revealed that only CrMYC2aD126N overexpression led to induction of the MIA pathway genes SGD, HYS, GO and TAT and the iridoid transporter NPF2.5, and that these genes were not affected by BIS1 or ORCA3 overexpression (Fig. 7A).
- the promoters containing 3 or more potential MYC2-binding domains such as LAMT (5), STR (5), T19H (4), HYS (4), TAT (3), 10 (3) and G80 (3) are all strongly up-regulated in CrMYC2aD126N overexpressing flowers, suggesting some correlation, although weak, between the number of potential MYC2 binding elements and inducibility by CrMYC2aD126N.
- this compound was identified as 16- hydroxytabersonine, a vindoline precursor, the identity of which was further confirmed by a standard synthesized in yeast. 16-hydroxytabersonine also accumulated two- to three-fold more in flowers overexpressing ORCA3 and CrMYC2aD126N, respectively, but not in BISl-overexpressing flowers (Fig. 7C; Table 3). The second peak corresponded to a compound with a parent [M+H]+ ion at m/z 625.1762 and was accumulating 4.5-fold higher in triple-TF infiltrated flowers. MS fragmentation suggested this compound to be a flavonoid, most likely an isomer of rhamnetin 3-rutinoside.
- PCA was carried out (Fig. 7D).
- Samples of BISl-overexpressing flowers largely overlapped with those of the control, but all others formed distinct groups, with the triple-TF infiltrated flowers showing the most divergent distribution pattern.
- distribution of PCI was mainly explained by variables corresponding to the above-mentioned differentially accumulating MIAs.
- PC2 seemed to be mostly influenced by compounds related to flavonoids such as the tentatively annotated rhamnetin 3-rutinoside, explaining the distribution pattern of the samples infiltrated with the ORCA3 TF.
- the 19-hydroxytabersonine-derived MIAs are normally produced in roots (Giddings et al., 2011). Considering the dramatic increase of root-specific MIAs, we screened our data for other MIAs in this specific branch (Fig. 7C and IB).
- BIS1 (Caros001862.1) and BIS2 (Caros006385.1) are clade IVa bH LH transcription factors. This clade is characterized by the absence of a JAZ interacting domain.
- Orthologues in Arabidopsis thaliana are At2g22750 (bHLH18), At4g37850 (bHLH25), At2g22760 (bHLH19) and At2g22770 (bHLH20).
- Orthologues Medicago truncatula are MtTSARl (SEQ ID No. 29) and MtTSAR2 (SEQ ID No. 30) (see Mertens et al 2016 Plant & Cell Physiology 57:2564-2575).
- ORCA3 belongs to the AP2/ERF (formerly called AP2/EREBP) subfamily of AP2-domain proteins (Fujimoto et al., 2000 Plant Cell 12:393-404; Riechmann and Meyerowitz, 1998 Biol Chem 379:633-646) with a single AP2 domain (SEQ ID No. 24).
- the AP2 subfamily contains two AP2 domains.
- the amino acid sequences of the AP2 domain and the AP2/ERF domain are quite divergent (for details see Fujimoto et al., 2000 Plant Cell 12:393-404).
- ORCA3 When ORCA3 is aligned with a number of functionally characterized AP2/ERF-type proteins from different plant species (NtEREBP-1, NtEREBP-2, NtEREBP-3, NtEREBP-4, AtERFl, AtERF2, AtERF3, AtERF4, AtERF5, LePti4, LePti5, LePti6, CrORCAl, CrORCA2), a high level of homology within the AP2/ERF domain is found (see Figure 2a in van der Fits and Memelink 2001 TPJ 25:43-53). Based on sequence and structural homology, several conserved domains can be pointed out in the ORCA3 protein.
- ORCA3 forms part of a subgroup of AP2/ERF-domain proteins having a conserved C-terminal extension of the AP2/ERF domain of about 20 amino acids (SEQ ID No. 25). Outside the AP2/ERF domain, little or no homology with other AP2/ERF-domain proteins is observed.
- the AP2/ERF domain of ORCA3 contains a putative bipartite nuclear localization signal (SEQ ID No. 26). In the N-terminus of the ORCA3 protein, an acidic domain can be pointed out (SEQ ID No. 27). Furthermore, a serine-rich region is present in the C-terminus of the ORCA3 protein (SEQ ID No. 28).
- Flomologues in C. roseus are the ORCA2 protein (GenBank: CAB93940.1) and the ORCA3-like protein 1 from C. roseus with accession or sequence ID ANC60170.1 (51% identity).
- Orthologues of ORCA3 in Datura mete! are the AP2-binding DNA-binding domain protein with accession or sequence ID ABU40945.1 (98% identity).
- Metabolic pathways are regulated and fine-tuned in a complicated way and increased induction of pathway gene expression does not necessarily lead to increased flux through the pathway or increased accumulation of the desired metabolites. This is particularly applicable to the MIA pathway with its numerous branches and high degree of cellular and organellar compartmentalization. For instance, overexpression of BIS1 or CrMYC2a in C. roseus flower petals had no effect on the level of the 24 flower MIAs identified here. Overexpression of ORCA3 and CrMYC2aD126N resulted in a statistically significant increase in the levels of six and nine of these MIAs, respectively.
- Elements of the network that have been exposed include: (i) the first direct regulator of SGD expression, namely CrMYC2a, which is particularly valuable because SGD represents the gateway towards all MIAs, (ii) the TFs regulating directly and indirectly the expression of known (seco)iridoid MIA transporters, which is crucial given the spatial distribution of the MIA pathway across cell types and compartments, (iii) the capacity of a combinatorial TF cassette to induce a genuine MIA pathway, thereby overruling previously anticipated organ-specific boundaries such as the unexpected induction of the postulated root-specific T19FI, MAT and TAT genes, (iv) the existence of amplification loops or TF cascades, e.g.
- Petals of freshly opened flowers were pierced with a needle and then infiltrated with a 1-mL syringe containing the A. tumefaciens solution. After 48 h of incubation, petals from five different flowers per sample were cut in two and immediately flash-frozen in liquid nitrogen. One sample was used for RNA extraction for gene expression analysis and the other sample was used for metabolite profiling.
- the fragments were gel-purified (GeneJET Gel Extraction Kit, ThermoFisher) and recombined into pDONRTM221 using Gateway ® BP clonaseTM II enzyme mix (ThermoFisher); the resulting ENTRY clones were sequenced.
- CrMYC2aD126N, CrMYC2bD60N, and CrMYC2cD53N were constructed by overlap extension PCR using the ENTRY clones as templates.
- ENTRY clones were recombined into pK7WG2D or p2GW7 (Karimi et al., 2002), respectively, using LR ClonaseTM enzyme mix (ThermoFisher).
- the promoter fragments of GES, G80, 8FIGO, IS, 10, 7DLGT, 7DLFI, LAMT, STR and BIS1 had been cloned previously (Van Moerkercke et al., 2016; Van Moerkercke et al., 2015; Vom Endt et al., 2007).
- the promoter fragments (including 5' UTRs) of SLS (1413bp), TDC (2353 bp) and SGD (1651 bp) were amplified from C. roseus var. "Little bright eyes" genomic DNA and recombined into ENTRY vectors.
- ENTRY clones containing promoter fragments were recombined into pGWL7 (Karimi et al., 2002) for transient expression assays.
- Y2H assays were performed as described (Cuellar Perez et al., 2013). Bait and prey were fused to the GAL4-AD or GAL4-BD via cloning into pGAD424gate or pGBT9gate, respectively.
- the Saccharomyces cerevisiae PJ69-4A yeast strain was co-transformed with bait and prey using the polyethylene glycol (PEG)/lithium acetate method. Positive transformants were selected on Synthetic Defined (SD) medium lacking Leu and Trp (-2) (Clontech). Colonies were grown overnight in liquid cultures (-2) at 30°C and 10- or 100-fold dilutions were dropped on control medium (-2) and selective medium lacking Leu, Trp and His (-3) (Clontech).
- C. roseus gene promoters by C. roseus TFs was assessed in transient expression assays in N. tabacum 'Bright Yellow-2' protoplasts as described (Vanden Bossche et al., 2013).
- Protoplasts were co-transfected with reporter, effector and normalizer plasmids.
- the reporter plasmid consists of a fusion between the promoter of interest and the FIREFLY LUCIFERASE (fLUC) gene.
- the effector plasmid contains the TF of interest driven by the CaMV35S promoter.
- the normalizer plasmid contains the RENILLA LUCIFERASE (rLUC) driven by the CaMV35S promoter.
- fLUC and rLUC readouts were collected after overnight incubation and lysis using the Dual-Luciferase Reporter Assay System (Promega). Each assay incorporated four or eight biological repeats. Normalized values of the promoter activities were obtained by dividing the fLUC values by the corresponding rLUC values. The average of the normalized fLUC values was calculated and set out relative to the control fLUC values (i.e. with an effector plasmid carrying the GUS gene instead of a TF gene).
- RNA from agro-infiltrated flower petals was extracted using the RNeasy Plant Mini kit (Qiagen) including an additional DNA on-column digest with RQ1 DNase (Promega). Up to 500 ng of RNA was used as a template for reverse transcription with the iScriptTM cDNA synthesis kit (Bio-Rad). qPCR was performed, on a LightCycler ® 480 (Roche) using SYBR Green qPCR master Mix (Agilent) and gene-specific oligonucleotides (Table S6) in two technical replicates. The data was normalized to two reference genes, N2227 and SAND (Pollier et al., 2014) using qBase (Hellemans et al., 2007).
- infiltrated petals were snap-frozen and ground in liquid nitrogen. After lyophilization, around 5 mg of dry petal tissue was weighed and extracted with 1 mL of methanol containing 100 mM caffeine as an internal standard. The samples were extracted at room temperature for 10 min and centrifuged for 10 min at 20,800 x g. The resulting supernatant was evaporated to dryness under vacuum, and the residue was dissolved in 800 pL of water/cyclohexane (1:1, v/v). The samples were centrifuged (10 min at 20,800 x g), and 200 pL of the aqueous phase was retained for LC-MS analysis.
- LC-MS For LC-MS, 10 pL of the sample was injected in a ZORBAX RRHD Eclipse XDB-C18 column (2.1 x 150 mm, 1.8 pm) mounted on a thermo instrument equipped with an LTQ FT Ultra and an electrospray ionization source. The following gradient was run using acidified (0.1% (v/v) formic acid) solvents A (water/acetonitrile (99:1, v/v)) and B (acetonitrile/water; 99:1, v/v)): time 0 min, 5% B; 30 min, 55% B; 35 min, 100% B.
- FT-MS spectra between m/z 120-1400 were recorded at a resolution of 100,000.
- T16H2 or T19H were cloned via Gateway recombination into the yeast vector pAG423GAL-ccdB (Alberti et al., 2007) (AddGene plasmid 14149) and co-transformed in the wild-type yeast strain PA59 (Arendt et al., 2017) (MATa; his3Al; leu2A0; ura3A0; lys2A0; trp-1) with the P450 reductase MTR1 (Miettinen et al., 2017) cloned in pAG415GAL-ccdB (Alberti et al., 2007) (AddGene plasmid 14145).
- Transformed colonies were selected on Synthetic Defined (SD) medium (Clontech) with -His, -Leu (Clontech) amino acid dropouts (DO).
- SD Synthetic Defined
- pre-cultures were grown at 30°C with shaking at 250 rpm for 24 h in 5 mL of liquid SD medium with -His, -Leu DO.
- the precultures were washed and inoculated into 50 mL of SD Gal/Raf medium with -His, -Leu DO supplements to a starting optical density of 0.25.
- the cultures were incubated for 24 h before addition of 125 mM of tabersonine (dissolved in ethanol) and further incubated for another 48 h.
- the produced 16-hydroxytabersonine or 19-hydroxytabersonine were extracted from the yeast medium using ethyl acetate and analyzed by LC- FT-ICR-MS as described above.
- SEQ ID No. 1 WT CrMYC2a protein (Catharanthus roseus)
- SEQ ID No. 2 Mutant CrMYC2a protein (Catharanthus roseus)
- SEQ ID No. 3 WT CrMYC2b protein (Catharanthus roseus)
- SEQ ID No. 4 Mutant CrMYC2b protein (Catharanthus roseus)
- SEQ ID No. 5 WT CrMYC2c protein (Catharanthus roseus)
- SEQ ID No. 7 JAZ interacting domain of CrMYC2a (Catharanthus roseus)
- SEQ ID No. 8 JAZ interacting domain of CrMYC2a (Catharanthus roseus)
- SEQ ID No. 12 JAZ interacting domain of CrMYC2a (Catharanthus roseus)
- SEQ ID No. 13 WT CrMYC2b DNA (Catharanthus roseus)
- SEQ ID No. 15 WT CrMYC2c DNA (Catharanthus roseus)
- SEQ ID No. 16 JAZ interacting domain of CrMYC2c (Catharanthus roseus)
- SEQ ID No. 17 WT AtMYC2 DNA (Arabidopsis thaliana)
- SEQ ID No. 18 WT BIS1 protein (Catharanthus roseus)
- SEQ ID No. 19 WT BIS2 protein (Catharanthus roseus)
- SEQ ID No. 20 WT BIS1 DNA (Catharanthus roseus)
- SEQ ID No. 21 WT BIS2 DNA (Catharanthus roseus)
- SEQ ID No. 22 WT ORCA3 protein (Catharanthus roseus)
- SEQ ID No. 23 WT ORCA3 DNA (Catharanthus roseus)
- SEQ ID No. 24 AP2/ERF domain of ORCA3 (Catharanthus roseus)
- SEQ ID No. 25 C-terminal domain of ORCA3 (Catharanthus roseus)
- SEQ ID No. 26 NLS of CrORCA3 of ORCA3 (Catharanthus roseus)
- SEQ ID No. 27 Acidic domain of ORCA3 (Catharanthus roseus)
- SEQ ID No. 28 Serine-rich domain of ORCA3 (Catharanthus roseus)
- SEQ ID No. 30 MtTSAR2 (Medicago truncatula)
- SEQ ID No. 31 ORCA2 protein (Catharanthus roseus)
- SEQ ID No. 32 WT AtMYC2 protein (Arabidopsis thaliana)
- SEQ ID No. 34 JAZ interacting domain of CrMYC2aD126N (Catharanthus roseus)
- SEQ ID No. 35 JAZ interacting domain of AtMYC2 (Catharanthus roseus)
- SEQ ID No. 36 JAZ interacting domain of AtMYC3 (Catharanthus roseus)
- SEQ ID No. 37 JAZ interacting domain of AtMYC4 (Catharanthus roseus)
- SEQ ID No. 38 JAZ interacting domain of AtMYC5 (Catharanthus roseus)
- SEQ ID No. 39 JAZ interacting domain of AtMYC2D105N (Catharanthus roseus)
- SEQ ID No. 40 JAZ interacting domain of AtMYC3/atr2D (Catharanthus roseus) References
- a pair of tabersonine 16-hydroxylases initiates the synthesis of vindoline in an organ- dependent manner in Catharanthus roseus. Plant Physiol. 163, 1792-1803.
- CrMYCl a Catharanthus roseus elicitor- and jasmonate-responsive bHLH transcription factor that binds the G-box element of the strictosidine synthase gene promoter. J. Exp. Bot. 54, 2587-2588.
- bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol. 166, 349-369.
- Jasmonic acid is a signal transducer in elicitor-induced plant cell cultures. Proc. Natl. Acad. Sci. USA. 89, 2389-2393.
- the jasmonate-responsive element from the ORCA3 promoter from Catharanthus roseus is active in Arabidopsis and is controlled by the transcription factor AtMYC2. Plant Cell Physiol. 52, 578-587.
- a differentially regulated AP2/ERF transcription factor gene cluster acts downstream of a MAP kinase cascade to modulate terpenoid indole alkaloid biosynthesis in Catharanthus roseus. New Phytol. 213, 1107-1123.
- JAZ proteins a crucial interface in the jasmonate signaling cascade.
- Stavrinides A., Tatsis, E.C., Caputi, L., Foureau, E., Stevenson, C.E.M., Lawson, D.M., Courdavault, V., O'Connor, S.E., 2016. Structural investigation of heteroyohimbine alkaloid synthesis reveals active site elements that control stereoselectivity. Nat. Commun. 7, 12116.
- Tatsis E.C., Carqueijeiro, L, Duge de Bernonville, T., Franke, J., Dang, T.-T., Oudin, A., Lanoue, A., Lafontaine, F., Stavrinides, A.K., Clastre, M., Courdavault, V., O'Connor, S.E., 2017. A three enzyme system to generate the Strychnos alkaloid scaffold from a central biosynthetic intermediate. Nat. Commun. 8, 316.
- the basic helix-loop-helix transcription factor BIS2 is essential for monoterpenoid indole alkaloid production in the medicinal plant Catharanthus roseus. Plant J. 88, 3-12.
- Van Moerkercke A., Steensma, P., Schweizer, F., Pollier, J., Gariboldi, L, Payne, R., Vanden Bossche, R., Mangatinen, K., Espoz, J., Purnama, P.C., Kellner, F., Seppanen-Laakso, T., O'Connor, S.E., Rischer, FL, Memelink, J., Goossens, A., 2015.
- the bHLH transcription factor BIS1 controls the iridoid branch of the monoterpenoid indole alkaloid pathway in Catharanthus roseus. Proc. Natl. Acad. Sci. USA. 112, 8130-8135.
- the basic helix-loop-helix transcription factor CrMYC2 controls the jasmonate-responsive expression of the ORCA genes that regulate alkaloid biosynthesis in Catharanthus roseus. Plant J. 67, 61-71.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Nutrition Science (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention relates to the field of plant secondary metabolites, more particularly to methods of increasing the production of specific plant secondary metabolites. Even more particularly the present invention relates to the identification of a combination of transcription factors that enhances the production of monoterpenoid indole alkaloids.
Description
AN ENGINEERED COMBINATORIAL MODULE OF TRANSCRIPTION FACTORS TO BOOST PRODUCTION
OF MONOTERPENOID INDOLE ALKALOIDS
Field of the invention
The present invention relates to the field of plant secondary metabolites with agricultural, pharmacological or other industrial properties, more particularly to methods of increasing the activity of specific plant secondary metabolites. Even more particularly the present invention relates to the identification of a combination of transcription factors that enhances the production of monoterpenoid indole alkaloids.
Background
Plants synthesize an overwhelming variety of specialized metabolites such as monoterpenoid indole alkaloids (MIAs) with an enormous range of biological activities relevant for the pharmaceutical (e.g. antitumor), chemical industry (e.g. additives to foods and cosmetics) as well as for the agricultural industry (e.g. antifungal, antibacterial, molluscicidal, insecticidal, and anti-feeding activities) (Suzuki et al. 2002 Plant Journal 32: 1033-1048; Huhman et al. 2005 J Agric Food Chem 53: 1914-1920; Augustin et al. 2011 Phytochemistry 72: 435-457; Osbourn et al. 2011 Natural Product Reports 28: 1261-1268).
Like for many specialized metabolites, MIA biosynthesis is regulated by the plant hormone jasmonate (JA) and serves predominantly a defensive role against insects and pathogens (De Geyter et al., 2012; Duge de Bernonville et al., 2017; Goossens et al., 2017; Roepke et al., 2010; Wasternack and Hause, 2013; Zhang et al., 2011; Zhou and Memelink, 2016). In general, in the absence of JA, in particular its bioactive form JA-isoleucine (JA-lle), the activity of positive regulators of the JA response, such as the transcription factor (TF) MYC2, is physically blocked by the interaction with JASMONATE-ZIM DOMAIN (JAZ) proteins (Chini et al., 2016; Pauwels and Goossens, 2011; Wasternack and Strnad, 2018). Insect attack, wounding or JA treatment is followed by a burst of JA-lle that promotes the interaction between the JAZ repressor proteins and the F-box CORONATINE INSENSITIVE 1 (COI1) protein, leading to ubiquitination and consequent proteasomal degradation of the JAZ proteins. Subsequently, TFs such as MYC2 are de-repressed, leading to transcriptional activation of their target genes (Chini et al., 2016; Goossens et al., 2017; Wasternack and Strnad, 2018; Zhou and Memelink, 2016). Recently, it has been shown that specific amino acid changes in the JAZ Interaction Domain (JID) of Arabidopsis thaliana MYC2 (AtMYC2) can prevent the interaction with the JAZ proteins, resulting in a constitutively active (hereafter called 'de-repressed') form, such as AtMYC2D105N (Frerigmann et al., 2014; Gasperini et al., 2015; Goossens et al., 2015; Smolen et al., 2002; Zhang et al., 2015).
Besides MYC2, JA-mediated elicitation of MIA biosynthesis in C. roseus organs involves several other TFs. Expression of the IPAP-specific MIA biosynthesis genes is controlled by the BASIC HELIX-LOOP-HELIX
IRIDOID SYNTHESIS (BIS) 1 and BIS2 TFs (Fig. 1A) (Van Moerkercke et al., 2016; Van Moerkercke et al., 2015). The expression of the epidermis-specific genes steering the following steps leading to strictosidine is controlled by the clade of the OCTADECANOID DERIVATIVE RESPONSIVE CATHARANTHUS APETALA2- DOMAIN (ORCA) 2, ORCA3, ORCA4, and ORCA5 TFs (Menke et al., 1999; Paul et al., 2017; van der Fits and Memelink, 2000; Zhou and Memelink, 2016). The expression of the BIS TFs as well as the ORCA TFs can be stimulated by JAs (Paul et al., 2017; Van Moerkercke et al., 2016; Van Moerkercke et al., 2015; Zhang et al., 2011). Overexpression of CrMYC2 in cell suspension and hairy root cultures has been shown to induce the expression of ORCA genes (Paul et al., 2017; Zhang et al., 2011) and CrMYC2 and ORCA3 have both been shown to be capable of transactivating the TDC promoter in tobacco protoplasts (Paul et al., 2017). However, the mechanism by which the whole MIA pathway and/or the above TFs are controlled by the primary MYC2 JA signaling module is not well understood yet, because evidence for both indirect and direct actions exist.
The medicinal plant Catharanthus roseus (Madagascar periwinkle) produces over 130 monoterpenoid indole alkaloids (MIAs), including the anticancer compounds vinblastine and vincristine (Fig. 1A) (van der Heijden et al., 2004). Today, C. roseus still remains the only source of these compounds, as their total chemical synthesis is economically not viable (Eastman, 2011; van der Heijden et al., 2004). Developing alternatives such as biotechnology-based production methods in hairy root, suspension cell or yeast cultures has been a longstanding research subject (Facchini and De Luca, 2008; O'Connor, 2015; van der Heijden et al., 2004). Some precursors of vinblastine have been produced successfully in heterologous systems, including the MIA precursor strictosidine in yeast and tobacco (Brown et al., 2015; Miettinen et al., 2014) and vindoline in yeast after feeding with the precursor tabersonine (Qu et al., 2015). However, because of the still incomplete knowledge of the entire MIA pathway, yields of current approaches are suboptimal and thus it would be advantageous to find alternative strategies to boost the production of MIAs, more particular the anticancer compounds vinblastine and vincristine.
Summary
Applicant made use of a flower petal transformation method in the medicinal plant Catharanthus roseus to shed light on the complex regulatory mechanisms steering the jasmonate-modulated biosynthesis of monoterpenoid indole alkaloids (MIAs), to which the anti-cancer compounds vinblastine and vincristine belong. By combinatorial overexpression of the transcriptional activators BIS1, ORCA3 and MYC2a, an unprecedented insight into the modular transcriptional control of MIA biosynthesis is provided. Furthermore, it is shown that the expression of an engineered de-repressed MYC2a triggers a tremendous reprogramming of the MIA pathway, finally leading to massively increased accumulation of at least 23 MIAs.
Therefore, a first object of the application is a Catharanthus roseus MYC2 protein with a D to N mutation at a position relative to position 126 of SEQ ID No. 1. In one embodiment, said MYC2 protein further comprises a JAZ interacting domain comprising SEQ ID No 7 and/or SEQ ID No. 8. In a further embodiment, said MYC2 protein has at least 90% homology to SEQ ID No. 1. In a more particular embodiment, a mutant Catharanthus roseus MYC2a protein as depicted in SEQ ID No. 2 is provided. It is also an object of the application to provide a nucleic acid molecule encoding one of the above MYC2 or MYC2a proteins.
A third object of the application is a plant cell expressing the above described nucleic acid molecule or comprising one of the MYC2 or MYC2a proteins described. In a more particular embodiment, said plant cell further expresses the transcriptional activators BIS1 and ORCA3. In an even more particular embodiment, the expression level of BIS1 and ORCA3 in said plant cell is at least 10% higher than the expression level of BIS1 and ORCA3 in a control plant cell.
A fourth object of the application is a regulatory module comprising one of the MYC2 or MYC2a proteins described above, further comprising the transcription factors BIS1 and ORCA3, wherein said BIS1 and ORCA3 transcription factors are transcriptionally controlled by promoters different to the promoters to which they are naturally linked.
A fifth object of the application is the use of one of the described MYC2 or MYC2a proteins or the use of the described nucleic acid molecule or the use of the described regulatory module to enhance the production of at least one monoterpenoid indole alkaloid in a plant cell with at least 10% compared to a control plant cell. In a particular embodiment, said at least one monoterpenoid indolalkaloid is a 16- hydroxytabersonine-derived MIA and/or 19-hydroxytabersonine-derived MIA. In an even more particular embodiment, said at least one MIA is selected from the list consisting of strictosidine, catharanthine, 16-hydroxytabersonine, 16-methoxylhorhammericine, horhammericine, serpentine, vindoline, vinblastine, akuammicine, isositsirikine, 16-methoxytabersonine, 3-hydroxy-16-methoxy-2,3- dihydrotabersonine, 19-hydroxytabersonine, 16-hydroxyhorhammericine, minovincinine, vincadifformine, 16-hydroxyvincadifformine, 16-hydroxy-19-0-acetyltabersonine, perivine and O- acetylstemmadine.
A sixth object of the application is a method of producing monoterpenoid indole alkaloids, said method comprising expressing one of the MYC2 or MYC2a proteins described in this specification in a plant cell; optionally further expressing the BIS1 and/or ORCA3 transcription factors; and selecting plant cells with increased production of at least one monoterpenoid indole alkaloid compared to control plant cells not expressing one of said MYC2 of MYC2a proteins.
Brief description of the drawings
Figure 1. MIA biosynthesis in C. rose us is regulated by CrMYC2a, BIS1 and ORCA3. (A) Pathway leading to the production of shoot-specific MIAs in C. roseus. (B) Pathway leading to the root-specific MIAs. Genes regulated by CrMYC2a, BIS1 and ORCA are boxed in orange, blue and green, respectively. Genes not regulated by any of these TFS are boxed in yellow. 7DLGT, 7-deoxyloganetic acid glucosyl transferase; 7DLH, 7-deoxyloganic acid hydroxylase; 8HGO, 8-hydroxygeraniol oxidoreductase; BIS1/2, bHLH iridoid synthesis 1 and 2; D4H, desacetoxy vindoline 4-hydroxylase; DAT, deacetylvindoline O-acetyltransferase; G80, geraniol-8-oxidase; GES, geraniol synthase; GO, geissoschizine oxidase; GS1/2, geissoschizine synthase 1 and 2; HL1/2, a/b hydrolase 1 and 2; HYS, heteroyohimbine synthase; 10, iridoid oxidase; IS, iridoid synthase; LAMT, loganic acid O-methyltransferase; MAT, minovincinine-19-hydroxy-O- acetyltransferase; NMT, N methyltransferase; NPF2.4/5/6/9, nitrate/peptide family; ORCA3, octadecanoid-derivative responsive Catharanthus AP2-domain protein 3; PRX1, peroxidase 1; SAT, stemmadenine-O-acetyltransferase; SGD, strictosidine B-glucosidase; SLS, secologanin synthase; STR, strictosidine synthase; T16H1/2, tabersonine 16-hydroxylase 1 and 2; T160MT, tabersonine 16-0- methyltransferase; T19H, tabersonine 19-hydroxylase; T30, tabersonine 3-oxygenase; T3R, tabersonine 3-reductase; TAT, tabersonine derivative 19-O-acetyltransferase; TDC, tryptophan decarboxylase; THAS, tetrahydroalstonine synthase.
Figure 2. Y2H assays to assess interaction between C. roseus JAZ and bHLH proteins. A: BIS1 and BIS2 do not interact with JAZ proteins in a Y2H assay. The full-length open reading frame sequences of BIS1 and BIS2 were cloned in the activation domain (AD) vectors whereas JAZ1, 2, 3, 4, 7 and 8 were cloned in DNA-binding domain (BD) vectors, as indicated. Transformed yeasts were spotted in 10-fold and 100- fold dilutions on control medium (-2) or selective medium (-3). Empty vectors were used as the negative control, whereas a clone with the BIS2-ACT domain was used as the positive control. B: Y2H growth control. Yeast cultures used for the Y2H assay shown in Fig. 3B to detect MYC2-JAZ interaction were additionally grown in 1:10 and 1:100 dilutions on control medium lacking Leu and Trp (-2).
Figure 3. De-repressed CrMYC2aD126N transactivates the promoters of BIS1, ORCA3 and MIA biosynthesis genes. (A) De-repressed CrMYC2aD126N and AtMYC2D105N can transactivate pBISl, pORCA3 and pSTR in transient expression assays in N. tabacum protoplasts. The y-axis shows fold change in normalized fLUC activity relative to the control transfection with GUS. The error bars designate SE of the mean (n = 8). Statistical significance was determined by the Student's t test (* P < 0.05, **P < 0.01, *** P < 0.001). (B) Y2H assay showing that de-repressed CrMYC2aD126N and AtMYC2D105N lose their capacity to interact with some but not all JAZ proteins, as compared to the wild-type versions. The FL-
ORF sequences of CrMYC2a, CrMYCaD126N, AtMYC2 and AtMYC2D105N were cloned in the activation domain (AD) vectors whereas those of the JAZ genes were cloned in DNA-binding domain (BD) vectors, as indicated. Transformed yeasts were spotted in 10-fold and 100-fold dilutions on selective medium (this figure) and control medium (see Fig. 2B). Empty vectors were used as the negative control. (C) CrMYC2aD126N, but not CrMYC2a, transactivates the promoter of MIA pathway genes in N. tabacum protoplasts. The y-axis shows fold change in normalized fLUC activity relative to the control transfection with GUS. The error bars designate SE of the mean (n = 4). Statistical significance was determined by the Student's t-test (*P < 0.05, **P < 0.01, *** p < 0.001). (D-G) qPCR data show that only the derepressed version of CrMYC2a is able to activate expression of BIS1 (D), BIS2 (E), ORCA2 (F) and ORCA3 (G).
Figure 4. Phylogenetic tree of A. thaliana and C. roseus bHLH proteins showing the relationship between clade III, clade IV and previously published MYC proteins. Arabidopsis bHLH proteins were used as bait to screen for clade III orthologs within the C. roseus transcriptome (http://bioinformatics.psb.ugent.be/orcae/overview/SmartCell). A neighbor-joining tree was constructed in MEGA6 based on an alignment of the full-length proteins (Tamura et al., 2013). Bootstrap analyses were performed with 1,000 bootstrap replicates. The tree was rooted on to the branch containing clade XII, IX, VI lb bHLH TFs.
Figure 5. Amino acid alignment showing conservation of aspartate in the JID domain. ClustalW multiple alignment of the JAZ interacting domain (JID) within C. roseus and A. thaliana MYC2 homologs. Red box indicates the mutated aspartate (D) in the de-repressed MYC2 homologs.
Figure 6. Expression of MIA pathway genes and metabolite profiling of C. roseus flower petals transiently overexpressing GUS, CrMYC2a, CrMYC2aD126N, AtMYC2 or AtMYCD105N under the CaMV35S promoter. (A) Expression of transcription factors, MIA pathway genes and transporters was measured by qPCR and represented in fold change compared to control samples (infiltrated with pCaMV35S::GUS constructs). (B) High abundant MIAs were measured on LC-ESI-FT-ICR-MS and expressed in average total ion current (TIC). (C) PCA plot and PC loading plot derived from the LC-ESI-FT- ICR-MS metabolome data of flower petals transiently overexpressing GUS, CrMYC2a, CrMYC2aD126N, AtMYC2, or AtMYC2D105N. The color code for the overexpression cassettes is depicted at the bottom of the figure. The error bars designate SE of the mean (n=4). Different letters within each expression series indicate statistically significant differences at P < 0.01 (Tukey's highly significant difference test).
Figure 7. Profiling of MIA pathway gene expression and metabolite accumulation in C. roseus flower petals transiently overexpressing the combination of CrMYC2aD126N, BIS1 and ORCA3 under control of the CaMV35S promoter. (A) Expression of MIA biosynthesis genes and transporters was measured by qPCR and represented in fold change compared to control samples (infiltrated with pCaMV35S::GUS). Error bars designate SE of the mean (n = 4). Different letters within each sample indicate statistically significant differences at P < 0.01 (Tukey's highly significant difference test). (B) LC-ESI-FT-ICR-MS chromatograms of extracts from flowers transiently overexpressing the GUS control (black) and BISl/MYC2aD126N/ORCA3 (red) are depicted. (C) Levels of differentially accumulating high abundant MIAs are expressed in peak area of total ion current (TIC). Error bars designate SE of the mean (n = 4). Different letters within each expression series indicate statistically significant differences at P < 0.01 (Tukey's highly significant difference test). (D) PCA plot and PC loading plot derived from LC-ESI-FT-ICR- MS metabolome data of flower petals transiently overexpressing GUS, MYC2aD126N, ORCA3, BIS1 or the combination of MYC2aD126N, ORCA3 and BIS1.
Figure 8. Analysis of TF amplification loops in the regulation of C. roseus MIA biosynthesis. Expression profile of TFs in C. roseus flower petals transiently overexpressing the combination of CrMYC2aD126N, BIS1 and ORCA3. Expression of MIA regulators was measured by qPCR and represented in fold change compared to control samples (infiltrated with pCaMV35S::GUS). Error bars designate SE of the mean (n = 4). Different letters within each sample indicate statistically significant differences at P < 0.01 (Tukey's highly significant difference test).
Figure 9. A simplified model illustrating the complex transcriptional regulation of the iridoid and MIA pathway. In the absence of stimuli, JAZ repressors bind the JID domain of CrMYC2a and thereby inhibit its transcriptional activity. Upon insect feeding, wounding or JA elicitation, JAZ proteins are degraded, leading to the de-repression of CrMYC2a and consequently direct induction of the whole MIA pathway. Concomitantly, active CrMYC2a induces expression of BIS and ORCA TFs, inserting a second amplification layer in the induction of the MIA pathway. Additionally, BIS1 induces an amplification loop via BIS2, whereas ORCA3 seems to be controlled by an auto-amplification loop and potential cross-amplification loops involving other ORCA3 homologs. In parallel, we postulate that active CrMYC2a induces transcription of JAZ repressors, as in other plant species, resulting in de novo repression of CrMYC2a activity, followed by subsequent downregulation of BIS TFs, ORCA TFs and MIA pathway genes. In the case of the constitutive de-repression due to the D126N amino acid change in CrMYC2a, the negative feedback loop of JAZ is disrupted, resulting in high transcript levels of BIS1, BIS2, ORCA3 and MIA genes. The whole regulatory mechanism is therefore in a free running state leading to a constant high
expression of the MIA pathway genes, resulting in higher accumulation of MIAs. GPP, geranyl diphosphate.
Detailed description of the invention
The present invention will be described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope. The drawings described are only schematic and are non-limiting. In the drawings, the size of some of the elements may be exaggerated and not drawn on scale for illustrative purposes. Where the term "comprising" is used in the present description and claims, it does not exclude other elements or steps. Where an indefinite or definite article is used when referring to a singular noun e.g. "a" or "an", "the", this includes a plural of that noun unless something else is specifically stated. Furthermore, the terms first, second, third and the like in the description and in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein.
Unless otherwise defined herein, scientific and technical terms and phrases used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Generally, nomenclatures used in connection with, and techniques of molecular and cellular biology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. The methods and techniques of the present invention are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, for example, Sambrook et al. Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002); Leach, Molecular Modelling: Principles and Applications, 2d ed., Prentice Hall, New Jersey (2001).
To fend off microbial pathogens and herbivores, plants have evolved a wide range of defense strategies such as physical barriers, or the production of anti-digestive proteins or bioactive specialized metabolites. Accumulation of the latter compounds is often regulated by transcriptional activation of the biosynthesis pathway genes by the phytohormone jasmonate-isoleucine. Applicant has developed a transient expression system in Catharanthus roseus flower petals, thereby creating a rapid and non-labor
intensive screening platform for pathway mapping, gene discovery and assessment of engineering tools (Van Moerkercke et al., 2016). Here, this platform has been employed to further unravel the organization of the regulatory transcription factor circuit that drives MIA biosynthesis in C. roseus. Subsequently, a combinatorial module has been designed of 'wild-type' and engineered, i.e. gain-of-function mutant, versions of three C. roseus transcription factors (TFs) that together boost MIA biosynthesis in a coordinated manner across cell types. Some of these MIAs have highly interesting activities on their own or are base molecules (e.g. strictosidine) for numerous pharmaceutically valuable metabolites including quinine, camptothecin, ajmalicine, serpentine, vinblastine and vincristine.
MIA biosynthesis in C. roseus is organ and cell-type specific and compartmentalized at the cellular and subcellular level (Courdavault et al., 2014; Duge de Bernonville et al., 2015). At the organ level, bisindole alkaloids such as vinblastine and vincristine, as well as vindoline are produced exclusively in the areal parts of the plant, whereas catharanthine accumulates in all organs (Pan et al., 2016; van der Heijden et al., 2004). Other abundant MIAs such as ajmalicine, serpentine and the tabersonine-derived MIAs horhammericine, lochnericine and 19-hydroxytabersonine are mostly present in roots (Laflamme et al., 2001; Pan et al., 2016; Rodriguez et al., 2003; van der Heijden et al., 2004). At the cellular level, the first seven biosynthesis steps from geranyl diphosphate (GPP) to the iridoid loganic acid take place in internal phloem associated parenchyma (IPAP) cells and involve GERANIOL SYNTHASE (GES), 8- HYDROXYGE ANIOL OXIDOREDUCTASE (8HGO), GERANIOL 8-OXIDASE (G80), IRIDOID SYNTHASE (IS), IRIDOID OXIDASE (10), 7-DEOXYLOGANETIC ACID GLUCOSYLTRANSFERASE (7DLGT) and 7- DEOXYLOGANIC ACID HYDROXYLASE (7DLH) (Asada et al., 2013; Geu-Flores et al., 2012; Miettinen et al., 2014; Salim et al., 2014; Simkin et al., 2013). The next four enzymatic steps involving LOGANIC ACID O- METHYLTRANSFERASE (LAMT), SECOLOGANIN SYNTHASE (SLS), TRYPTOPHAN DECARBOXYLASE (TDC) and STRICTOSIDINE SYNTHASE (STR) take place in epidermal cells, resulting in the formation of strictosidine (Courdavault et al., 2014; St-Pierre et al., 1999) (Fig. 1A). Transport of the iridoid intermediate(s) from the IPAP to the epidermal cells involves NITRATE/PEPTIDE FAMILY (NPF) transporters (NPF2.4, NPF2.5, NPF2.6) (Larsen et al., 2017). Likewise, strictosidine is exported from the epidermal vacuole by NPF2.9 (Payne et al., 2017), transported to the nucleus via a yet unknown mechanism and subsequently deglucosylated by STRICTOSIDINE B-GLUCOSIDASE (SGD), resulting in a highly reactive aglycone that can be converted to (i) the corynanthe-type ajmalicine or tetrahydroalstonine by HETEROYOHIMBINE SYNTHASE (HYS) or TETRAHYDROALSTONINE SYNTHASE (THAS), respectively, or (ii) vindoline or catharanthine by the action of multiple enzymes (Courdavault et al., 2014; Stavrinides et al., 2016) (Fig. 1A). The latter involve GEISSOSCHIZINE SYNTHASE 1 and 2 (GS1 and 2) that, in conjunction with GEISSOSCHIZINE OXIDASE (GO), produce preakuammicine, a precursor of both vindoline and catharanthine (Tatsis et al., 2017). The pathway enzymes catalyzing the conversion
of the intermediate preakuammicine to catharanthine or tabersonine remain elusive. In contrast, conversion of tabersonine to vindoline has been resolved and involves the action of seven enzymes spread over three cell types, i.e. the epidermis, the laticifers and the idioblasts (Besseau et al., 2013; Guirimand et al., 2011; Levac et al., 2008; Liscombe et al., 2010; Qu et al., 2015; St-Pierre et al., 1999). The monomeric MIAs vindoline and catharanthine can dimerize to form 3',4'-anhydrovinblastine, the direct precursor of vinblastine and vincristine (van der Heijden et al., 2004).
In a first aspect, a Catharanthus roseus MYC2 protein is provided. More particularly said MYC2 protein has a D to N mutation at a position relative to position 126 of SEQ ID No. 1. Even more particularly, said MYC2 protein has a D to N mutation at position 126 of SEQ ID No. 1.
As used herein, the terms "polypeptide", "protein, "peptide" are used interchangeably and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
A "position relative to position 126" as used herein refers to the precise location of the D (aspartic acid) in the original sequence SEQ ID No. 1. As the D to N mutation at position 126 of SEQ ID No. 1 is crucial to the invention because it makes the activity of the mutated MYC2 independent of JA signaling (i.e. loss of interaction with and loss of repression by JAZ proteins) and thus turns the mutant MYC2 protein into a derepressed form, the upstream amino acid sequence could be modified (e.g. by adding one or more amino acids to the N-terminal part of said MYC2) without losing the characteristics of the depressed MYC2 protein. However, in that case it could be that position 126 does not refer anymore to the crucial D. To make it clear that the D at position 126 of SEQ ID No. 1 should be changed into N, Applicant recites the "relative position", meaning that the precise location of the D could be moved. In case the crucial D to N mutation maintains its position at 126 of said MYC2 protein of the invention, the position relative to position 126 of SEQ ID No. 1 is identical as the position 126 of SEQ ID No. 1.
In a more particular embodiment, said MYC2 protein further comprises a JAZ interacting domain comprising SEQ ID No 7 (VLGWGNGYYKGEEDK) and/or SEQ ID No. 8 (WTYAIFWQXS, wherein X is S or P). In a further particular embodiment, said MYC2 protein comprises a JAZ interacting domain consisting of SEQ ID No 7 (VLGWGNGYYKGEEDK) and/or SEQ ID No. 8 (WTYAIFWQXS, wherein X is S or P). In a more particular embodiment, said MYC2 protein comprises a JAZ interacting domain comprising WTYAIFWQXSXXXFXGXS (SEQ ID No. 9), wherein X can be every amino acid or a gap. In an even more particular embodiment, said MYC2 protein comprises a JAZ interacting domain comprising SEQ ID No 7 (VLGWGNGYYKGEEDK) and WTYAIFWQXSXXXFXGXS (SEQ ID No. 9), wherein X can be every amino acid
or a gap. In a most particular embodiment said MYC2 protein comprises a JAZ interacting domain comprising or consisting of SEQ ID No. 10 (WTYAIFWQSSVVEFAGPSVLGWGNGYYKGEEDK).
The "JAZ interacting domain" of "JID" as used herein is well-known by the skilled person as a conserved amino acid domain which is essential for interaction with JAZ proteins (Fernandez-Calvo et al., 2011 Plant Cell 23: 701-715).
In an even more particular embodiment, said MYC2 protein has at least 90%; at least 91%; at least 92%; at least 93%; at least 94%; at least 95%; at least 96%; at least 97%; at least 98%; at least 99% or at least 99.5% homology to SEQ ID No. 1.
Flomologs of a protein encompass peptides, oligopeptides and polypeptides having amino acid substitutions, deletions and/or insertions, preferably by a conservative change, relative to the unmodified protein in question and having similar biological and functional activity as the unmodified protein from which they are derived; or in other words, without significant loss of function or activity. Orthologs and paralogs, which are well-known terms by the skilled person, define subcategories of homologs and encompass evolutionary concepts used to describe the ancestral relationships of genes. Paralogs are genes within the same species that have originated through duplication of an ancestral gene; orthologs are genes from different organisms that have originated through speciation, and are also derived from a common ancestral gene. Several different methods are known by those of skill in the art for identifying and defining these functionally homologous sequences. General methods for identifying orthologues and paralogues include phylogenetic methods, sequence similarity and hybridization methods. Percentage similarity and identity can be determined electronically. Examples of useful algorithms are PILEUP (Higgins & Sharp, CABIOS 5:151 (1989), BLAST and BLAST 2.0 (Altschul et al. J. Mol. Biol. 215: 403 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). The "homology" or "sequence identity" of two related nucleotide or amino acid sequences, expressed as a percentage, refers to the number of positions in the two optimally aligned sequences which have identical residues (xlOO) divided by the number of positions compared. A gap, i.e., a position in an alignment where a residue is present in one sequence but not in the other is regarded as a position with non-identical residues. The alignment of the two sequences is performed by the Needleman and Wunsch algorithm (Needleman and Wunsch (1970) J Mol Biol. 48: 443-453). The computer-assisted sequence alignment above, can be conveniently performed using standard software program such as GAP which is part of the Wisconsin Package Version 10.1 (Genetics Computer Group, Madison, Wisconsin, USA) using the default scoring matrix with a gap creation penalty of 50 and a gap extension penalty of 3. Sequences are indicated as "essentially similar" when such sequences have a sequence identity of at least about 75%,
particularly at least about 80 %, more particularly at least about 85%, quite particularly about 90%, especially about 95%, more especially about 100%, quite especially are identical.
In most particular embodiments, said MYC2 protein from the invention is a MYC2a protein, more particularly a mutant MYC2a protein, even more particularly a mutant Catharanthus roseus MYC2a protein, most particularly the mutant Catharanthus roseus MYC2a protein as depicted in SEQ ID No. 2. In particular embodiments of the first aspect, the above described MYC2 or MYC2a proteins are recombinantly produced proteins. A "recombinantly produced protein", as used herein, refers to a protein produced by recombinant methods, e.g. recombinant DNA technology. For the purposes of the invention, "recombinant", "transgene" or "transgenic" means with regard to, for example, a protein, a nucleic acid sequence, a chimeric gene construct or a vector comprising said nucleic acid sequence or a cell transformed with the said nucleic acid sequences, chimeric gene constructs or vectors, all those constructions brought about by recombinant methods in which either (a) the nucleic acid sequences encoding proteins useful in the methods of the invention, or (b) genetic control sequence(s) which is operably linked with the nucleic acid sequence according to the invention, for example a promoter, or (c) a) and b) are not located in their natural genetic environment or have been modified by recombinant methods, it being possible for the modification to take the form of, for example, a substitution, addition, deletion, inversion or insertion of one or more nucleotide residues. The natural genetic environment is understood as meaning the natural genomic or chromosomal locus in the original plant or the presence in a genomic library. In the case of a genomic library, the natural genetic environment of the nucleic acid sequence is preferably retained, at least in part. The environment flanks the nucleic acid sequence at least on one side and has a sequence length of at least 50 bp, preferably at least 500 bp, especially preferably at least 1000 bp, most preferably at least 5000 bp. A naturally occurring expression cassette - for example the naturally occurring combination of the natural promoter of the nucleic acid sequences with the corresponding nucleic acid sequence encoding one of the MYC2 or MYC2 proteins described in this specification - becomes a transgenic expression cassette when this expression cassette is modified by non-natural, synthetic ("artificial") methods such as, for example, mutagenic treatment. Suitable methods are described, for example, in US 5,565,350 or WO 00/15815.
In one embodiment, said recombinantly produced protein is a man-made or non-naturally occurring fusion protein.
In a second aspect, a nucleic acid molecule is provided encoding any of the MYC2 or MYC2a proteins described in the first aspect of this specification.
As used herein, the terms "nucleic acid", "polynucleotide", "polynucleic acid" are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown. Non-limiting examples of polynucleotides include a gene, a gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, control regions, isolated RNA of any sequence, nucleic acid probes, and primers. The polynucleotide molecule may be linear or circular. The polynucleotide may comprise a promoter, an intron, an enhancer region, a polyadenylation site, a translation initiation site, 5' or 3' untranslated regions, a reporter gene, a selectable marker or the like. The polynucleotide may comprise single stranded or double stranded DNA or RNA. The polynucleotide may comprise modified bases or a modified backbone. A nucleic acid that is up to about 100 nucleotides in length, is often also referred to as an oligonucleotide.
To express one of the above disclosed nucleic acid molecules, said nucleic acid molecule must be linked operably to or comprise a suitable promoter which expresses said nucleic acid molecule at the right point in time and with the required spatial expression pattern. The term "operably linked" as used herein refers to a linkage in which the promoter or regulatory sequence is contiguous with the gene of interest to control the gene of interest (i.e. initiate the transcription of the gene of interest), as well as a promoter that act in trans or at a distance to control the gene of interest. For example, a DNA sequence is operably linked to a promoter when it is ligated to the promoter downstream with respect to the transcription initiation site of the promoter and allows transcription elongation to proceed through the DNA sequence. Linkage of DNA sequences to regulatory sequences is typically accomplished by ligation at suitable restriction sites or adapters or linkers inserted instead of using restriction endonucleases known to one of skill in the art.
A promoter that enables the initiation of gene transcription in a host cell is referred to as being "active". To identify a promoter which is active in a host cell, the promoter can be operably linked to a reporter gene after which the expression level and pattern of the reporter gene can be assayed. Suitable well- known reporter genes include for example beta-glucuronidase, beta-galactosidase or any fluorescent or luminescent protein. The term "promoter activity" refers to the extent of transcription of a polynucleotide sequence, homologue, variant or fragment thereof that is operably linked to the promoter whose promoter activity is being measured. The promoter activity is assayed by measuring the enzymatic activity of the beta-glucuronidase or beta-galactosidase. Alternatively, promoter strength may also be assayed by quantifying mRNA levels or by comparing mRNA levels of the nucleic acid, with mRNA levels of housekeeping genes such as 18S rRNA, using methods known in the art, such as Northern
blotting with densitometric analysis of autoradiograms, quantitative real-time PCR or RT-PCR (Heid et al., 1996 Genome Methods 6: 986-994).
The promoter linked to the nucleic acid molecule of interest can be the endogenous promoter of said nucleic acid molecule, i.e. the promoter that regulates expression of said nucleic acid molecule as found in nature. Alternatively, the promoter can be an exogenous promoter, i.e. a regulatory nucleic acid sequence which differs from the sequence to which said nucleic acid molecule is associated in nature. Therefore also a chimeric gene is provided in this application, wherein said chimeric gene is a recombinant nucleic acid sequence comprising one of the nucleic acid molecules disclosed in this specification and a promoter or regulatory nucleic acid sequence, wherein said promoter or regulatory nucleic acid sequence of the chimeric gene is not operably linked to the said nucleic acid sequence as found in nature. This is equivalent as saying that said promoter or regulatory nucleic acid sequence to which the nucleic acid molecule is operably linked differs from the promoter or regulatory nucleic acid sequence operably linked or associated with said nucleic acid molecule in the natural environment.
A non-limiting example of an exogenous promoter for expression of a gene of interest in plants is the 35S promoter. The "35S promoter" or the "cauliflower mosaic virus (CaMV) 35S promoter" is a constitutive or constant active promoter that directs high-level expression in a wide range of cells under a wide range of conditions and in most plant tissues including monocots. Examples of other constitutive plant promoters useful for expressing heterologous, modified or non-modified polypeptides in plant cells include, but are not limited to, the nopaline synthase promoter and the octopine synthase promoter. For expression of the nucleic acid molecule encoding one of the MYC2 or MYC2a protein disclosed in this specification in yeast, the "AOX promoter" or "AOX1 promoter" or "inducible AOX1 promoter" that originates from Pichia pastoris can be used. The alcohol oxidase AOX1 and AOX2 promoters are strongly inducible by methanol and are repressed by e.g. glucose. These genes allow Pichia to use methanol as a carbon and energy source. Usually the gene for the desired protein is introduced under the control of the AOX1 promoter, which means that protein production can be induced by the addition of methanol. In a particular embodiment, said chimeric gene comprising a nucleic acid molecule encoding for one of the MYC2 or MYC2a proteins described in this specification operably linked to an endogenous or exogenous promoter, further comprises a 3' polyadenylation and/or transcript termination region. The term "3' polyadenylation and transcript termination region" refers a 3' end region involved in transcription termination or polyadenylation and encompasses a control sequence which is a DNA sequence at the end of a transcriptional unit which signals 3’ processing or polyadenylation of a primary transcript and is involved in termination of transcription. The control sequence for transcription termination or terminator can be derived from a natural gene or from a variety of genes. For expression in plants, the 3’ end sequence to be added may be derived from, for example, the nopaline synthase or
octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic or viral gene. For expression in yeast the terminator to be added may be derived from, for example, the TEF or CYC1 genes or alternatively from another yeast gene or less preferably from any other eukaryotic or viral gene.
A vector comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins disclosed in this specification or a chimeric gene comprising said nucleic acid molecule also forms part of the present invention. Therefore, in a particular embodiment, a vector is provided comprising a nucleic acid molecule encoding any of the MYC2 or MYC2a proteins described in the first aspect of this specification or comprising a chimeric gene comprising said nucleic acid molecule.
The term "vector" as used herein is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid molecule to which it has been linked. The vector may be of any suitable type including, but not limited to, a phage, virus, plasmid, phagemid, cosmid, bacmid or even an artificial chromosome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., vectors having an origin of replication which functions in the host cell). Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and are thereby replicated along with the host genome. In addition to the replication system, there will frequently be (but not necessarily) at least one marker present, which may be useful in one or more hosts, or different markers for individual hosts. The markers may a) code for protection against a biocide, such as antibiotics, toxins, heavy metals, certain sugars or the like; b) provide complementation, by imparting prototrophy to an auxotrophic host: or c) provide a visible phenotype through the production of a novel compound in the plant. Exemplary genes which may be employed include neomycin phosphotransferase (NPTII), hygromycin phosphotransferase (FIPT), chloramphenicol acetyltransferase (CAT), nitrilase, and the gentamicin resistance gene. For plant host selection, non-limiting examples of suitable markers are b-glucuronidase, providing indigo production, luciferase, providing visible light production, Green Fluorescent Protein and variants thereof, NPTII, providing kanamycin resistance or G418 resistance, FIPT, providing hygromycin resistance, and the mutated aroA gene, providing glyphosate resistance.
Additionally, certain preferred vectors are capable of directing the expression of certain genes of interest. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors"). Suitable vectors have regulatory sequences, such as promoters, enhancers, terminator sequences, and the like as desired and according to a particular host organism (e.g. plant cell). Typically, a recombinant vector according to the present invention comprises at least one "chimeric gene" or "expression cassette". Expression cassettes are generally DNA constructs preferably including (5' to 3' in the direction of transcription): a promoter region, a polynucleotide sequence, homologue, variant or
fragment thereof of the present invention operably linked with the transcription initiation region, and a termination sequence including a stop signal for RNA polymerase and a polyadenylation signal. It is understood that all of these regions should be capable of operating in biological cells, such as plant cells, to be transformed. The promoter region comprising the transcription initiation region, which preferably includes the RNA polymerase binding site, and the polyadenylation signal may be native to the biological cell to be transformed or may be derived from an alternative source, where the region is functional in the biological cell.
Additionally, also host cells comprising one of the MYC2 or MYC2a proteins disclosed in this specification or comprising a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or comprising a chimeric gene comprising said nucleic acid molecule or comprising a vector comprising said nucleic acid molecule or said chimeric gene form part of the present invention. Therefore, in other particular embodiments, host cells are provided comprising any of the MYC2 or MYC2a proteins described in the first aspect of this specification of comprising a nucleic acid sequence encoding said MYC2 or MYC2a protein.
In particular embodiments, said host cell is a eukaryotic cell. Eukaryotic cells provided in this application can be of any unicellular or multicellular eukaryotic organism, but in particular embodiments yeast, plant, and algal cells are envisaged, in most particular embodiments, plant cells are envisaged. The nature of the cells used will typically depend on the ease and cost of producing monoterpenoid indole alkaloids (MIAs). It is clear for the skilled person that when using non-plant host cells the necessary molecular framework to produce plant-derived MIAs should be introduced or engineered in said non plant host cells. Therefore, in a preferred embodiment, said host cell is a plant cell. The term "plant" as used herein refers to vascular plants (e.g. gymnosperms and angiosperms). A "plant cell" is understood, according to the invention, as being any cell which is derived from or found in a plant and which is able to form or is part of undifferentiated tissues, such as calli or cell cultures, differentiated tissues such as embryos, parts of plants, plants or seeds.
Given the conservation of the MIA pathway organization, there is no reason to assume that the MYC2 or MYC2a proteins described in this specification or the triple transcription factor cassette (see later) would not work well in other MIA-producing plants, for example to stimulate the production of valuable compounds such as reserpine in Rauwolfia serpentina, camptothecin in Camptotheca acuminata or quinine in Cinchona officinalis (Aerts et al., 1994; Deepthi and Satheeshkumar, 2017; Gundlach et al., 1992; Song and Byun, 1998). Plants that are particularly suitable for the production of MIAs are plants from the genus selected from the group consisting of Catharanthus, Medicago, Rauwolfia, Camptothecal, Cinchona, Arabidopsis and Nicotiana.
Plants or plant cells that are also relevant to this application include, but are not limited to, plants or plant cells of agronomically important crops which are or are not intended for animal or human nutrition, such as maize or corn, wheat, barley, oat, Brassica spp. plants such as Brassica napus or Brassica juncea, soybean, bean, alfalfa, pea, rice, sugarcane, beetroot, tobacco, sunflower, cotton, vegetable plants such as cucumber, leek, carrot, tomato, lettuce, peppers, melon, watermelon, diverse herbs such as oregano, basilicum and mint. It may also be applied to plants that produce valuable compounds, e.g. useful as for instance pharmaceuticals, as ajmalicine, vinblastine, vincristine, ajmaline, reserpine, rescinnamine, camptothecine, ellipticine, quinine, and quinidine, taxol, morphine, scopolamine, atropine, cocaine, sanguinarine, codeine, genistein, daidzein, digoxin, calystegins or as food additives such as anthocyanins, vanillin; including but not limited to the classes of compounds mentioned above. Examples of such plants include, but not limited to, Papaver spp., Rauwolfia spp., Taxus spp., Cinchona spp., Eschscholtzia californica, Camptotheca acuminata, Hyoscyamus spp., Berberis spp., Coptis spp., Datura spp., Atropa spp., Thalictrum spp., Peganum spp. Preferred members of the genus Taxus comprise Taxus brevifolia, Taxus baccata, Taxus cuspidata, Taxus canadensis and Taxus floridana.
According to alternative embodiments, the eukaryotic cells as used to produce the MIAs are not plant cells but for example algal or yeast cells. According to particular embodiments, the yeast cell is a yeast cell of a Saccharomyces species (e.g. Saccharomyces cerevisiae), a Hansenula species (e.g. Hansenula polymorpha), a Yarrowia species (e.g. Yarrowia lipolytica), a Kluyveromyces species (e.g. Kluyveromyces lactis), a Pichia species (e.g. Pichia pastoris) or a Candida species (e.g. Candida utilis). According to further particular embodiments, the algal cells are derived from algae of the genus selected from the group comprising Dunaliella, Chlorella, or Chlamydomonas. In other alternative embodiments, said host cell is a microbial cell. The microbial cells particularly envisioned in current application are bacterial cells and yeast cells.
In another alternative embodiment, the prokaryotic or eukaryotic host cells as used herein themselves do not naturally produce the MIAs of the application, but may do so after genetic engineering. Thus, preferably, host cells artificially producing MIAs of the application refers to cells that, while not naturally having the ability to synthesize the MIAs of the application, have acquired such ability by means of genetic modification processes including transgenesis. Therefore, in another particular embodiment, said host cell is a recombinant host cell. The term "recombinant host cell" ("expression host cell", "expression host system", "expression system" or simply "host cell"), as used herein, is intended to refer to a cell into which a recombinant vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because
certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell" as used herein. A recombinant host cell may be an isolated cell or cell line grown in culture or may be a cell which resides in a living tissue or organism. Host cells can be of bacterial, fungal, plant or mammalian origin.
Thus, in case the host cell is a plant cell then the plant cell as used may be a genetically engineered plant cell, which is a plant cell derived from a recombinant or genetically engineered plant. A "recombinant plant" or a "genetically engineered plant", as used herein, refers to a plant comprising a recombinant polynucleotide and/or a recombinant polypeptide resulting in the expression of one of the MYC2 or MYC2a proteins as disclosed in the first aspect of this specification. In a particular embodiment, a recombinant plant cell is provided comprising one of the MYC2 or MYC2a proteins described in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins.
A recombinant plant refers to a whole plant as well as to a plant part, such as seed, fruit, leaf, or root, plant tissue, plant cells or any other plant material, and progeny thereof. A recombinant plant can be obtained by transforming a plant cell with an expression cassette and regenerating such plant cell into a transgenic, cisgenic or intragenic plant. Such plants can be propagated vegetatively or reproductively. The transforming step may be carried out by any suitable means, including by Agrobacterium-mediated transformation and non-Agrobacterium-med\ated transformation, as discussed further below. Plants can be regenerated from the transformed cell (or cells) by techniques known to those skilled in the art. Where chimeric plants are produced by the process, plants in which all cells are transformed may be regenerated from chimeric plants having transformed germ cells, as is known in the art. Methods that can be used to transform plant cells or tissue with expression vectors include both Agrobacterium and non -Agrobacterium vectors. Agrobacterium- mediated gene transfer exploits the natural ability of Agrobacterium tumefaciens to transfer DNA into plant chromosomes and is described in detail in Gheysen, G., Angenon, G. and Van Montagu, M. 1998. Agrobacterium- mediated plant transformation: a scientifically intriguing story with significant applications. In K. Lindsey (Ed.), Transgenic Plant Research. Harwood Academic Publishers, Amsterdam, pp. 1-33 and in Stafford, H.A. (2000) Botanical Review 66: 99-118. A second group of transformation methods is the non -Agrobacterium mediated transformation and these methods are known as direct gene transfer methods. An overview is brought by Barcelo, P. and Lazzeri, P.A. (1998) Direct gene transfer: chemical, electrical and physical methods. In K. Lindsey (Ed.), Transgenic Plant Research, Harwood Academic Publishers, Amsterdam, pp.35-55. Methods include particle gun delivery, microinjection, electroporation of intact cells, polyethyleneglycol-mediated protoplast transformation, electroporation of protoplasts, liposome-mediated transformation, silicon-
whiskers mediated transformation etc. A suitable control plant would include a genetically unaltered or non-transgenic plant of the parental line (wild type) used to generate a transgenic plant herein.
Particularly useful for current application are genetically transformed hairy root cultures that can be obtained by transformation with virulent strains of Agrobacterium rhizogenes, and can produce high levels of MIAs of current application. Protocols used for establishing of hairy root cultures vary, as well as the susceptibility of plant species to infection by Agrobacterium (Toivounen et al. 1993; Vanhala et al. 1995). It is possible by systematic clone selection e.g. via protoplasts, to find high yielding, stable, and from single cell derived-hairy root clones. This is possible because the hairy root cultures possess a great somaclonal variation. Another possibility of transformation is the use of viral vectors (Turpen 1999). Any plant tissue or plant cell capable of subsequent clonal propagation, whether by organogenesis or embryogenesis, may be transformed with an expression vector of interest. The term 'organogenesis' means a process by which shoots and roots are developed sequentially from meristematic centers; the term 'embryogenesis' means a process by which shoots and roots develop together in a concerted fashion (not sequentially), whether from somatic cells or gametes. The particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed. Exemplary tissue targets include protoplasts, leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g. apical meristems, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyls meristem). Also useful for the industrial production of MIAs are whole transgenic plants. MIAs can then be extracted or isolated from the whole plant or from easily accessible tissue, e.g. leaves. Also particularly useful for current application are cell suspension cultures of plant cells expressing one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing the triple transcription factor cassette (see later) of current application. Suitable cell culture media for eukaryotic cells, in particular plant cells and microbial cells, are known in the art. For plant cells, a number of suitable culture media for callus induction and subsequent growth on aqueous or solidified media are known. Exemplary media include standard growth media, many of which are commercially available (e.g., Sigma Chemical Co., St. Louis, Mo.). Examples include Schenk-Hildebrandt (SH) medium, Linsmaier-Skoog (LS) medium, Murashige and Skoog (MS) medium, Gamborg’s B5 medium, Nitsch & Nitsch medium, White's medium, and other variations and supplements well known to those of skill in the art (see, e.g., Plant Cell Culture, Dixon, ed. I RL Press, Ltd. Oxford (1985) and George et al., Plant Culture Media, Vol 1, Formulations and Uses Exegetics Ltd. Wilts, UK, (1987)). (see, e.g., Plant Cell Culture, Dixon, ed. I RL Press, Ltd. Oxford (1985) and George et al., Plant Culture Media, Vol 1, Formulations and Uses Exegetics Ltd. Wilts, UK, (1987)).
For yeast cells, exemplary media include standard growth media, many of which are commercially available (e.g., Clontech, Sigma Chemical Co., St. Louis, Mo.). Examples include Yeast Extract Peptone Dextrose (YPD or YPED) medium, Yeast Extract Peptone Glycerol (YPG or YPEG) medium, Hartwell's complete (HC) medium, Synthetic complete (SC) medium, Yeast Nitrogen Base (YNB), and other variations and supplements well known to those of skill in the art (see, Yeast Protocol Handbook, Clontech). The incubation conditions (temperature, photoperiod, shaking, auxin/cytokine hormone ratio, promoter inducing conditions, promoter repressing conditions, etc.) will depend, among other factors, on the cells to be incubated and are standard techniques in the art.
In a third aspect, a plant cell is provided comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses the transcriptional activators BIS1 and/or ORCA3. In a particular embodiment, said transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by promoters different to the promoters to which they are naturally associated or linked. In a particular embodiment, said transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by exogenous promoters.
In one embodiment, said transcriptional activator BIS1 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 18. In another embodiment, said transcriptional activator ORCA3 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No. 22.
In yet another embodiment, said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
In yet another embodiment, said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22.
In yet another embodiment, said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No.22.
In a particular embodiment, the plant cell of the third aspect of this specification is a recombinant or genetically engineered plant cell. According to a particularly embodiment, the plant cell of the third aspect of this specification comprises or expresses an exogenous or wholly exogenous MYC2, BIS1 and ORCA3. The term "exogenous" or "heterologous" as used herein is any material originated outside of an organism, tissue, or cell, but that is present (and typically can become active) in that organism, tissue, or cell. Analogously, "endogenous", refers to substances (e.g. genes) originating from within an organism, tissue, or cell. The term "wholly exogenous" as used herein refers to a wholly exogenous protein and means that the whole protein (especially relevant in case of fusion proteins) is exogenous. For example, a plant protein endogenous to a specific plant species will become exogenous after fusion of said endogenous protein with an exogenous protein, for example but without the purpose of limiting the green fluorescent protein (GFP). The term "wholly exogenous" is used when every functional fragment of a fusion protein is exogenous to a specific host.
In particular embodiments, a plant cell is provided comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses an orthologue of the Catharanthus roseus transcriptional activator BIS1 and/or an orthologue of the Catharanthus roseus transcriptional activator ORCA3. In a particular embodiment, said orthologues of the transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by promoters different to the promoters to which they are naturally associated or linked. In a particular embodiment, said orthologues of the transcriptional activators BIS1 and/or ORCA3 are transcriptionally controlled by exogenous promoters. Orthologues of BIS1 that are particularly envisaged are the Medicago truncatula TRITERPENE SAPONIN BIOSYNTHESIS ACTIVATING REGULATOR1 (TSAR1) and TSAR2 proteins (see also Mertens et al 2016 Plant Physiol 170:194-210). In particular embodiments, said orthologue of the Catharanthus roseus transcriptional activator BIS1 is MtTSARl defined by SEQ ID No. 29 or MtTSAR2 defined by SEQ ID No. 30.
Orthologues of ORCA3 can be identified by the presence of one or more conserved domains. In one embodiment, said orthologue of the Catharanthus roseus transcriptional activator ORCA3 comprises one AP2/ERF domain as defined by SEQ ID No. 24. In other embodiments, said ORCA3 orthologue further comprises a C-terminal domain as defined by SEQ ID No. 25 and/or a nuclear localization sequence as defined by SEQ ID No. 26 and/or an acidic domain as defined by SEQ ID No. 27 and/or a serine-rich domain as defined by SEQ ID No. 28.
In another particular embodiment, the plant cell of the third aspect of this specification is provided wherein BIS1 or an orthologue thereof and ORCA3 or an orthologue thereof are overexpressed. Overexpression of a gene of interest can be achieved by adding additional copies of said gene in the host cell of interest. The additional copies of the gene of interest (e.g. BIS1 and/or ORCA3) can be transcriptionally regulated by their endogenous promoter but more preferably by a non-endogenous promoter. The result of said overexpression is that the expression level of a gene of interest exceeds the expression level of said gene in a control host cell. Therefore, this application also provides a plant cell comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses the transcriptional activators BIS1 or an orthologue thereof and/or ORCA3 or an orthologue thereof, wherein the expression levels of BIS1 and/or ORCA3 or said orthologues thereof are at least 10% higher, at least 20% higher, at least 30% higher, at least 40% higher, at least 50% higher, at least 60% higher, at least 70% higher, at least 80% higher, at least 90% higher, at least 100% higher, at least 2-fold higher, at least 3-fold higher, at least 5-fold higher, at least 10-fold higher, between 30% and
150% higher, between 50% and 200% higher or between 2-fold and 8-fold higher than the corresponding expression level of BIS1 and/or ORCA3 of said orthologues thereof in a control plant cell.
In alternative embodiments of the third aspect, a plant cell is provided comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification or expressing a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins, wherein said plant cell further expresses the transcriptional activators BIS2 and ORCA3 or BIS2 and ORCA2 or BIS1 and ORCA2. In a particular embodiment, said transcriptional activators BIS1 and/or BIS2 and/or ORCA2 and/or ORCA3 are transcriptionally controlled by promoters different to the promoters to which they are naturally associated or linked. In a particular embodiment, said transcriptional activators BIS1 and/or BIS2 and/or ORCA2 and/or ORCA3 are transcriptionally controlled by exogenous promoters. BIS2 is a homologue of BIS1 in C. roseus and defined by SEQ ID No. 19, while ORCA2 is a homologue of ORCA3 in C. roseus and defined by SEQ ID No. 31.
In a fourth aspect, a regulatory module is provided comprising one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification and further comprising the transcription factors BIS1 and/or ORCA3, wherein said BIS1 and ORCA3 are transcriptionally controlled by promoters different to the promoters to which BIS1 and ORCA3 are naturally linked or associated.
A "regulatory module" as used herein refers to a combination of at least two transcription factors controlling the expression of one or more genes within one molecular pathway, for example the pathway that leads to the production of monoterpenoid indole alkaloids. The at least two transcription factors can be introduced into a host cell using one or more vectors. Therefore, in one embodiment, a vector is provided comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins described in the first aspect of this specification and a nucleic acid molecule encoding BIS1. In another embodiment, a vector is provided comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins described in the first aspect of this specification and a nucleic acid molecule encoding ORCA3. In yet another embodiment, a vector is provided comprising a nucleic acid molecule encoding one of the MYC2 or MYC2a proteins described in the first aspect of this specification, a nucleic acid molecule encoding BIS1 and a nucleic acid molecule encoding ORCA3.
In a particular embodiment, said regulatory module is a triple transcription factor cassette, consisting of one of the MYC2 or MYC2a proteins disclosed in the first aspect of this specification and the transcription factors BIS1 and ORCA3. Said triple transcription factor cassette can consist of one vector, two vector or three vectors.
In one embodiment, said transcriptional activator BIS1 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 18. In another embodiment, said transcriptional activator ORCA3 has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 90% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No. 22.
In yet another embodiment, said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 90% homology to SEQ ID No. 22.
In yet another embodiment, said transcriptional activator BIS1 has at least 93% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 93% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 95% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 95% homology to SEQ ID No. 22. In yet another embodiment, said transcriptional activator BIS1 has at least 97% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 97% homology to SEQ ID No. 22. In yet another embodiment, said
transcriptional activator BIS1 has at least 99% homology to SEQ ID No. 18 and said transcriptional activator ORCA3 has at least 99% homology to SEQ ID No. 22.
In yet another embodiment, said transcriptional activator BIS1 is defined by SEQ ID No. 18 and said transcriptional activator ORCA3 is defined by SEQ ID No. 22.
In a fifth aspect, the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or of the above described regulatory module is provided to produce at least one monoterpenoid indole alkaloid in a plant cell. Also the use of one of the plant cells described in the third aspect of this specification is provided for the production of at least one MIA. In one embodiment, the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or of the above described regulatory module is provided to enhance the production of at least one monoterpenoid indole alkaloid in a plant cell with at least 10% compared to a control plant cell. In more particular embodiments, said use is provided to enhance the production of at least one monoterpenoid indole alkaloids in a plant cell with at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, at least 10-fold, at least 50-fold, at least 100-fold, between 2- fold and 10-fold or between 5-fold and 100-fold or between 50-fold and 1000-fold compared to a control plant cell. For this aspect of the application, said control plant cell is a plant cell without one of said MYC2 or MYC2a proteins or without the nucleic acid molecule encoding one of said MYC2 or MYC2a proteins or without the above described regulatory module.
In other embodiments, the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins is provided in combination with the expression of the C. roseus BIS1 or an orthologue thereof and/or the C. roseus ORCA3 or an orthologue thereof to produce at least one MIA in a host cell or the increase the production of at least one MIA in a plant cell.
In alternative embodiments, the use of one of the MYC2 or MYC2a proteins described in the first aspect of this specification or of a nucleic acid molecule encoding one of said MYC2 or MYC2a proteins is provided in combination with the expression of the C. roseus BIS2 and ORCA3 or of the C. roseus BIS2 and ORCA2 or of the C. roseus BIS1 and ORCA2 to produce at least one MIA in a host cell or the increase the production of at least one MIA in a plant cell. Said increase in production is defined as at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, at least 10-fold, at least 50-fold, at least 100-fold, between 2-fold and 10-fold or between 5-fold and 100-fold or between 50-fold and 1000-
fold higher compared to a control plant cell. In particular embodiments, BIS1, BIS2, ORCA2, ORCA3 and their orthologues are defined as described in the third aspect of this specification.
In a particular embodiment, said use of the fifth aspect is provided, wherein the at least one monoterpenoid indole alkaloid is a 16-hydroxytabersonine-derived MIA and/or 19-hydroxytabersonine- derived MIA.
In another particular embodiment, said use is provided wherein the at least one monoterpenoid indole alkaloids is selected from the list consisting of strictosidine, catharanthine, 16-hydroxytabersonine, 16- methoxylhorhammericine, horhammericine, serpentine, vindoline, vinblastine, akuammicine, isositsirikine, 16-methoxytabersonine, 3-hydroxy-16-methoxy-2,3-dihydrotabersonine, 19- hydroxytabersonine, 16-hydroxyhorhammericine, minovincinine, vincadifformine, 16- hydroxyvincadifformine, 16-hydroxy-19-0-acetyltabersonine, perivine and O-acetylstemmadine.
In a sixth aspect, a method is provided of producing at least one monoterpenoid indole alkaloid in a host cell, comprising:
- expressing one of the MYC2 or MYC2a proteins described in the first aspect of this specification in a host cell;
- optionally further expressing the C. roseus BIS1 transcription factor or an orthologue thereof and/or the C. roseus ORCA3 transcription factor or an orthologue thereof;
- selecting host cells that produce at least one monoterpenoid indole alkaloid.
In particular embodiments, a method is provided of increasing the production of at least one monoterpenoid indole alkaloid in a host cell, comprising:
- expressing one of the MYC2 or MYC2a proteins described in the first aspect of this specification in a host cell;
- optionally further expressing the C. roseus BIS1 transcription factor or an orthologue thereof and/or the C. roseus ORCA3 transcription factor or an orthologue thereof;
- selecting host cells with increased production of at least one monoterpenoid indole alkaloid compared to control cells not expressing one of said MYC2 of MYC2a proteins.
In alternative embodiments, methods are provided of producing at least one monoterpenoid indole alkaloid in a host cell, said method comprises expressing one of the MYC2 or MYC2a proteins described in the first aspect of this specification in a host cell, expressing the C. roseus BIS1 transcription factor or an orthologue thereof and/or the C. roseus BIS2 transcription factor or an orthologue thereof and/or the C. roseus ORCA2 transcription factor or an orthologue thereof and/or the C. roseus ORCA3 transcription factor or an orthologue thereof, and selecting host cells that produce at least one monoterpenoid indole alkaloid. In other alternative embodiments, method are provided of increasing the production of at least
one monoterpenoid indole alkaloid in a host cell, said method comprises expressing one of the MYC2 or MYC2a proteins described in the first aspect of this specification in a host cell, expressing the C. roseus BIS1 transcription factor or an orthologue thereof and/or the C. roseus BIS2 transcription factor or an orthologue thereof and/or the C. roseus ORCA2 transcription factor or an orthologue thereof and/or the C. roseus ORCA3 transcription factor or an orthologue thereof, and selecting host cells with increased production of at least one monoterpenoid indole alkaloid compared to control cells not expressing one of said MYC2 of MYC2a proteins.
In particular embodiments, said host cell is a eukaryotic cell, more particularly a plant or yeast cell, even more particularly a plant cell.
In more particular embodiments, increased production of at least one MIA means that the production level of said at least one MIA in the selected host cells is at least 10% higher than that of control cells. In even more particular embodiments, said production level is at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 2-fold, at least 5- fold, at least 10-fold, at least 50-fold, at least 100-fold, or between 2-fold and 10-fold, between 10-fold and 100-fold or between 50-fold and 1000-fold higher than that of control cells.
In particular embodiments, BIS1, BIS2, ORCA2, ORCA3 and their orthologues are defined as described in the third aspect of this specification.
The following examples are intended to promote a further understanding of the present invention. While the present invention is described herein with reference to illustrated embodiments, it should be understood that the invention is not limited hereto. Those having ordinary skill in the art and access to the teachings herein will recognize additional modifications and embodiments within the scope thereof. Therefore, the present invention is limited only by the claims attached herein.
EXAMPLES
Example 1. A protoplast-based screen for transcriptional regulator(s) of BIS1 yields no hits from a collection of 'wild-type' C. roseus TFs
Positive amplification loops are a hallmark of the JA-signaling pathway (Memelink, 2009; Pauwels et al., 2009). As such, the expression of the BIS as well as the ORCA and most MIA pathway genes can be induced by JA treatment (data not shown) (Giddings et al., 2011; Liscombe et al., 2010; Miettinen et al., 2014; Van Moerkercke et al., 2016; Van Moerkercke et al., 2015). However, thus far we could not establish an auto-amplification loop for the BIS genes (Van Moerkercke et al., 2016). Furthermore, a direct physical interaction between the BIS TFs and the JAZ repressors is unlikely, because the BIS TFs lack a typical J ID domain. Nevertheless, we mined the C. roseus transcriptomes for CrJAZ genes, cloned
several of them and carried out a yeast two-hybrid (Y2H) assay to test for potential interaction between BIS TFs and JAZ. As recently also suggested (Patra et al., 2018), BIS TFs failed to interact with all tested JAZ proteins (Fig. 2A). This suggests that the JA-elicitation of BIS expression is mediated by another TF that is repressed by JAZ proteins. Such a regulatory loop has been established for the JA-induction of ORCA genes, and as a consequence the downstream epidermis-specific MIA biosynthesis genes, with MYC2 being the responsible JAZ-interacting regulatory TF (Fig. 1A) (Zhang et al., 2011; Zhou and Memelink, 2016). To investigate whether the same or a similar cascade is driving the expression of BIS genes and consequently that of the IPAP-specific iridoid pathway, we tested the transactivation of the BIS1 promoter (pBISl) by JA-modulated, potentially JAZ-interacting C. roseus TFs in our well-established tobacco protoplast-based expression system that we previously used to discover the BIS TFs (Van Moerkercke et al., 2016; Van Moerkercke et al., 2015; Vanden Bossche et al., 2013). CrMYC2 (i.e. CrMYC2a, see later), as well as the Arabidopsis homolog AtMYC2, are both able to transactivate the ORCA3 promoter (pORCA3) but both MYC2 orthologs failed to transactivate pBISl (Fig. 3A), suggesting that CrMYC2 may not be directly regulating BIS1 expression.
The past decade, numerous JAZ-interacting TFs have been identified, mainly in Arabidopsis, including bHLH TFs from the same or other bHLH clades than MYC2, namely clades lllb (the 'ICE' TFs), llld (the 'JAM' TFs), llle (the 'MYC2' TFs) and lllf (the 'GL' TFs) (Chini et al., 2016; De Geyter et al., 2012; Goossens et al., 2016; Fleim et al., 2003; Kazan and Manners, 2012; Pauwels and Goossens, 2011). We therefore screened the available C. roseus transcriptomes for members of these bHLH clades using the Arabidopsis proteins as a bait and cloned them for expression in the protoplast assay. Besides homologs of well- described TFs such as GLABROUS 3 (GL3), JASMONATE ASSOCIATED MYC2-LIKE 1 (JAM1), and INDUCER OF CBP EXPRESSION 1 (ICE1), we also identified two additional C. roseus MYC2 homologs that we named CrMYC2b and CrMYC2c (Fig. 4). The 'original' CrMYC2 was therefore renamed to CrMYC2a here. This nomenclature was chosen to avoid any confusion with previously described bHLH TFs from C. roseus, which are phylogenetically not closely related to CrMYC2a, despite being called CrMYCl, CrMYC3, CrMYC4 and CrMYC5 (Chatel et al., 2003; Zhang et al., 2011) (Fig. 4). Expression of CrMYC2a, CrMYC5, CrJAM2 and CrJAM3 but not of CrMYCl, CrMYC3, CrMYC4, CrICEla, CrICElb and CrGL3 was JA-inducible in plants (data not shown). However, none of the clade III bHLH TFs could transactivate pBISl in the protoplast assay (data not shown).
Besides the clade III bHLH TF BIS, and the ORCA TF-encoding genes, mining of the available C. roseus transcriptome data revealed numerous other JA-inducible TFs of the WRKY, MYB and NAC families, several of which were included in our screen. However, again none of the tested TFs could transactivate the pBISl fragment in the protoplast assay (data not shown).
Example 2. Contrary to wild-type MYC2 versions and de-repressed mutant CrMYC2b and CrMYC2c, de- repressed mutant CrMYC2a transactivates pBISl and pORCA3 in tobacco protoplasts
Because protoplasting is known to trigger JA signaling (Birnbaum et al., 2003), we postulated that endogenous tobacco JAZ proteins may repress the transcriptional activity of bHLH TFs containing JID domains such as CrMYC2a-c, possibly leading to false negatives. To explore this hypothesis, we tested whether de-repressed CrMYC2 mutants could transactivate pBISl. In Arabidopsis, in contrast to wild- type AtMYC2, the available de-repressed AtMYC2D105N mutant (Goossens et al., 2015) was capable to transactivate pBISl around eightfold (Fig. 3A), suggesting it is involved in direct regulation of BIS1 expression and that its wild-type activity is limited by interaction with JAZ proteins. Accordingly, transactivation of pORCA3 by AtMYC2D105N was fivefold stronger than by wild-type AtMYC2 (Fig. 3A). The JAZ/MYC2 regulatory complex is widely conserved among the plant kingdom (Chini et al., 2016; Wasternack and Strnad, 2018). Likewise, the negatively charged aspartate (D) at position 105 of AtMYC2 that causes the de-repression phenotype is strictly conserved among all Arabidopsis and C. roseus clade llle bHLH TFs and corresponds to D126 of CrMYC2a, D60 of CrMYC2b and D53 of CrMyc2c (Fig. 5). To assess whether the same mutation in CrMYC2a-c would also trigger de-repression and transactivation of MIA pathway gene promoters, we engineered a de-repressed CrMYC2a (CrMYC2aD160N), CrMYC2b (CrMYC2bD60N) and CrMYC2c (CrMYC2cD50N). Surprisingly, only CrMYC2aD126N could transactivate pBISl, pBIS2, pORCA2 and pORCA3 in BY-2 protoplasts (Fig. 3A; Fig. 3D-G), supporting a role for CrMYC2a, but not CrMYC2b or CrMYC2c, as an indirect regulator of MIA biosynthesis gene expression.
To confirm that the mutation in CrMYC2aD126N affects the interaction with JAZ proteins, as it does in AtMYC2D105N, we carried out a Y2H assay (Fig. 3B). CrMYC2a and AtMYC2 both interacted with all tested CrJAZ proteins. The mutant version of CrMYC2a lost its capacity to interact with CrJAZ3 and CrJAZ8, whereas the interaction with CrJAZl, 2, 4 and 7 was maintained. In comparison, the mutant version of AtMYC2 did no longer interact with CrJAZl, 2, 3 and 8, whereas interaction with CrJAZ4 and CrJAZ7 was also maintained. Generally, these Y2H results are in agreement with those published in other studies and that have shown a loss of interaction of AtMYC2D105N with most Arabidopsis JAZ proteins as well as a maintained ability to interact with some of them (Frerigmann et al., 2014; Goossens et al., 2015).
Originally, CrMYC2a was discovered in a yeast-one hybrid (Y1H) screen for activators of the STR promoter (pSTR), but has so far not been shown to transactivate pSTR in any plant system (Chatel et al., 2003; Paul et al., 2017; Pre et al., 2000; Zhang et al., 2011). Here, we corroborate these Y1H data by demonstrating that both the de-repressed AtMYC2D105N and CrMYC2aD126N can transactivate pSTR in tobacco protoplasts, contrary to the wild-type versions (Fig. 3A). Together, this also supports a role for CrMYC2a as a direct regulator of MIA biosynthesis gene expression. To assess whether this applies to the whole
MIA pathway, we tested transactivation of the available promoters of other MIA pathway genes. Indeed, CrMYC2aD126N, but not CrMYC2a was capable of transactivating the GES, 8HGO, IS, 10, SLS, TDC and SGD promoters (Fig. 3C).
Example 3. Transient expression of de-repressed AtMYC2 or CrMYC2a induces expression of MIA pathway genes in C. rose us flower petals and leads to increased strictosidine accumulation
To assess the potential of de-repressed AtMYC2 and CrMYC2a mutants to stimulate MIA biosynthesis gene expression in plcrnta, they were transiently overexpressed in C. roseus flower petals using Agrobacterium tumefaciens infiltration. In accordance with the tobacco protoplast assays, overexpression of de-repressed AtMYC2 or CrMYC2a mutants resulted in a strong upregulation of MIA pathway genes in comparison to control petals transformed with a pCaMV35S::GUS construct (Fig. 6A and data not shown). Overall, overexpression of CrMYC2aD126N and AtMYC2D105N caused similar induction patterns, both in terms of the identity of the MIA pathway genes and the fold-induction, although CrMYC2aD126N had a particularly stronger effect on the induction of the BIS and ORCA genes than AtMYC2D105N. Both de-repressed MYC2 TFs also strongly induced the expression of genes encoding the NPF iridoid and strictosidine transporters (Fig. 6A and data not shown). Unexpectedly, also TABERSONINE 19-HYDROXYLASE (T19H), MINOVINCININE-19-O-ACETYLTRANSFERASE (MAT) and the recently published homolog TABERSONINE DERIVATIVE 19-O-ACETYLTRANSFERASE (TAT), normally specifically expressed in roots and involved in the biosynthesis of root-specific MIAs such as horhammericine (Giddings et al., 2011; Laflamme et al., 2001), were pronouncedly induced by the de- repressed MYC2 TFs (Fig. 6A and data not shown). So far, no positive regulators have been described for these transporter or root-specific MIA biosynthesis genes. Notably, despite the strong upregulation of pathway genes for specific MIAs such as strictosidine, horhammericine or ajmalicine, the expression of the vindoline pathway genes, i.e., TABERSONINE 16-HYDROXYLASE 2 (T16H2), TABERSONINE 16-0- METHYLTRANSFERASE (T160MT), DESACETOXYVINDOLINE 4-HYDROXYLASE (D4H) or DEACETYLVINDOLINE O-ACETYLTRANSFERASE (DAT) was not induced by the overexpression of de- repressed MYC2s (data not shown). Qu et al. (2018) recently published the missing enzymatic steps between geissoschizine and tabersonine or catharanthine, i.e. Redoxl, Redox2, SAT, HL1 and HL2 (Fig. 1A). Similar to the vindoline pathway, the genes coding for these newly discovered enzymes were not induced by the overexpression of de-repressed MYC2s (data not shown). This correlates with the observation that those genes are not JA-inducible either; hence, their expression may be subject to other regulatory cues.
Conversely, overexpression of wild-type AtMYC2 had no significant effect on MIA pathway gene expression, whereas that of wild-type CrMYC2a resulted in a transcriptional induction of the BIS1 and
BIS2 genes, although 6- to 9-fold less than by CrMYC2aD126N overexpression (Fig. 6A and data not shown). Presumably as an indirect effect caused by BIS upregulation, also a minor induction of some IPAP-specific iridoid genes, e.g. of GES, 8HGO and IS, was observed by CrMYC2a overexpression (Fig. 6A and data not shown). The expression profile of the epidermis-specific late iridoid and MIA pathway genes did not significantly differ between control flowers or those overexpressing wild-type MYC2s, which correlates with the lack of induction of ORCA2 or ORCA3 (Fig. 6 and data not shown).
Next, we carried out metabolite profiling by liquid chromatography Fourier-transform ion cyclotron resonance mass spectrometry (LC-FT-ICR-MS) to verify whether the transcriptional upregulation of the MIA pathway in the de-repressed AtMYC2 or CrMYC2a overexpressing petals leads to an increased accumulation of MIAs. This analysis revealed that strictosidine levels were increased approximately five fold in flowers overexpressing de-repressed AtMYC2 or CrMYC2a. Levels of other detectable MIAs, such as catharanthine, vindoline and vinblastine, did not change (Fig. 6B). To further evaluate the impact of de-repressed MYC2s on the metabolome, the LC-FT-ICR-MS data were used for a principal component analysis (PCA) (Fig. 6C). The metabolomes of the various petal samples clustered in two distinguishable groups with one group containing the samples from flowers transformed with the pCaMV35S::GUS, pCaMV35S::CrMYC2a and pCaMV35S::AtMYC2 constructs and the other group containing those from flowers transformed with pCaMV35S::CrMYC2aD126N or pCaMV35S::AtMYC2D105N. The PCA loading control confirmed that strictosidine is the most important variable explaining the observed distribution pattern in the PCA (Fig. 6C). Four additional compounds show a comparable distribution pattern to strictosidine and strongly accumulated in pCaMV35S::CrMYC2aD126N and pCaMV35S::AtMYC2D105N expressing flowers (Fig. 6C). Based on accurate mass and MSn fragmentation data, these peaks were shown to correspond to a strictosidine dimer, strictosidine hexoside, strictosidine secologanoside (a bahenioside A-like metabolite) and a low abundant, unknown metabolite (Fig. 6C).
Taken together, our findings show that overexpression of de-repressed CrMYC2aD126N and AtMYC2D105N upregulates the expression of the genes encoding the known iridoid and MIA regulators, early MIA enzymes and transporters, with the exception of the vindoline and catharanthine branch enzymes, in C. roseus petals, which finally leads to a marked increase in the accumulation of strictosidine.
Example 4. Transient overexpression of the CrMYC2a homologs CrMYC2b and CrMYC2c in C. roseus flower petals has no effect on the MIA pathway
We transiently overexpressed CrMYC2b and CrMYC2c as well as their de-repressed forms (CrMYC2bD60N and CrMYC2cD53N) in C. roseus flower petals. However, none of the overexpression constructs resulted in an upregulation of the vindoline or catharanthine pathway genes, nor any of the
other iridoid or MIA pathway genes as observed with CrMYC2aD126N (Table 1). These data are in line with the above observed difference between the de-repressed CrMYC2 mutants.
3 HL1 1 ± 0.13 1.18 ±0.17 1.04 ±0.09 0.93 ±0.14 1.14 ±0.14 1.76 ±0.23* 0.95 ±0.07
-<
n
n HL2 1 ± 0.13 1.55 ±0.1* 0.99 ± 0.04 1.12 ±0.1 2.29 ±0.2** 0.93 ±0.03 0.93 ±0.1
O T16H1 1 ± 0.04 1.53 ±0.11** 1.28 ±0.05** 1.12 ±0.09 1.22 ±0.05* 0.79 ±0.17 0.95 ±0.07 o n
IL T16H2 1±0.1 1.29 ±0.08 0.76 ±0.06 1 ± 0.15 0.33 ±0.09** 0.78 ±0.2 0.67 ±0.11 c 1 ± 0.09 1.03 ±0.16 0.99 ±0.13 1 ± 0.08 0.49 ±0.03** 0.65 ±0.24 0.8 ±0.03
IL -< 160MT
O
3 T30 1 ± 0.05 1.83 ±0.17** 2.54 ±0.14*** 1.28 ±0.19 2.64 ±0.3** 1.73 ±0.36 1.07 ±0.11 n
r-y T3R 1±0.1 0.56 ±0.11* 0.95 ± 0.04 0.85 ± 0.03 0.47 ±0.04** 0.55 ±0.1* 0.73 ±0.1
O O
NMT 1 ± 0.08 0.93 ±0.17 0.69 ± 0.06* 0.96 ± 0.09 0.49 ±0.05** 1.48 ±0.12* 0.89 ± 0.07
-<
n n D4H 1 ± 0.22 1.74 ±0.05* 0.95 ±0.14 0.67 ±0.11 0.95 ±0.39 1.12 ±0.13 0.44 ±0.02* o- DAT 1 ± 0.05 0.88 ±0.1 0.7 ±0.09* 0.77 ±0.1 0.62 ±0.09* 1.53 ±0.37 0.57 ±0.09**
-< o
O s> TAT 1 ± 0.29 1.61 ±0.15 1.5 ±0.14 0.52 ±0.08 11.47 ±1.27*** 0.88 ±0.36 0.61 ±0.34 o
O C. roseus agro-infiltrated flower petals from four biological replicates were analyzed by qPCR. Values ± SE of the mean are normalized fold-changes relative to a 35S::GUS control infiltration.
Statistical significance was determined by the Student's t-test (*P < 0.05, **P < 0.01, ***P < 0.001).
Example 5. Combinatorial overexpression of CrMYC2aD126N, BIS1 and ORCA3 in flower petals has synergistic effects on MIA pathway gene induction
This and previous studies start to shape (part of) the regulatory network of MIA biosynthesis, and accredit defined roles to CrMYC2a, BIS and ORCA TFs (Fig. 1A) (Montiel et al., 2011; Van Moerkercke et al., 2015; Zhang et al., 2011; Zhou and Memelink, 2016). We next wondered whether a combination of overexpression of BIS, ORCA and de-repressed MYC2 TFs would amplify MIA biosynthesis additively or rather surprisingly synergistically.
Therefore, we transiently transformed C. roseus flowers by infiltration with A. tumefaciens containing BIS1, ORCA3 or CrMYC2aD126N overexpression cassettes, either in a single, a double (pairwise), or the triple combination. First, we assessed the effect on gene expression. Generally, overexpression of either BIS1 or ORCA3 confirmed the previously reported specificities for the MIA pathway branches. BIS1 strongly upregulated all IPAP-specific iridoid pathway genes as well as the BIS2 TF, whereas no effect was observed for MIA pathway genes, hence mirroring the patterns previously obtained in other expression systems (Van Moerkercke et al., 2015) (Fig. 7A; Table 2). Unexpectedly, overexpression of ORCA3 also led to a marked upregulation of several of the iridoid pathway genes, but the overall effect was clearly weaker when compared to flowers expressing BIS1 or CrMYC2aD126N, suggesting this may be an indirect effect, for instance by an (indirect) induction of BIS expression (Fig. 7A; Table 2). In contrast, ORCA3 overexpression, similar to CrMYC2aD126N overexpression but distinct from BIS1 overexpression, clearly induced the seco-iridoid and MIA pathway genes downstream from 7DLH, as well as of the (seco-)iridoid and strictosidine transporters NPF2.6 and NPF2.9 and MIA pathway genes such as GS1, GS2, T19H and MAT (Fig. 7A). Further comparison of expression profiles revealed that only CrMYC2aD126N overexpression led to induction of the MIA pathway genes SGD, HYS, GO and TAT and the iridoid transporter NPF2.5, and that these genes were not affected by BIS1 or ORCA3 overexpression (Fig. 7A).
Combined overexpression of CrMYC2aD126N and BIS1 or of ORCA3 and BIS1 did not have marked synergistic effects, in contrast to combined overexpression of CrMYC2aD126N and ORCA3, which led to a synergistic upregulation of iridoid and MIA pathway genes such as GES, 8FIGO, G80, IS, 10, GS2, T19FI, MAT and TAT (Fig. 7A; Table 2). Flowever, synergistic effects were most pronounced in the triple-TF combination, in particular for the gene set mentioned above (Fig. 7A; Table 2). Synergistic activity was most pronounced (over 1,100-fold induction) for T19FI and MAT, two genes that are normally expressed at very low level in flowers. Notably, we did not observe any induction of vindoline pathway genes or the recently described Redoxl, Redox2, SAT, HL1 and H L2 genes with any of the TF combinations (Table 2)·
35S::GUS 35S::CrMYC2aD126N 35S::ORCA3 35S::BIS1 35S::ORCA3 35S::ORCA3 35S::BIS1 Triple
35S::CrMYC2aD126N 35S::BIS1 35S::CrMYC2aD126N
O
MYC2a 1 + 0.04 6.9 + 0.48*** 1.16 + 0.12** 1.13 + 0.15** 5.56 + 0.48*** 1.26 + 0.02 7.01 + 0.66*** 6.02 + 0.45*** O
BIS1 1 + 0.16 49.06 + 3.42*** 6.57 + 1.35** 413.86 + 16.95*** 51.65 + 2.29*** 224.97 + 19.83*** 388.51 + 40.47*** 258.84 + 34.98**1
BIS2 1 + 0.28 155.52 ± 26.3** 34.44 + 6.71** 207.66 + 31.1*** 632.42 + 19.14*** 95.96 + 9*** 157.04 ± 29.01 941.66 + 142.09**
ORCA2 1 + 0.08 2.71 + 0.14*** 0.85 + 0.1 0.84 + 0.04** 2.11 + 0.11*** 1.02 + 0.08 3.62 + 0.37*** 1.62 + 0.17
ORCA3 1 + 0.11 36.31 ± 7.76** 1964.04 + 162.58*** 4.17 + 1.75* 1638.36 ± 312.84** 1696.22 ± 123.82*** 20.5 + 5.89 1963.22 + 261.75*1
ORCA4 1 + 0.18 6.97 + 1.08** 1.49 + 0.44 1.9 + 0.44* 4.88 + 0.54*** 1.26 + 0.33 3.56 + 0.89 5.33 + 1.51
ORCA5 1 + 1 254.83 ± 57.98** 61.75 ± 26.71 60.69 ± 13.74* 142.41 ± 32.76** 13.83 ± 5.18 72.16 ± 21.12 146.38 ± 31.69 GES 1 + 0.23 1271.92 ± 36.56*** 161.75 ± 42.26** 1082.59 + 96.3*** 2510.8 + 330.03*** 591.11 ± 104.71 914.87 + 100.33*** 4462.52 + 545.62*1
8HGO 1 + 0.07 12.17 ± 3.25** 3.07 + 0.43** 26.02 + 5.75** 48.43 + 3.54*** 10.93 ± 2.31 23.24 ± 4.11 85.25 ± 20.17
G80 1 + 0.04 50.66 + 4.46*** 9.89 + 2.22** 87.4 + 7.85*** 167.88 + 20.67*** 37.72 + 1.93*** 48.57 + 4.75*** 189.85 ± 42.37
IS 1 + 0.24 1677.04 + 88.06*** 270.65 + 47.1** 3713.16 ± 283.8*** 4148.33 + 370.24*** 1389.23 ± 283.14 2297.63 + 214.4*** 5365.99 ± 1469.1-
10 1 + 0.02 50.5 + 5.45*** 9.76 + 2.13** 76.3 + 3.95*** 140.43 + 16.58*** 42.46 + 1.73*** 36.49 + 3.8*** 163.72 + 11.69**1
7DLGT 1 + 0.07 4.81 + 0.5*** 1.63 + 0.09** 6.03 + 0.48*** 9.65 + 0.39*** 3.67 + 0.05*** 4.98 + 0.35*** 15.32 + 0.67*** w 7DLH 1 + 0.06 0.69 + 0.04 1.22 + 0.04 0.87 + 0.07** 1.07 + 0.02 1.03 + 0.07 0.71 + 0.05 1.03 + 0.08
NPF2.4 1 + 0.07 0.87 + 0.09 1.01 + 0.07 0.8 + 0.04* 1.13 + 0.04 0.99 + 0.08 1.45 + 0.12 0.93 + 0.08
NPF2.5 1 + 0.19 13.1 + 1.74*** 0.76 + 0.04 1.24 + 0.27** 6.32 + 0.7*** 0.78 + 0.16 13.14 ± 2.47 8.73 + 1.59
NPF2.6 1 + 0.02 2.39 + 0.42** 2.08 + 0.14*** 0.85 + 0.07** 4.75 + 0.24*** 2.03 + 0.23 3.14 + 0.48 5.05 + 0.95
LAMT 1 + 0.13 25.38 + 2.07*** 6.13 + 0.4*** 1.42 + 0.25** 32.01 + 3.43*** 5.7 + 0.24*** 20.19 ± 3.89 39.62 + 7.7
SLS 1 + 0.05 3.1 + 0.24*** 3.76 + 0.29*** 1.16 + 0.1** 6.92 + 0.51*** 3.63 + 0.36*** 3.33 + 0.31*** 7.38 + 1.51
TDC 1 + 0.13 5.58 + 0.21*** 6.33 + 0.25*** 1.29 + 0.11** 10.71 + 0.5*** 5.98 + 0.36*** 5.22 + 0.44*** 10.77 + 1.26***
STR 1 + 0.1 2.64 + 0.29** 5.08 + 0.42*** 1.19 + 0.12** 7.35 + 0.74*** 5.43 + 0.75 2.99 + 0.19*** 7.8 + 1.27 NPF2.9 1 + 0.11 4.54 + 0.33*** 3.07 + 0.35** 0.82 + 0.05** 4.41 + 0.17*** 2.77 + 0.21*** 2.84 + 0.2*** 6.91 + 0.49***
SGD 1 + 0.09 3.19 + 0.34*** 1.5 + 0.21 1.47 + 0.34** 6.4 + 0.64*** 1.42 + 0.28 3.58 + 0.36*** 5.39 + 1.01 n H
HYS 1 + 0.12 4.77 + 0.74** 0.69 + 0.03* 1.27 + 0.26** 3.96 + 0.76** 0.62 + 0.02 5.67 + 0.78*** 3.13 + 0.26***
GS1 1 + 0.04 1.65 + 0.08*** 2.27 + 0.07*** 0.97 + 0.11** 4.11 + 0.21*** 2.15 + 0.13*** 1.82 + 0.19 4.4 + 0.28*** kί o
GS2 1 + 0.07 5.08 + 0.57*** 6.23 + 0.36*** 1.14 + 0.05** 16.85 + 2.13*** 5.86 + 0.56*** 5.02 + 1.05 18.21 + 1.28*** o o\ bo
Table 2. qPCR showing the effect of single, double or triple transient overexpression of CrMYC2aD126N,
0RCA3 and BIS1 on the expression of MIA biosynthesis genes in C. roseus petals.
As we were also interested in potential amplification loops, we assessed expression of the TFs themselves, including CrMYC2a, the two BIS homologs, and the four ORCA homologs, i.e. ORCA2 to ORCA5 (Paul et al., 2017) (Fig. 8). qPCR targeting the 3' untranslated region (3'UTR) of CrMYC2a suggested no autoregulation or cross-regulation by ORCA3 or BIS1 overexpression. In agreement with our previous reports, BIS2 expression was markedly upregulated by BIS1 overexpression, over 200-fold (Van Moerkercke et al., 2016). Likewise, overexpression of CrMYC2aD126N led to a strong upregulation of the expression of both BIS TFs, ca. 50- and 150-fold, respectively. ORCA3 overexpression also induced the expression of BIS1 and BIS2, but weaker, respectively less than 10- and 40-fold, respectively. Notably, combined overexpression of CrMYC2aD126N and ORCA3 had a strong synergistic effect on the expression of BIS2 (over 600-fold) but not on that of BIS1. Expression of endogenous ORCA3 was ca. 5- fold upregulated by either BIS1 or ORCA3 overexpression. This can be considered as only a minor, possibly indirect effect, given the almost 90-fold induction observed with CrMYC2aD126N overexpression, which is in agreement with the known direct regulation. A similar pattern was also observed for ORCA5, but not ORCA2 or ORCA4 (Fig. 8). In contrast to the pathway genes themselves, no combinatorial or synergistic effects on TF gene expression could be spotted in the double or triple TF combinations, except for BIS2.
To correlate CrMYC2aD126N mediated transactivation with the possible presence of potential cis- regulatory elements, we searched the promoters of all MIA pathway genes for canonical MYC2 binding motifs (Godoy et al 2011). In general, we noticed that promoter sequences (2 kb upstream of the start codon) of the MIA pathway and transporter genes contained on average 1.7 potential MYC2 binding boxes (data not shown). Promoters of genes that could not be induced by CrMYC2aD126N overexpression contained on average 1.5 binding elements whereas, CrMYC2aD126N inducible promoters contained on average 1.88 binding elements. Noteworthy, the promoters containing 3 or more potential MYC2-binding domains such as LAMT (5), STR (5), T19H (4), HYS (4), TAT (3), 10 (3) and G80 (3) are all strongly up-regulated in CrMYC2aD126N overexpressing flowers, suggesting some correlation, although weak, between the number of potential MYC2 binding elements and inducibility by CrMYC2aD126N.
Taken together, these findings further support that the expression of MIA pathway genes, as well as the transporter and TF genes, are orchestrated by the combinatorial action of TFs such as CrMYC2a, BIS1 and ORCA3 (see the model proposed in Fig. 9).
Example 6. Combinatorial overexpression of CrMYC2aD126N, BIS1 and ORCA3 is necessary and sufficient to elicit MIA accumulation in flower petals
To further explore the individual and combinatorial effects of the three TFs and to correlate gene expression with metabolite production, we carried out metabolite profiling by LC-FT-ICR-MS. First, the positive effect of CrMYC2aD126N overexpression on strictosidine accumulation was further increased (though not statistically significant) by the triple-TF infiltration, in agreement with the synergistic effects on MIA biosynthesis gene expression. Overexpression of BIS1 or ORCA3 did not affect strictosidine levels (Fig. 7B and C; Table 3). Likewise, no effect was observed on the levels of other abundant MIAs such vindoline, catharanthine, serpentine and vinblastine by any of the TF infiltrations (Table 3), which is in agreement with the observed lack of induction of the vindoline pathway genes. However, chromatogram comparisons displayed a number of prominently increased peaks, besides that corresponding to strictosidine, in the triple-TF infiltrated flowers, for instance at retention time (RT) 13.46 and 14.07 (Fig. 7B). The first peak corresponded to a compound with a parent [M+H]+ ion at m/z 353.1858 and accumulated up to 10-fold more in triple-TF infiltrated flowers compared to the control GUS-infiltrated flowers (Fig. 7B; Table 3). Based on MS fragmentation, this compound was identified as 16- hydroxytabersonine, a vindoline precursor, the identity of which was further confirmed by a standard synthesized in yeast. 16-hydroxytabersonine also accumulated two- to three-fold more in flowers overexpressing ORCA3 and CrMYC2aD126N, respectively, but not in BISl-overexpressing flowers (Fig. 7C; Table 3). The second peak corresponded to a compound with a parent [M+H]+ ion at m/z 625.1762 and was accumulating 4.5-fold higher in triple-TF infiltrated flowers. MS fragmentation suggested this compound to be a flavonoid, most likely an isomer of rhamnetin 3-rutinoside. Given that this putative flavonoid also showed increased accumulation in the ORCA3-overexpressing flowers but not in the CrMYC2aD126N- or BISl-overexpressing flowers, this effect seems to be strictly related to the overexpression of ORCA3, hence we did not further focus on it in this study.
Two other peaks, with RTs at 9.03 and 10.32 and parent [M+H]+ ions at m/z 369.1807 and 399.1913, respectively, were dramatically increased in the triple-TF infiltrated flowers. The increased accumulation amounted up to over 2,300-fold in the triple-TF infiltrated flowers and were barely detectable in samples derived from the GUS control or single-TF infiltrated flowers (Fig. 7B and C; Table 3). Surprisingly, based on MS fragmentation, these compounds were identified as the postulated root-specific MIAs horhammericine (identity confirmed with an authentic standard) and 16-methoxyhorhammericine, also known as horhammerinine (Fig. 7B and C; Table 3) (Abraham and Farnsworth, 1969). Additional novel peaks, potentially corresponding to strictosidine derivatives (including bis(monoterpenoid) indole alkaloids such as strictosidine secologanatoside and strictosidine secologanoside) and other MIAs, showed a similar marked increase in the triple-TF infiltrated flowers, but their identity could not unambiguously be determined (Table 3).
To further investigate the effects of the single- and triple-TF combinations on the flower metabolome, PCA was carried out (Fig. 7D). Samples of BISl-overexpressing flowers largely overlapped with those of the control, but all others formed distinct groups, with the triple-TF infiltrated flowers showing the most divergent distribution pattern. According to the PCA loading plot, distribution of PCI was mainly explained by variables corresponding to the above-mentioned differentially accumulating MIAs. Conversely, PC2 seemed to be mostly influenced by compounds related to flavonoids such as the tentatively annotated rhamnetin 3-rutinoside, explaining the distribution pattern of the samples infiltrated with the ORCA3 TF.
The observation that combinatorial overexpression of TFs in flowers had no effect on the accumulation of catharanthine and vindoline, but could boost the production of certain MIAs, encouraged us to take a closer look at potential MIA intermediates and final MIA products (Fig. 1A and B). Based on MS fragmentation and standards, we identified and quantified 18 additional MIAs (Table 3). As recently published, most intermediates between the strictosidine aglycone and tabersonine or catharanthine are unstable, hypothetical or not detectable in planta, which explains why we were not able to detect for instance deshydroxymethylstemmadenine or the critical intermediate stemmadenine (Qu et al 2018). Nevertheless, we observed an important increase of O-acetylstemmadenine (>6-fold) and 'early- branching' MIAs such as akuammicine (>14-fold), perivine (>7-fold) and isositsirikine (>5-fold) in triple- TF infiltrated flowers and to lesser extent in flowers infiltrated with 35S::CrMYC2aD126N, which correlated with the high induction observed for GS1, GS2 and GO (Fig. 1A and 7A; Table 3). Besides the above-mentioned 16-hydroxytabersonine, the subsequent downstream intermediates of the vindoline pathway, 16-methoxytabersonine and 3-hydroxy-16-methoxy-2,3-dihydrotabersonine, accumulated only poorly in control samples, but showed nevertheless slightly increased levels in triple-TF infiltrated
flowers (Table 3). The last precursors and derivate compounds in the vindoline pathway, like deacetylvindoline, desacetoxyvindoline and demethoxyvindoline, were relatively highly abundant, but remained unchanged among all samples (Table 3). In contrast to the 16-hydroxytabersonine-derived MIAs that are normally produced in the aerial plant parts, the 19-hydroxytabersonine-derived MIAs, such as horhammericine, are normally produced in roots (Giddings et al., 2011). Considering the dramatic increase of root-specific MIAs, we screened our data for other MIAs in this specific branch (Fig. 7C and IB). Similar to horhammericine, most root-specific MIAs were barely detectable in the control flowers, but displayed a massively increased accumulation in triple-TF infiltrated flowers, including 19- hydroxytabersonine (>90-fold), 16-hydroxyhorhammericine (not detectable in control flowers), minovincinine (>320-fold), vincadifformine (>170-fold) and 16-hydroxyvincadifformine (>220-fold) (Table 3). Surprisingly, although expression of MAT and TAT was strongly increased in triple-TF infiltrated samples, we were not able to detect any previously described acetylated MIAs such as echitovenine, 19- O-acetylhorhammericine or 19-O-acetyltabersonine (Giddings et al., 2011; Laflamme et al., 2001). Instead we detected an over 8,300-fold increased accumulation of an acetylated compound in triple-TF infiltrated samples that we tentatively identified as 16-hydroxy-19-0-acetyltabersonine (Table 3). This acetylated MIA, at the detection limit in all single TF infiltrated samples, is most likely the result of a concerted reaction involving T16FI and the highly expressed T19FI and TAT in a yet undiscovered order. 16-methoxy-19-0-acetyltabersonine, a similarly acetylated MIA could be produced in yeast in a previous study, confirming that C-16 hydroxylation and C-19 hydroxylation/acetylation can occur on the same molecule (Carqueijeiro et al 2018 TPJ 94:469-484).
Taken together, metabolite profiling reveals that combinatorial overexpression of BIS1, ORCA3 and CrMYC2aD126N has a tremendous effect on the general MIA profile, an effect which cannot be obtained with single TFs, and correlating with the MIA pathway gene induction that they trigger together.
Example 7. Identification of orthologous genes of BIS1
As shown by the phylogenetic analysis in Figure 4, BIS1 (Caros001862.1) and BIS2 (Caros006385.1) are clade IVa bH LH transcription factors. This clade is characterized by the absence of a JAZ interacting domain. Orthologues in Arabidopsis thaliana are At2g22750 (bHLH18), At4g37850 (bHLH25), At2g22760 (bHLH19) and At2g22770 (bHLH20). Orthologues Medicago truncatula are MtTSARl (SEQ ID No. 29) and MtTSAR2 (SEQ ID No. 30) (see Mertens et al 2016 Plant & Cell Physiology 57:2564-2575).
Example 8. Identification of orthologous genes of ORCA3
ORCA3 belongs to the AP2/ERF (formerly called AP2/EREBP) subfamily of AP2-domain proteins (Fujimoto et al., 2000 Plant Cell 12:393-404; Riechmann and Meyerowitz, 1998 Biol Chem 379:633-646) with a
single AP2 domain (SEQ ID No. 24). In contrast, the AP2 subfamily contains two AP2 domains. In addition, the amino acid sequences of the AP2 domain and the AP2/ERF domain are quite divergent (for details see Fujimoto et al., 2000 Plant Cell 12:393-404). When ORCA3 is aligned with a number of functionally characterized AP2/ERF-type proteins from different plant species (NtEREBP-1, NtEREBP-2, NtEREBP-3, NtEREBP-4, AtERFl, AtERF2, AtERF3, AtERF4, AtERF5, LePti4, LePti5, LePti6, CrORCAl, CrORCA2), a high level of homology within the AP2/ERF domain is found (see Figure 2a in van der Fits and Memelink 2001 TPJ 25:43-53). Based on sequence and structural homology, several conserved domains can be pointed out in the ORCA3 protein. ORCA3 forms part of a subgroup of AP2/ERF-domain proteins having a conserved C-terminal extension of the AP2/ERF domain of about 20 amino acids (SEQ ID No. 25). Outside the AP2/ERF domain, little or no homology with other AP2/ERF-domain proteins is observed. The AP2/ERF domain of ORCA3 contains a putative bipartite nuclear localization signal (SEQ ID No. 26). In the N-terminus of the ORCA3 protein, an acidic domain can be pointed out (SEQ ID No. 27). Furthermore, a serine-rich region is present in the C-terminus of the ORCA3 protein (SEQ ID No. 28).
Flomologues in C. roseus are the ORCA2 protein (GenBank: CAB93940.1) and the ORCA3-like protein 1 from C. roseus with accession or sequence ID ANC60170.1 (51% identity).
Orthologues of ORCA3 in Datura mete! are the AP2-binding DNA-binding domain protein with accession or sequence ID ABU40945.1 (98% identity).
Conclusion
Metabolic pathways are regulated and fine-tuned in a complicated way and increased induction of pathway gene expression does not necessarily lead to increased flux through the pathway or increased accumulation of the desired metabolites. This is particularly applicable to the MIA pathway with its numerous branches and high degree of cellular and organellar compartmentalization. For instance, overexpression of BIS1 or CrMYC2a in C. roseus flower petals had no effect on the level of the 24 flower MIAs identified here. Overexpression of ORCA3 and CrMYC2aD126N resulted in a statistically significant increase in the levels of six and nine of these MIAs, respectively. Flowever, a MIA pathway-encompassing effect, leading to a dramatic increase in the levels of 23 MIAs was only obtained by the triple-TF combination, i.e. when wild-type BIS1 and ORCA3, and the de-repressed CrMYC2aD126N were concomitantly transiently overexpressed. This demonstrates that an intelligent and inventive design of combinatorial TF cassettes allows to create superior engineering tools, even encompassing transcriptional regulation across multiple cell types in a single engineering event.
In conclusion, we here provide a broad view on the hierarchy, range, and cell type- and pathway branch- specificity of and within a specific JA-modulated regulatory module that involves CrMYC2a, BIS and ORCA TFs. This view is visualized in a simplified model (Fig. 9). Elements of the network that have been exposed
include: (i) the first direct regulator of SGD expression, namely CrMYC2a, which is particularly valuable because SGD represents the gateway towards all MIAs, (ii) the TFs regulating directly and indirectly the expression of known (seco)iridoid MIA transporters, which is crucial given the spatial distribution of the MIA pathway across cell types and compartments, (iii) the capacity of a combinatorial TF cassette to induce a genuine MIA pathway, thereby overruling previously anticipated organ-specific boundaries such as the unexpected induction of the postulated root-specific T19FI, MAT and TAT genes, (iv) the existence of amplification loops or TF cascades, e.g. positioning CrMYC2a as a strong and direct inducer of BIS and ORCA expression, and (v) the existence of negative feedback loops as evidenced by the fact that an engineered, de-repressed CrMYC2a variant needed to be employed to enable its activity in the absence of the JA signal.
Materials and methods
Plant material and transformation
Flower petals of one-year-old Catharanthus roseus var. "Little bright eyes" plants (grown under greenhouse conditions) were infiltrated with Agrobacterium tumefaciens C58C1 harboring the respective constructs for overexpression (see below) as previously described (Van Moerkercke et al., 2016), with slight modifications. One day prior to the infiltration experiment, all open flowers were removed from the plants. The day of infiltration, liquid A. tumefaciens cultures were washed, resuspended and diluted to a final OD=0.3 in infiltration buffer (100 mM acetosyringone, 10 mM MgCI2, 20 mM MES) and left shaking for 3 h. Petals of freshly opened flowers were pierced with a needle and then infiltrated with a 1-mL syringe containing the A. tumefaciens solution. After 48 h of incubation, petals from five different flowers per sample were cut in two and immediately flash-frozen in liquid nitrogen. One sample was used for RNA extraction for gene expression analysis and the other sample was used for metabolite profiling.
Generation of DN A constructs
Constructs were made with the Gateway® Technology (Invitrogen). ENTRY clones containing AtMYC2, AtMYC2D105N, CrMYC2a, BIS1 and ORCA3 had been generated previously (Goossens et al., 2015; Van Moerkercke et al., 2015). For all other transcription factors used in this study, the coding sequences were amplified from C. roseus var. "Little bright eyes" cDNA with Q5® High-Fidelity DNA Polymerase (New England BioLabs®) and gene-specific oligonucleotides containing attB Gateway® recombination sites. The fragments were gel-purified (GeneJET Gel Extraction Kit, ThermoFisher) and recombined into pDONRTM221 using Gateway® BP clonaseTM II enzyme mix (ThermoFisher); the resulting ENTRY clones were sequenced. CrMYC2aD126N, CrMYC2bD60N, and CrMYC2cD53N were constructed by overlap
extension PCR using the ENTRY clones as templates. For expression in flower petals under control of the CaMV35S promoter or promoter transactivation assays, ENTRY clones were recombined into pK7WG2D or p2GW7 (Karimi et al., 2002), respectively, using LR ClonaseTM enzyme mix (ThermoFisher). The promoter fragments of GES, G80, 8FIGO, IS, 10, 7DLGT, 7DLFI, LAMT, STR and BIS1 had been cloned previously (Van Moerkercke et al., 2016; Van Moerkercke et al., 2015; Vom Endt et al., 2007). The promoter fragments (including 5' UTRs) of SLS (1413bp), TDC (2353 bp) and SGD (1651 bp) were amplified from C. roseus var. "Little bright eyes" genomic DNA and recombined into ENTRY vectors. ENTRY clones containing promoter fragments were recombined into pGWL7 (Karimi et al., 2002) for transient expression assays.
Phylogenetic analysis
Amino acid sequences of full-length proteins of C. roseus and A. thaliana were aligned using ClustalW. A neighbor-joining tree was constructed in MEGA6 (Tamura et al., 2013). Evolutionary distances were calculated using the Jones, Taylor, and Thornton (JTT) model. Bootstrap analyses were performed with 1,000 bootstrap replicates. bHLH clades were defined as in Heim et al. (2003).
Protein interaction assays in yeast
Y2H assays were performed as described (Cuellar Perez et al., 2013). Bait and prey were fused to the GAL4-AD or GAL4-BD via cloning into pGAD424gate or pGBT9gate, respectively. The Saccharomyces cerevisiae PJ69-4A yeast strain was co-transformed with bait and prey using the polyethylene glycol (PEG)/lithium acetate method. Positive transformants were selected on Synthetic Defined (SD) medium lacking Leu and Trp (-2) (Clontech). Colonies were grown overnight in liquid cultures (-2) at 30°C and 10- or 100-fold dilutions were dropped on control medium (-2) and selective medium lacking Leu, Trp and His (-3) (Clontech).
Transient expression assays in N. tabacum protoplasts
Transactivation of C. roseus gene promoters by C. roseus TFs was assessed in transient expression assays in N. tabacum 'Bright Yellow-2' protoplasts as described (Vanden Bossche et al., 2013). Protoplasts were co-transfected with reporter, effector and normalizer plasmids. The reporter plasmid consists of a fusion between the promoter of interest and the FIREFLY LUCIFERASE (fLUC) gene. The effector plasmid contains the TF of interest driven by the CaMV35S promoter. The normalizer plasmid contains the RENILLA LUCIFERASE (rLUC) driven by the CaMV35S promoter. fLUC and rLUC readouts were collected after overnight incubation and lysis using the Dual-Luciferase Reporter Assay System (Promega). Each assay incorporated four or eight biological repeats. Normalized values of the promoter activities were
obtained by dividing the fLUC values by the corresponding rLUC values. The average of the normalized fLUC values was calculated and set out relative to the control fLUC values (i.e. with an effector plasmid carrying the GUS gene instead of a TF gene).
Transcript profiling by qPCR
RNA from agro-infiltrated flower petals was extracted using the RNeasy Plant Mini kit (Qiagen) including an additional DNA on-column digest with RQ1 DNase (Promega). Up to 500 ng of RNA was used as a template for reverse transcription with the iScriptTM cDNA synthesis kit (Bio-Rad). qPCR was performed, on a LightCycler® 480 (Roche) using SYBR Green qPCR master Mix (Agilent) and gene-specific oligonucleotides (Table S6) in two technical replicates. The data was normalized to two reference genes, N2227 and SAND (Pollier et al., 2014) using qBase (Hellemans et al., 2007).
Metabolite profiling
For metabolite profiling, infiltrated petals were snap-frozen and ground in liquid nitrogen. After lyophilization, around 5 mg of dry petal tissue was weighed and extracted with 1 mL of methanol containing 100 mM caffeine as an internal standard. The samples were extracted at room temperature for 10 min and centrifuged for 10 min at 20,800 x g. The resulting supernatant was evaporated to dryness under vacuum, and the residue was dissolved in 800 pL of water/cyclohexane (1:1, v/v). The samples were centrifuged (10 min at 20,800 x g), and 200 pL of the aqueous phase was retained for LC-MS analysis. For LC-MS, 10 pL of the sample was injected in a ZORBAX RRHD Eclipse XDB-C18 column (2.1 x 150 mm, 1.8 pm) mounted on a thermo instrument equipped with an LTQ FT Ultra and an electrospray ionization source. The following gradient was run using acidified (0.1% (v/v) formic acid) solvents A (water/acetonitrile (99:1, v/v)) and B (acetonitrile/water; 99:1, v/v)): time 0 min, 5% B; 30 min, 55% B; 35 min, 100% B. FT-MS spectra between m/z 120-1400 were recorded at a resolution of 100,000. For identification, full MS spectra were interchanged with a dependent MS2 scan event in which the most abundant ion in the previous full MS scan was fragmented, two dependent MS3 scan events in which the two most abundant daughter ions were fragmented and a dependent MS4 scan event in which the most abundant granddaughter ion was fragmented. The collision energy was set at 35%. Peak areas were calculated using the Progenesis Ql software and normalized by petal sample mass and the peak area of caffeine. Compounds were identified based on their exact mass, fragmentation and co-elution with authentic standards. Compounds for which no authentic standards are available were tentatively identified based on their exact mass and MSn fragmentation.
The production of the standards 16-hydroxytabersonine and 19-hydroxytabersonine was carried out based in yeast on the biotransformation method reported by Qu et al. (2015) with modifications. Briefly,
T16H2 or T19H were cloned via Gateway recombination into the yeast vector pAG423GAL-ccdB (Alberti et al., 2007) (AddGene plasmid 14149) and co-transformed in the wild-type yeast strain PA59 (Arendt et al., 2017) (MATa; his3Al; leu2A0; ura3A0; lys2A0; trp-1) with the P450 reductase MTR1 (Miettinen et al., 2017) cloned in pAG415GAL-ccdB (Alberti et al., 2007) (AddGene plasmid 14145). Transformed colonies were selected on Synthetic Defined (SD) medium (Clontech) with -His, -Leu (Clontech) amino acid dropouts (DO). For compound production, pre-cultures were grown at 30°C with shaking at 250 rpm for 24 h in 5 mL of liquid SD medium with -His, -Leu DO. To induce gene expression, the precultures were washed and inoculated into 50 mL of SD Gal/Raf medium with -His, -Leu DO supplements to a starting optical density of 0.25. The cultures were incubated for 24 h before addition of 125 mM of tabersonine (dissolved in ethanol) and further incubated for another 48 h. The produced 16-hydroxytabersonine or 19-hydroxytabersonine were extracted from the yeast medium using ethyl acetate and analyzed by LC- FT-ICR-MS as described above.
For details on all metabolite identifications, see Supplemental Dataset SI. The PCA was performed with MetabolAnalyst 3.0 with Pareto-scaled mass spectrometry data and standard settings (http://www.metaboanalyst.ca/) (Xia and Wishart, 2016).
Data deposition
The sequences reported in this paper have been deposited in the GenBank database [accession nos. MG676658 (CrICEla), MG676659 (CrICElb), MG676660 (CrMYC2b), MG676661 (CrMYC2c), MG676662 (CrJAM2), MG676663 (CrJAM3), MG676664 (CrGL3), MG676665 (CrMYBETCla), MG676666 (CrMYBETClb), MG676667 (CrR2R3MYB63). MG676668 (CrR2R3MYB116), MG676669
(CrR2R3MYBTT2a), MG676670 (CrR2R3MYBTT2b), MG676671 (CrANAC002), MG676672 (CrANAC055), MG676673 (CrANAC056), MG676674 (CrWRKY40), MG676675 (CrWRKY75), MG676676 (CrJAZ7), MG676677 (CrJAZ4), MG676678 (pSGD), MG676679 (pSLSl)].
Sequences
The following sequences can be found in the sequence list
SEQ ID No. 1: WT CrMYC2a protein (Catharanthus roseus)
SEQ ID No. 2: Mutant CrMYC2a protein (Catharanthus roseus)
SEQ ID No. 3: WT CrMYC2b protein (Catharanthus roseus)
SEQ ID No. 4: Mutant CrMYC2b protein (Catharanthus roseus)
SEQ ID No. 5: WT CrMYC2c protein (Catharanthus roseus)
SEQ ID No. 6: Mutant CrMYC2c protein (Catharanthus roseus)
SEQ ID No. 7: JAZ interacting domain of CrMYC2a (Catharanthus roseus)
SEQ ID No. 8: JAZ interacting domain of CrMYC2a (Catharanthus roseus)
SEQ ID No. 9: JAZ interacting domain of CrMYC2a (Catharanthus roseus)
SEQ ID No. 10: JAZ interacting domain of CrMYC2a (Catharanthus roseus)
SEQ ID No. 11: WT CrMYC2a DNA (Catharanthus roseus)
SEQ ID No. 12: JAZ interacting domain of CrMYC2a (Catharanthus roseus)
SEQ ID No. 13: WT CrMYC2b DNA (Catharanthus roseus)
SEQ ID No. 14: JAZ interacting domain of CrMYC2b (Catharanthus roseus)
SEQ ID No. 15: WT CrMYC2c DNA (Catharanthus roseus)
SEQ ID No. 16: JAZ interacting domain of CrMYC2c (Catharanthus roseus)
SEQ ID No. 17: WT AtMYC2 DNA (Arabidopsis thaliana)
SEQ ID No. 18: WT BIS1 protein (Catharanthus roseus)
SEQ ID No. 19: WT BIS2 protein (Catharanthus roseus)
SEQ ID No. 20: WT BIS1 DNA (Catharanthus roseus)
SEQ ID No. 21: WT BIS2 DNA (Catharanthus roseus)
SEQ ID No. 22: WT ORCA3 protein (Catharanthus roseus)
SEQ ID No. 23: WT ORCA3 DNA (Catharanthus roseus)
SEQ ID No. 24: AP2/ERF domain of ORCA3 (Catharanthus roseus)
SEQ ID No. 25: C-terminal domain of ORCA3 (Catharanthus roseus)
SEQ ID No. 26: NLS of CrORCA3 of ORCA3 (Catharanthus roseus)
SEQ ID No. 27: Acidic domain of ORCA3 (Catharanthus roseus)
SEQ ID No. 28: Serine-rich domain of ORCA3 (Catharanthus roseus)
SEQ ID No. 29: MtTSARl (Medicago truncatula)
SEQ ID No. 30: MtTSAR2 (Medicago truncatula)
SEQ ID No. 31: ORCA2 protein (Catharanthus roseus)
SEQ ID No. 32: WT AtMYC2 protein (Arabidopsis thaliana)
SEQ ID No. 33: Mutant AtMYC2 protein (Arabidopsis thaliana)
SEQ ID No. 34: JAZ interacting domain of CrMYC2aD126N (Catharanthus roseus) SEQ ID No. 35: JAZ interacting domain of AtMYC2 (Catharanthus roseus)
SEQ ID No. 36: JAZ interacting domain of AtMYC3 (Catharanthus roseus)
SEQ ID No. 37: JAZ interacting domain of AtMYC4 (Catharanthus roseus)
SEQ ID No. 38: JAZ interacting domain of AtMYC5 (Catharanthus roseus)
SEQ ID No. 39: JAZ interacting domain of AtMYC2D105N (Catharanthus roseus) SEQ ID No. 40: JAZ interacting domain of AtMYC3/atr2D (Catharanthus roseus)
References
Abraham, D.J., Farnsworth, N.R., 1969. Structure elucidation and chemistry of Catharanthus alkaloids.
III. Structure of leurosine, an active anticancer alkaloid. J. Pharm. Sci. 58, 694-698.
Aerts, R.J., Gisi, D., De Carolis, E., De Luca, V., Baumann, T.W., 1994. Methyl jasmonate vapor increases the developmental^ controlled synthesis of alkaloids in Catharanthus and Cinchona seedlings. Plant
J. 5, 635-643.
Alberti, S., Gitler, A.D., Lindquist, S., 2007. A suite of Gateway® cloning vectors for high-throughput genetic analysis in Saccharomyces cerevisiae. Yeast. 24, 913-919.
Arendt, P., Miettinen, K., Pollier, J., De Rycke, R., Callewaert, N., Goossens, A., 2017. An endoplasmic reticulum-engineered yeast platform for overproduction of triterpenoids. Metab. Eng. 40, 165-175.
Asada, K., Salim, V., Masada-Atsumi, S., Edmunds, E., Nagatoshi, M., Terasaka, K., Mizukami, H., De Luca, V., 2013. A 7-deoxyloganetic acid glucosyltransferase contributes a key step in secologanin biosynthesis in Madagascar periwinkle. Plant Cell. 25, 4123-4134.
Besseau, S., Kellner, F., Lanoue, A., Thamm, A.M.K., Salim, V., Schneider, B., Geu-Flores, F., Hofer, R., Guirimand, G., Guihur, A., Oudin, A., Glevarec, G., Foureau, E., Papon, N., Clastre, M., Giglioli- Guivarc'h, N., St-Pierre, B., Werck-Reichhart, D., Buriat, V., De Luca, V., O'Connor, S.E., Courdavault, V., 2013. A pair of tabersonine 16-hydroxylases initiates the synthesis of vindoline in an organ- dependent manner in Catharanthus roseus. Plant Physiol. 163, 1792-1803.
Birnbaum, K., Shasha, D.E., Wang, J.Y., Jung, J.W., Lambert, G.M., Galbraith, D.W., Benfey, P.N., 2003. A gene expression map of th e Arabidopsis root. Science. 302, 1956-1960.
Brkljacic, J., Grotewold, E., 2017. Combinatorial control of plant gene expression. Biochim. Biophys. Acta - Gene Regul. Mech. 1860, 31-40.
Brown, S., Clastre, M., Courdavault, V., O'Connor, S.E., 2015. De novo production of the plant-derived alkaloid strictosidine in yeast. Proc. Natl. Acad. Sci. USA. 112, 3205-3210.
Chatel, G., Montiel, G., Pre, M., Memelink, J., Thiersault, M., Saint-Pierre, B., Doireau, P., Gantet, P., 2003.
CrMYCl, a Catharanthus roseus elicitor- and jasmonate-responsive bHLH transcription factor that binds the G-box element of the strictosidine synthase gene promoter. J. Exp. Bot. 54, 2587-2588.
Chini, A., Gimenez-lbanez, S., Goossens, A., Solano, R., 2016. Redundancy and specificity in jasmonate signalling. Curr. Opin. Plant Biol. 33, 147-156.
Courdavault, V., Papon, N., Clastre, M., Giglioli-Guivarc'h, N., St-Pierre, B., Buriat, V., 2014. A look inside an alkaloid multisite plant: the Catharanthus logistics. Curr. Opin. Plant Biol. 19C, 43-50.
Cuellar Perez, A., Pauwels, L., De Clercq, R., Goossens, A., 2013. Yeast two-hybrid analysis of jasmonate signaling proteins. Methods Mol. Biol. 1011, 173-185.
De Geyter, N., Gholami, A., Goormachtig, S., Goossens, A., 2012. Transcriptional machineries in jasmonate-elicited plant secondary metabolism. Trends Plant Sci. 17, 349-359.
Deepthi, S., Satheeshkumar, K., 2017. Cell line selection combined with jasmonic acid elicitation enhance camptothecin production in cell suspension cultures of Ophiorrhiza mungos L. Appl. Microbiol. Biotechnol. 101, 545-558.
Duge de Bernonville, T., Carqueijeiro, L, Lanoue, A., Lafontaine, F., Sanchez Bel, P., Liesecke, F., Musset,
K., Oudin, A., Glevarec, G., Pichon, O., Besseau, S., Clastre, M., St-Pierre, B., Flors, V., Maury, S., Huguet, E., O'Connor, S.E., Courdavault, V., 2017. Folivory elicits a strong defense reaction in Catharanthus roseus : metabolomic and transcriptomic analyses reveal distinct local and systemic responses. Sci. Rep. 7, 40453.
Duge de Bernonville, T., Clastre, M., Besseau, S., Oudin, A., Buriat, V., Glevarec, G., Lanoue, A., Papon, N., Giglioli-Guivarc'h, N., St-Pierre, B., Courdavault, V., 2015. Phytochemical genomics of the Madagascar periwinkle: Unravelling the last twists of the alkaloid engine. Phytochemistry. 113, 9- 23.
Eastman, P., 2011. Oncology drug shortages worsening, threatening patient care. Oncology Times. 33, 14-15.
Facchini, P.J., De Luca, V., 2008. Opium poppy and Madagascar periwinkle: model non-model systems to investigate alkaloid biosynthesis in plants. Plant J. 54, 763-784.
Frerigmann, H., Berger, B., Gigolashvili, T., 2014. bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol. 166, 349-369.
Gasperini, D., Chetelat, A., Acosta, I.F., Goossens, J., Pauwels, L., Goossens, A., Dreos, R., Alfonso, E., Farmer, E.E., 2015. Multilayered organization of jasmonate signalling in the regulation of root growth. PLoS Genet. 11, el005300.
Geu-Flores, F., Sherden, N.H., Courdavault, V., Buriat, V., Glenn, W.S., Wu, C., Nims, E., Cui, Y., O'Connor, S.E., 2012. An alternative route to cyclic terpenes by reductive cyclization in iridoid biosynthesis. Nature. 492, 138-142.
Giddings, L.-A., Liscombe, D.K., Hamilton, J.P., Childs, K.L., DellaPenna, D., Buell, C.R., O'Connor, S.E., 2011. A stereoselective hydroxylation step of alkaloid biosynthesis by a unique cytochrome P450 in Catharanthus roseus. Journal of biological chemistry. 286, 16751-16757.
Goossens, J., Fernandez-Calvo, P., Schweizer, F., Goossens, A., 2016. Jasmonates: signal transduction components and their roles in environmental stress responses. Plant Mol. Biol. 91, 673-689.
Goossens, J., Mertens, J., Goossens, A., 2017. Role and functioning of bHLH transcription factors in jasmonate signalling. J. Exp. Bot. 68, 1333-1347.
Goossens, J., Swinnen, G., Vanden Bossche, R., Pauwels, L., Goossens, A., 2015. Change of a conserved amino acid in the MYC2 and MYC3 transcription factors leads to release of JAZ repression and increased activity. New Phytol. 206, 1229-1237.
Guirimand, G., Guihur, A., Poutrain, P., Hericourt, F., Mahroug, S., St-Pierre, B., Buriat, V., Courdavault, V., 2011. Spatial organization of the vindoline biosynthetic pathway in Catharanthus roseus. J. Plant Physiol. 168, 549-557.
Gundlach, H., Mtiller, M.J., Kutchan, T.M., Zenk, M.H., 1992. Jasmonic acid is a signal transducer in elicitor-induced plant cell cultures. Proc. Natl. Acad. Sci. USA. 89, 2389-2393.
Heim, M.A., Jakoby, M., Werber, M., Martin, C., Weisshaar, B., Bailey, P.C., 2003. The basic helix-loop- helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. Mol. Biol. Evol. 20, 735-747.
Hellemans, J., Mortier, G., De Paepe, A., Speleman, F., Vandesompele, J., 2007. qBase relative quantification framework and software for management and automated analysis of real-time quantitative PCR data. Genome Biol. 8, R19.
Karimi, M., Inze, D., Depicker, A., 2002. GATEWAY™ vectors for Agrobacterium- mediated plant transformation. Trends Plant Sci. 7, 193-195.
Kazan, K., Manners, J.M., 2012. JAZ repressors and the orchestration of phytohormone crosstalk. Trends Plant Sci. 17, 22-31.
Laflamme, P., St-Pierre, B., De Luca, V., 2001. Molecular and biochemical analysis of a Madagascar periwinkle root-specific minovincinine-19-hydroxy-O-acetyltransferase. Plant Physiol. 125, 189-198.
Larsen, B., Fuller, V.L., Pollier, J., Van Moerkercke, A., Schweizer, F., Payne, R., Colinas, M., O'Connor, S.E., Goossens, A., Halkier, B.A., 2017. Identification of iridoid glucoside transporters in Catharanthus roseus. Plant Cell Physiol. 58, 1507-1518.
Levac, D., Murata, J., Kim, W.S., De Luca, V., 2008. Application of carborundum abrasion for investigating the leaf epidermis: molecular cloning of Catharanthus roseus 16-hydroxytabersonine-16-0- methyltransferase. Plant J. 53, 225-236.
Liscombe, D.K., Usera, A.R., O'Connor, S.E., 2010. Homolog of tocopherol C methyltransferases catalyzes N methylation in anticancer alkaloid biosynthesis. Proc. Natl. Acad. Sci. USA. 107, 18793-13798.
Memelink, J., 2009. Regulation of gene expression by jasmonate hormones. Phytochemistry. 70, 1560- 1570.
Menke, F.L.H., Champion, A., Kijne, J.W., Memelink, J., 1999. A novel jasmonate- and elicitor-responsive element in the periwinkle secondary metabolite biosynthetic gene Str interacts with a jasmonate- and elicitor-inducible AP2-domain transcription factor, ORCA2. EMBO J. 18, 4455-4463.
Miettinen, K., Dong, L, Navrot, N., Schneider, T., Buriat, V., Pollier, J., Woittiez, L, van der Krol, S., Lugan, R., lie, T., Verpoorte, R., Oksman-Caldentey, K.-M., Martinoia, E., Bouwmeester, H., Goossens, A., Memelink, J., Werck-Reichhart, D., 2014. The seco-iridoid pathway from Catharanthus roseus. Nat. Commun. 5, 3606.
Miettinen, K., Pollier, J., Buyst, D., Arendt, P., Csuk, R., Sommerwerk, S., Moses, T., Mertens, J., Sonawane, P.D., Pauwels, L, Aharoni, A., Martins, J., Nelson, D.R., Goossens, A., 2017. The ancient CYP716 family is a major contributor to the diversification of eudicot triterpenoid biosynthesis. Nat. Commun. 8, 14153.
Montiel, G., Zarei, A., Korbes, A.P., Memelink, J., 2011. The jasmonate-responsive element from the ORCA3 promoter from Catharanthus roseus is active in Arabidopsis and is controlled by the transcription factor AtMYC2. Plant Cell Physiol. 52, 578-587.
O'Connor, S.E., 2015. Engineering of secondary metabolism. Annu. Rev. Genet. 49, 71-94.
Pan, Q., Saiman, M.Z., Mustafa, N.R., Verpoorte, R., Tang, K., 2016. A simple and rapid HPLC-DAD method for simultaneously monitoring the accumulation of alkaloids and precursors in different parts and different developmental stages of Catharanthus roseus plants. J. Chromatogr. B. 1014, 10-16.
Patra, B., Pattanaik, S., Schluttenhofer, C., Yuan, L, 2018. A network of jasmonate-responsive bHLH factors modulate monoterpenoid indole alkaloid biosynthesis in Catharanthus roseus. New Phytol., in press.
Paul, P., Singh, S.K., Patra, B., Sui, X., Pattanaik, S., Yuan, L, 2017. A differentially regulated AP2/ERF transcription factor gene cluster acts downstream of a MAP kinase cascade to modulate terpenoid indole alkaloid biosynthesis in Catharanthus roseus. New Phytol. 213, 1107-1123.
Pauwels, L, Goossens, A., 2011. The JAZ proteins: a crucial interface in the jasmonate signaling cascade.
Plant Cell. 23, 3089-3100.
Pauwels, L, Inze, D., Goossens, A., 2009. Jasmonate-inducible gene: what does it mean? Trends Plant Sci. 14, 87-91.
Payne, R.M.E., Xu, D., Foureau, E., Teto Carqueijeiro, M.I.S., Oudin, A., Duge de Bernonville, T., Novak, V., Burow, M., Olsen, C.-E., Jones, D.M., Tatsis, E.C., Pendle, A., Halkier, B.A., Geu-Flores, F., Courdavault, V., Nour-Eldin, FI. FI., O'Connor, S.E., 2017. An NPF transporter exports a central monoterpene indole alkaloid intermediate from the vacuole. Nat. Plants. 3, 16208.
Pollier, J., Vanden Bossche, R., Rischer, FI., Goossens, A., 2014. Selection and validation of reference genes for transcript normalization in gene expression studies in Catharanthus roseus. Plant Physiol. Biochem. 83C, 20-25.
Pre, M., Siberil, Y., Memelink, J., Champion, A., Doireau, P., Gantet, P., 2000. Isolation by the yeast one- hybrid system of cDNAs encoding transcription factors that bind to the G-box element of the strictosidine synthase gene promoter from Catharanthus roseus. Int. J. Biochromatogr. 5, 229-244.
Qu, Y., Easson, M.L.A.E., Froese, J., Simionescu, R., Hudlicky, T., De Luca, V., 2015. Completion of the seven-step pathway from tabersonine to the anticancer drug precursor vindoline and its assembly in yeast. Proc. Natl. Acad. Sci. USA. 112, 6224-6229.
Rodriguez, S., Compagnon, V., Crouch, N.P., St-Pierre, B., De Luca, V., 2003. Jasmonate-induced epoxidation of tabersonine by a cytochrome P-450 in hairy root cultures of Catharanthus roseus. Phytochemistry. 64, 401-409.
Roepke, J., Salim, V., Wu, M., Thamm, A.M.K., Murata, J., Ploss, K., Boland, W., De Luca, V., 2010. Vinca drug components accumulate exclusively in leaf exudates of Madagascar periwinkle. Proc. Natl. Acad. Sci. USA. 107, 15287-15292.
Salim, V., Wiens, B., Masada-Atsumi, S., Yu, F., De Luca, V., 2014. 7-deoxyloganetic acid synthase catalyzes a key 3 step oxidation to form 7-deoxyloganetic acid in Catharanthus roseus iridoid biosynthesis. Phytochemistry. 101, 23-31.
Simkin, A.J., Miettinen, K., Claudel, P., Buriat, V., Guirimand, G., Courdavault, V., Papon, N., Meyer, S., Godet, S., St-Pierre, B., Giglioli-Guivarc'h, N., Fischer, M.J.C., Memelink, J., Clastre, M., 2013. Characterization of the plastidial geraniol synthase from Madagascar periwinkle which initiates the
monoterpenoid branch of the alkaloid pathway in internal phloem associated parenchyma. Phytochemistry. 85, 36-43.
Smolen, G.A., Pawlowski, L, Wilensky, S.E., Bender, J., 2002. Dominant alleles of the basic helix-loop- helix transcription factor ATR2 activate stress-responsive genes in Arabidopsis. Genetics. 161, 1235- 1246.
St-Pierre, B., Vazquez-Flota, F.A., De Luca, V., 1999. Multicellular compartmentation of Catharanthus roseus alkaloid biosynthesis predicts intercellular translocation of a pathway intermediate. Plant Cell. 11, 887-900.
Stavrinides, A., Tatsis, E.C., Caputi, L., Foureau, E., Stevenson, C.E.M., Lawson, D.M., Courdavault, V., O'Connor, S.E., 2016. Structural investigation of heteroyohimbine alkaloid synthesis reveals active site elements that control stereoselectivity. Nat. Commun. 7, 12116.
Tamura, K., Stecher, G., Peterson, D., Filipski, A., Kumar, S., 2013. MEGA6: Molecular Evolutionary Genetics Analysis version 6.0. Mol. Biol. Evol. 30, 2725-2729.
Tatsis, E.C., Carqueijeiro, L, Duge de Bernonville, T., Franke, J., Dang, T.-T., Oudin, A., Lanoue, A., Lafontaine, F., Stavrinides, A.K., Clastre, M., Courdavault, V., O'Connor, S.E., 2017. A three enzyme system to generate the Strychnos alkaloid scaffold from a central biosynthetic intermediate. Nat. Commun. 8, 316.
van der Fits, L., Memelink, J., 2000. ORCA3, a jasmonate-responsive transcriptional regulator of plant primary and secondary metabolism. Science. 289, 295-297.
van der Heijden, R., Jacobs, D.I., Snoeijer, W., Hallard, D., Verpoorte, R., 2004. The Catharanthus alkaloids: pharmacognosy and biotechnology. Curr. Med. Chem. 11, 607-628.
Van Moerkercke, A., Steensma, P., Gariboldi, L, Espoz, J., Purnama, P.C., Schweizer, F., Miettinen, K., Vanden Bossche, R., De Clercq, R., Memelink, J., Goossens, A., 2016. The basic helix-loop-helix transcription factor BIS2 is essential for monoterpenoid indole alkaloid production in the medicinal plant Catharanthus roseus. Plant J. 88, 3-12.
Van Moerkercke, A., Steensma, P., Schweizer, F., Pollier, J., Gariboldi, L, Payne, R., Vanden Bossche, R., Miettinen, K., Espoz, J., Purnama, P.C., Kellner, F., Seppanen-Laakso, T., O'Connor, S.E., Rischer, FL, Memelink, J., Goossens, A., 2015. The bHLH transcription factor BIS1 controls the iridoid branch of the monoterpenoid indole alkaloid pathway in Catharanthus roseus. Proc. Natl. Acad. Sci. USA. 112, 8130-8135.
Vanden Bossche, R., Demedts, B., Vanderhaeghen, R., Goossens, A., 2013. Transient expression assays in tobacco protoplasts. Methods Mol. Biol. 1011, 227-239.
Vom Endt, D., Soares e Silva, M., Kijne, J.W., Pasquali, G., Memelink, J., 2007. Identification of a bipartite jasmonate-responsive promoter element in the Catharanthus roseus ORCA3 transcription factor gene that interacts specifically with AT-hook DNA-binding proteins. Plant Physiol. 144, 1680-1689.
Wasternack, C., Hause, B., 2013. Jasmonates: biosynthesis, perception, signal transduction and action in plant stress response, growth and development. An update to the 2007 review in Annals of Botany. Ann. Bot. Ill, 1021-1058.
Wasternack, C., Strnad, M., 2018. Jasmonates are signals in the biosynthesis of secondary metabolites — Pathways, transcription factors and applied aspects— A brief review. New BiotechnoL, in press.
Xia, J., Wishart, D.S., 2016. Using MetaboAnalyst 3.0 for comprehensive metabolomics data analysis.
Curr. Protoc. Bioinform. 55, 14.10. 1-14.10.91.
Zhang, F., Yao, J., Ke, J., Zhang, L., Lam, V.Q., Xin, X.-F., Zhou, X.E., Chen, J., Brunzelle, J., Griffin, P.R., Zhou, M., Xu, H.E., Melcher, K., He, S.Y., 2015. Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling. Nature. 525, 269-273.
Zhang, H., Hedhili, S., Montiel, G., Zhang, Y., Chatel, G., Pre, M., Gantet, P., Memelink, J., 2011. The basic helix-loop-helix transcription factor CrMYC2 controls the jasmonate-responsive expression of the ORCA genes that regulate alkaloid biosynthesis in Catharanthus roseus. Plant J. 67, 61-71.
Zhou, M., Memelink, J., 2016. Jasmonate-responsive transcription factors regulating plant secondary metabolism. BiotechnoL Adv. 34, 441-449.
Claims
1. A Catharanthus roseus MYC2 protein with a D to N mutation at a position relative to position 126 of SEQ ID No. 1.
2. The MYC2 protein according to claim 1 further comprising a JAZ interacting domain comprising SEQ ID No. 7 and/or SEQ ID No. 8.
3. The MYC2 protein according to claim 1 or 2, wherein said protein has at least 90% homology to SEQ ID No. 1.
4. A mutant Catharanthus roseus MYC2a protein as depicted in SEQ ID No. 2.
5. A nucleic acid molecule encoding the MYC2 or MYC2a protein according to any of claims 1-4.
6. A plant cell expressing the nucleic acid molecule of claim 5 or comprising the MYC2 or MYC2a protein according to any of claims 1-4.
7. The plant cell of claim 6 further expressing the transcriptional activators BIS1 and ORCA3.
8. The plant cell of claim 7 wherein the expression level of BIS1 and ORCA3 is at least 10% higher than the corresponding expression level in a control plant cell.
9. A regulatory module comprising the MYC2 or MYC2a protein of any of claims 1-4, further comprising the transcription factors BIS1 and ORCA3, said BIS1 and ORCA3 transcription factors are transcriptionally controlled by promoters different to the promoters to which they are naturally linked.
10. Use of the MYC2 or MYC2a protein according to any of claims 1-4 or the nucleic acid molecule of claim 5 or the regulatory module of claim 9 to produce at least one monoterpenoid indole alkaloid in a host cell.
11. Use of the plant cell according to claim 7 or 8 to enhance the production of at least one monoterpenoid indole alkaloid with at least 10% compared to a control plant cell.
12. The use according to claim 10 or 11 wherein the at least one monoterpenoid indole alkaloid is a 16- hydroxytabersonine-derived MIA and/or a 19-hydroxytabersonine-derived MIA.
13. The use according to any of claims 10-12 wherein the at least one monoterpenoid indole alkaloid is selected from the list consisting of strictosidine, catharanthine, 16-hydroxytabersonine, 16- methoxylhorhammericine, horhammericine, serpentine, vindoline, vinblastine, akuammicine, isositsirikine, 16-methoxytabersonine, 3-hydroxy-16-methoxy-2,3-dihydrotabersonine, 19- hydroxytabersonine, 16-hydroxyhorhammericine, minovincinine, vincadifformine, 16- hydroxyvincadifformine, 16-hydroxy-19-0-acetyltabersonine, perivine and O-acetylstemmadine.
14. A method of producing at least one monoterpenoid indole alkaloid in a host cell, comprising:
a. Expressing the MYC2 or MYC2a protein of any of claims 1-4 in said host cell; b. Optionally further expressing the BIS1 and/or ORCA3 transcription factors;
c. Selecting host cells that produce said at least one monoterpenoid indole alkaloid.
15. Method of increasing the production of at least one monoterpenoid indole alkaloid in a plant cell, comprising:
a. Expressing the MYC2 or MYC2a protein of any of claims 1-4 in said plant cell; b. Optionally further expressing the BIS1 and/or ORCA3 transcription factors; c. Selecting plant cells with an at least 10% increased production of said at least one monoterpenoid indole alkaloid compared to control plant cells not expressing the MYC2 or MYC2a protein of any of claims 1-4.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18172996.3 | 2018-05-17 | ||
| EP18172996 | 2018-05-17 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019219933A1 true WO2019219933A1 (en) | 2019-11-21 |
Family
ID=62244295
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2019/062848 Ceased WO2019219933A1 (en) | 2018-05-17 | 2019-05-17 | An engineered combinatorial module of transcription factors to boost production of monoterpenoid indole alkaloids |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2019219933A1 (en) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113337519A (en) * | 2021-06-03 | 2021-09-03 | 浙江农林大学 | Application of different copies of BrMYC2/3/4 gene in plant growth |
| CN113817034A (en) * | 2021-09-06 | 2021-12-21 | 中国科学院华南植物园 | Application of DoMYC2 in increasing of geraniol content of dendrobium officinale |
| CN114891803A (en) * | 2022-05-30 | 2022-08-12 | 湖南工程学院 | Ginseng PgWRKY40 gene induced by methyl jasmonate and application thereof |
| WO2023196684A3 (en) * | 2022-04-08 | 2023-12-07 | Northeastern University | Genetically engineered plants for increased production of vindoline |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5565350A (en) | 1993-12-09 | 1996-10-15 | Thomas Jefferson University | Compounds and methods for site directed mutations in eukaryotic cells |
| WO2000015815A1 (en) | 1998-09-14 | 2000-03-23 | Pioneer Hi-Bred International, Inc. | Rac-like genes from maize and methods of use |
| WO2018039590A1 (en) * | 2016-08-26 | 2018-03-01 | Board Of Trustees Of Michigan State University | Transcription factors to improve resistance to environmental stress in plants |
-
2019
- 2019-05-17 WO PCT/EP2019/062848 patent/WO2019219933A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5565350A (en) | 1993-12-09 | 1996-10-15 | Thomas Jefferson University | Compounds and methods for site directed mutations in eukaryotic cells |
| WO2000015815A1 (en) | 1998-09-14 | 2000-03-23 | Pioneer Hi-Bred International, Inc. | Rac-like genes from maize and methods of use |
| WO2018039590A1 (en) * | 2016-08-26 | 2018-03-01 | Board Of Trustees Of Michigan State University | Transcription factors to improve resistance to environmental stress in plants |
Non-Patent Citations (121)
| Title |
|---|
| "GenBank database", Database accession no. MG676658 |
| "GenBank database", Database accession no. MG676659 |
| "GenBank database", Database accession no. MG676660 |
| "GenBank database", Database accession no. MG676661 |
| "GenBank database", Database accession no. MG676662 |
| "GenBank database", Database accession no. MG676663 |
| "GenBank database", Database accession no. MG676664 |
| "GenBank database", Database accession no. MG676665 |
| "GenBank database", Database accession no. MG676666 |
| "GenBank database", Database accession no. MG676667 |
| "GenBank database", Database accession no. MG676668 |
| "GenBank database", Database accession no. MG676669 |
| "GenBank database", Database accession no. MG676670 |
| "GenBank database", Database accession no. MG676671 |
| "GenBank database", Database accession no. MG676672 |
| "GenBank database", Database accession no. MG676673 |
| "GenBank database", Database accession no. MG676674 |
| "GenBank database", Database accession no. MG676675 |
| "GenBank database", Database accession no. MG676676 |
| "GenBank database", Database accession no. MG676677 |
| "GenBank database", Database accession no. MG676678 |
| "GenBank database", Database accession no. MG676679 |
| "Plant Cell Culture", 1985, I RL PRESS, LTD. |
| "Plant Cell Culture", 1985, IRL PRESS, LTD. |
| "The basic helix-loop-helix transcription factor BIS2 is essential for monoterpenoid indole alkaloid production in the medicinal plant Catharanthus roseus", PLANT J., vol. 88, 2016, pages 3 - 12 |
| "Transgenic Plant Research", HARWOOD ACADEMIC PUBLISHERS, pages: 1 - 33 |
| ABRAHAM, D.J.FARNSWORTH, N.R.: "Structure elucidation and chemistry of Catharanthus alkaloids. III. Structure of leurosine, an active anticancer alkaloid", J. PHARM. SCI., vol. 58, 1969, pages 694 - 698 |
| AERTS, R.J.GISI, D.DE CAROLIS, E.DE LUCA, V.BAUMANN, T.W.: "Methyl jasmonate vapor increases the developmentally controlled synthesis of alkaloids in Catharanthus and Cinchona seedlings", PLANT J., vol. 5, 1994, pages 635 - 643 |
| ALBERTI, S.GITLER, A.D.LINDQUIST, S.: "A suite of Gateway* cloning vectors for high-throughput genetic analysis in Saccharomyces cerevisiae", YEAST., vol. 24, 2007, pages 913 - 919 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 |
| ARENDT, P.MIETTINEN, K.POLLIER, J.DE RYCKE, R.CALLEWAERT, N.GOOSSENS, A.: "An endoplasmic reticulum-engineered yeast platform for overproduction of triterpenoids", METAB. ENG., vol. 40, 2017, pages 165 - 175, XP029945566, DOI: doi:10.1016/j.ymben.2017.02.007 |
| ASADA, K.SALIM, V.MASADA-ATSUMI, S.EDMUNDS, E.NAGATOSHI, M.TERASAKA, K.MIZUKAMI, H.DE LUCA, V.: "A 7-deoxyloganetic acid glucosyltransferase contributes a key step in secologanin biosynthesis in Madagascar periwinkle", PLANT CELL., vol. 25, 2013, pages 4123 - 4134 |
| AUGUSTIN ET AL., PHYTOCHEMISTRY, vol. 72, 2011, pages 435 - 457 |
| BARCELO, P.LAZZERI, P.A.: "Direct gene transfer: chemical, electrical and physical methods.", 1998, TRANSGENIC PLANT RESEARCH, HARWOOD ACADEMIC PUBLISHERS, pages: 35 - 55 |
| BESSEAU, S.KELLNER, F.LANOUE, A.THAMM, A.M.K.SALIM, V.SCHNEIDER, B.GEU-FLORES, F.HOFER, R.GUIRIMAND, G.GUIHUR, A.: "A pair of tabersonine 16-hydroxylases initiates the synthesis of vindoline in an organ-dependent manner in Catharanthus roseus", PLANT PHYSIOL., vol. 163, 2013, pages 1792 - 1803 |
| BIRNBAUM, K.SHASHA, D.E.WANG, J.Y.JUNG, J.W.LAMBERT, G.M.GALBRAITH, D.W.BENFEY, P.N.: "A gene expression map of the Arabidopsis root", SCIENCE, vol. 302, 2003, pages 1956 - 1960 |
| BRKLJACIC, J.GROTEWOLD, E.: "Combinatorial control of plant gene expression", BIOCHIM. BIOPHYS. ACTA - GENE REGUL. MECH., vol. 1860, 2017, pages 31 - 40, XP029872074, DOI: doi:10.1016/j.bbagrm.2016.07.005 |
| BROWN, S.CLASTRE, M.COURDAVAULT, V.O'CONNOR, S.E.: "De novo production of the plant-derived alkaloid strictosidine in yeast", PROC. NATL. ACAD. SCI. USA., vol. 112, 2015, pages 3205 - 3210, XP055556409, DOI: doi:10.1073/pnas.1423555112 |
| CARQUEIJEIRO ET AL., TPJ, vol. 94, 2018, pages 469 - 484 |
| CHATEL, G.MONTIEL, G.PRE, M.MEMELINK, J.THIERSAULT, M.SAINT-PIERRE, B.DOIREAU, P.GANTET, P.: "CrMYCl, a Catharanthus roseus elicitor- and jasmonate-responsive bHLH transcription factor that binds the G-box element of the strictosidine synthase gene promoter", J. EXP. BOT., vol. 54, 2003, pages 2587 - 2588 |
| CHINI, A.GIMENEZ-LBANEZ, S.GOOSSENS, A.SOLANO, R.: "Redundancy and specificity in jasmonate signalling", CURR. OPIN. PLANT BIOL., vol. 33, 2016, pages 147 - 156 |
| COURDAVAULT, V.PAPON, N.CLASTRE, M.GIGLIOLI-GUIVARC'H, N.ST-PIERRE, B.BURLAT, V.: "A look inside an alkaloid multisite plant: the Catharanthus logistics", CURR. OPIN. PLANT BIOL., vol. 19C, 2014, pages 43 - 50 |
| CUELLAR PEREZ, A.PAUWELS, L.DE CLERCQ, R.GOOSSENS, A.: "Yeast two-hybrid analysis of jasmonate signaling proteins", METHODS MOL. BIOL., vol. 1011, 2013, pages 173 - 185 |
| DE GEYTER, N.GHOLAMI, A.GOORMACHTIG, S.GOOSSENS, A.: "Transcriptional machineries in jasmonate-elicited plant secondary metabolism", TRENDS PLANT SCI., vol. 17, 2012, pages 349 - 359, XP028520086, DOI: doi:10.1016/j.tplants.2012.03.001 |
| DEEPTHI, S.SATHEESHKUMAR, K.: "Cell line selection combined with jasmonic acid elicitation enhance camptothecin production in cell suspension cultures of Ophiorrhiza mungos", L. APPL. MICROBIOL. BIOTECHNOL., vol. 101, 2017, pages 545 - 558 |
| DUGE DE BERNONVILLE, T.CARQUEIJEIRO, I.LANOUE, A.LAFONTAINE, F.SANCHEZ BEL, P.LIESECKE, F.MUSSET, K.OUDIN, A.GLEVAREC, G.PICHON, O: "Folivory elicits a strong defense reaction in Catharanthus roseus: metabolomic and transcriptomic analyses reveal distinct local and systemic responses", SCI. REP., vol. 7, 2017, pages 40453 |
| DUGE DE BERNONVILLE, T.CLASTRE, M.BESSEAU, S.OUDIN, A.BURLAT, V.GLEVAREC, G.LANOUE, A.PAPON, N.GIGLIOLI-GUIVARC'H, N.ST-PIERRE, B.: "Phytochemical genomics of the Madagascar periwinkle: Unravelling the last twists of the alkaloid engine", PHYTOCHEMISTRY, vol. 113, 2015, pages 9 - 23 |
| EASTMAN, P.: "Oncology drug shortages worsening, threatening patient care", ONCOLOGY TIMES., vol. 33, 2011, pages 14 - 15 |
| FACCHINI, P.J.DE LUCA, V.: "Opium poppy and Madagascar periwinkle: model non-model systems to investigate alkaloid biosynthesis in plants", PLANT J., vol. 54, 2008, pages 763 - 784, XP055012554, DOI: doi:10.1111/j.1365-313X.2008.03438.x |
| FERNANDEZ-CALVO ET AL., PLANT CELL, vol. 23, 2011, pages 701 - 715 |
| FITSMEMELINK, TPJ, vol. 25, 2001, pages 43 - 53 |
| FRERIGMANN, H.BERGER, B.GIGOLASHVILI, T.: "bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis", PLANT PHYSIOL., vol. 166, 2014, pages 349 - 369 |
| FUJIMOTO ET AL., PLANT CELL, vol. 12, 2000, pages 393 - 404 |
| GASPERINI, D.CHETELAT, A.ACOSTA, I.F.GOOSSENS, J.PAUWELS, L.GOOSSENS, A.DREOS, R.ALFONSO, E.FARMER, E.E.: "Multilayered organization of jasmonate signalling in the regulation of root growth", PLOS GENET., vol. 11, 2015, pages e1005300 |
| GEORGE ET AL.: "Plant Culture Media", vol. 1, 1987, FORMULATIONS AND USES EXEGETICS LTD |
| GEORGE ET AL.: "Plant Culture Media", vol. 1, 1987, FORMULATIONS AND USES EXEGETICS LTD. |
| GEU-FLORES, F.SHERDEN, N.H.COURDAVAULT, V.BURLAT, V.GLENN, W.S.WU, C.NIMS, E.CUI, Y.O'CONNOR, S.E.: "An alternative route to cyclic terpenes by reductive cyclization in iridoid biosynthesis", NATURE, vol. 492, 2012, pages 138 - 142, XP055556015, DOI: doi:10.1038/nature11692 |
| GIDDINGS, L.-A.LISCOMBE, D.K.HAMILTON, J.PCHILDS, K.L.DELLAPENNA, D.BUELL, C.R.O'CONNOR, S.E.: "A stereoselective hydroxylation step of alkaloid biosynthesis by a unique cytochrome P450 in Catharanthus roseus", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 286, 2011, pages 16751 - 16757 |
| GOOSSENS, J.FERNANDEZ-CALVO, P.SCHWEIZER, F.GOOSSENS, A.: "Jasmonates: signal transduction components and their roles in environmental stress responses", PLANT MOL. BIOL., vol. 91, 2016, pages 673 - 689, XP035995148, DOI: doi:10.1007/s11103-016-0480-9 |
| GOOSSENS, J.MERTENS, J.GOOSSENS, A.: "Role and functioning of bHLH transcription factors in jasmonate signalling", J. EXP. BOT., vol. 68, 2017, pages 1333 - 1347 |
| GOOSSENS, J.SWINNEN, G.VANDEN BOSSCHE, R.PAUWELS, L.GOOSSENS, A.: "Change of a conserved amino acid in the MYC2 and MYC3 transcription factors leads to release of JAZ repression and increased activity", NEW PHYTOL., vol. 206, 2015, pages 1229 - 1237 |
| GUIRIMAND, G.GUIHUR, A.POUTRAIN, P.HERICOURT, F.MAHROUG, S.ST-PIERRE, B.BURLAT, V.COURDAVAULT, V.: "Spatial organization of the vindoline biosynthetic pathway in Catharanthus roseus", J. PLANT PHYSIOL., vol. 168, 2011, pages 549 - 557 |
| GUNDLACH, H.MULLER, M.J.KUTCHAN, T.M.ZENK, M.H.: "Jasmonic acid is a signal transducer in elicitor-induced plant cell cultures", PROC. NATL. ACAD. SCI. USA., vol. 89, 1992, pages 2389 - 2393, XP002314845, DOI: doi:10.1073/pnas.89.6.2389 |
| HEID ET AL., GENOME METHODS, vol. 6, 1996, pages 986 - 994 |
| HEIM, M.A.JAKOBY, M.WERBER, M.MARTIN, C.WEISSHAAR, B.BAILEY, P.C.: "The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity", MOL. BIOL. EVOL., vol. 20, 2003, pages 735 - 747, XP002435312, DOI: doi:10.1093/molbev/msg088 |
| HELLEMANS, J.MORTIER, G.DE PAEPE, A.SPELEMAN, F.VANDESOMPELE, J.: "qBase relative quantification framework and software for management and automated analysis of real-time quantitative PCR data", GENOME BIOL., vol. 8, 2007, pages R19, XP021027351, DOI: doi:10.1186/gb-2007-8-2-r19 |
| HIGGINSSHARP, CABIOS, vol. 5, 1989, pages 151 |
| HUHMAN ET AL., J AGRIC FOOD CHEM, vol. 53, 2005, pages 1914 - 1920 |
| JONAS GOOSSENS ET AL: "Change of a conserved amino acid in the MYC2 and MYC3 transcription factors leads to release of JAZ repression and increased activity", NEW PHYTOLOGIST, vol. 206, no. 4, 1 June 2015 (2015-06-01), GB, pages 1229 - 1237, XP055597086, ISSN: 0028-646X, DOI: 10.1111/nph.13398 * |
| KARIMI, M.INZE, D.DEPICKER, A.: "GATEWAyTM vectors for Agrobacterium-mediated plant transformation", TRENDS PLANT SCI., vol. 7, 2002, pages 193 - 195, XP002714178, DOI: doi:10.1016/S1360-1385(02)02251-3 |
| KAZAN, K.MANNERS, J.M.: "JAZ repressors and the orchestration of phytohormone crosstalk", TRENDS PLANT SCI., vol. 17, 2012, pages 22 - 31, XP028441895, DOI: doi:10.1016/j.tplants.2011.10.006 |
| LAFLAMME, P.ST-PIERRE, B.DE LUCA, V.: "Molecular and biochemical analysis of a Madagascar periwinkle root-specific minovincinine-19-hydroxy-O-acetyltransferase", PLANT PHYSIOL., vol. 125, 2001, pages 189 - 198 |
| LARSEN, B.FULLER, V.L.POLLIER, J.VAN MOERKERCKE, A.SCHWEIZER, F.PAYNE, R.COLINAS, M.O'CONNOR, S.E.GOOSSENS, A.HALKIER, B.A.: "Identification of iridoid glucoside transporters in Catharanthus roseus", PLANT CELL PHYSIOL., vol. 58, 2017, pages 1507 - 1518 |
| LEVAC, D.MURATA, J.KIM, W.S.DE LUCA, V.: "Application of carborundum abrasion for investigating the leaf epidermis: molecular cloning of Catharanthus roseus 16-hydroxytabersonine-16-0-methyltransferase", PLANT J., vol. 53, 2008, pages 225 - 236 |
| LISCOMBE, D.K.USERA, A.R.O'CONNOR, S.E.: "Homolog of tocopherol C methyltransferases catalyzes N methylation in anticancer alkaloid biosynthesis", PROC. NATL. ACAD. SCI. USA., vol. 107, 2010, pages 18793 - 13798 |
| MEMELINK, J.: "Regulation of gene expression by jasmonate hormones", PHYTOCHEMISTRY, vol. 70, 2009, pages 1560 - 1570 |
| MENKE, F.L.H.CHAMPION, A.KIJNE, J.W.MEMELINK, J.: "A novel jasmonate- and elicitor-responsive element in the periwinkle secondary metabolite biosynthetic gene Str interacts with a jasmonate-and elicitor-inducible AP2-domain transcription factor", ORCA2. EMBO J., vol. 18, 1999, pages 4455 - 4463, XP002155761, DOI: doi:10.1093/emboj/18.16.4455 |
| MERTENS ET AL., PLANT & CELL PHYSIOLOGY, vol. 57, 2016, pages 2564 - 2575 |
| MERTENS ET AL., PLANT PHYSIOL, vol. 170, 2016, pages 194 - 210 |
| MIETTINEN, K.DONG, L.NAVROT, N.SCHNEIDER, T.BURLAT, V.POLLIER, J.WOITTIEZ, L.VAN DER KROL, S.LUGAN, R.LIE, T.: "The seco-iridoid pathway from Catharanthus roseus", NAT. COMMUN, vol. 5, 2014, pages 3606, XP055556417, DOI: doi:10.1038/ncomms4606 |
| MIETTINEN, K.POLLIER, J.BUYST, D.ARENDT, P.CSUK, R.SOMMERWERK, S.MOSES, T.MERTENS, J.SONAWANE, P.D.PAUWELS, L.: "The ancient CYP716 family is a major contributor to the diversification of eudicot triterpenoid biosynthesis", NAT. COMMUN, vol. 8, 2017, pages 14153 |
| MONTIEL, G.ZAREI, A.KORBES, A.P.MEMELINK, J.: "The jasmonate-responsive element from the ORCA3 promoter from Catharanthus roseus is active in Arabidopsis and is controlled by the transcription factor AtMYC2", PLANT CELL PHYSIOL., vol. 52, 2011, pages 578 - 587 |
| NATHAN DE GEYTER ET AL: "Transcriptional machineries in jasmonate-elicited plant secondary metabolism", TRENDS IN PLANT SCIENCE, vol. 17, no. 6, 9 March 2012 (2012-03-09), pages 349 - 359, XP028520086, ISSN: 1360-1385, [retrieved on 20120309], DOI: 10.1016/J.TPLANTS.2012.03.001 * |
| NEEDLEMANWUNSCH, J MOL BIOL., vol. 48, 1970, pages 443 - 453 |
| O'CONNOR, S.E.: "Engineering of secondary metabolism", ANNU. REV. GENET., vol. 49, 2015, pages 71 - 94 |
| OSBOURN ET AL., NATURAL PRODUCT REPORTS, vol. 28, 2011, pages 1261 - 1268 |
| PAN QIFANG ET AL: "Monoterpenoid indole alkaloids biosynthesis and its regulation inCatharanthus roseus: a literature review from genes to metabolites", PHYTOCHEMISTRY REVIEWS, KLUWER, NL, vol. 15, no. 2, 1 April 2015 (2015-04-01), pages 221 - 250, XP035928057, ISSN: 1568-7767, [retrieved on 20150401], DOI: 10.1007/S11101-015-9406-4 * |
| PAN, Q.SAIMAN, M.Z.MUSTAFA, N.R.VERPOORTE, R.TANG, K.: "A simple and rapid HPLC-DAD method for simultaneously monitoring the accumulation of alkaloids and precursors in different parts and different developmental stages of Catharanthus roseus plants", J. CHROMATOGR. B., vol. 1014, 2016, pages 10 - 16 |
| PATRA, B.PATTANAIK, S.SCHLUTTENHOFER, C.YUAN, L.: "New Phytol.", 2018, PRESS, article "A network of jasmonate-responsive bHLH factors modulate monoterpenoid indole alkaloid biosynthesis in Catharanthus roseus" |
| PAUL, P.SINGH, S.K.PATRA, B.SUI, X.PATTANAIK, S.YUAN, L.: "A differentially regulated AP2/ERF transcription factor gene cluster acts downstream of a MAP kinase cascade to modulate terpenoid indole alkaloid biosynthesis in Catharanthus roseus", NEW PHYTOL., vol. 213, 2017, pages 1107 - 1123 |
| PAUWELS, L.GOOSSENS, A.: "The JAZ proteins: a crucial interface in the jasmonate signaling cascade", PLANT CELL, vol. 23, 2011, pages 3089 - 3100 |
| PAUWELS, L.INZE, D.GOOSSENS, A.: "Jasmonate-inducible gene: what does it mean?", TRENDS PLANT SCI., vol. 14, 2009, pages 87 - 91, XP025916734, DOI: doi:10.1016/j.tplants.2008.11.005 |
| PAYNE, R.M.E.XU, D.FOUREAU, E.TETO CARQUEIJEIRO, M.I.S.OUDIN, A.DUGE DE BERNONVILLE, T.NOVAK, V.BUROW, M.OLSEN, C.-E.JONES, D.M.: "An NPF transporter exports a central monoterpene indole alkaloid intermediate from the vacuole", NAT. PLANTS., vol. 3, 2017, pages 16208 |
| POLLIER, J.VANDEN BOSSCHE, R.RISCHER, H.GOOSSENS, A.: "Selection and validation of reference genes for transcript normalization in gene expression studies in Catharanthus roseus", PLANT PHYSIOL. BIOCHEM., vol. 83C, 2014, pages 20 - 25, XP029064099, DOI: doi:10.1016/j.plaphy.2014.07.004 |
| PRE, M.SIBERIL, Y.MEMELINK, J.CHAMPION, A.DOIREAU, P.GANTET, P.: "Isolation by the yeast one-hybrid system of cDNAs encoding transcription factors that bind to the G-box element of the strictosidine synthase gene promoter from Catharanthus roseus", INT. J. BIOCHROMATOGR., vol. 5, 2000, pages 229 - 244 |
| QU, Y.EASSON, M.L.A.E.FROESE, J.SIMIONESCU, R.HUDLICKY, T.DE LUCA, V.: "Completion of the seven-step pathway from tabersonine to the anticancer drug precursor vindoline and its assembly in yeast", PROC. NATL. ACAD. SCI. USA., vol. 112, 2015, pages 6224 - 6229, XP055414039, DOI: doi:10.1073/pnas.1501821112 |
| RIECHMANNMEYEROWITZ, BIOL CHEM, vol. 379, 1998, pages 633 - 646 |
| RODRIGUEZ, S.COMPAGNON, V.CROUCH, N.P.ST-PIERRE, B.DE LUCA, V.: "Jasmonate-induced epoxidation of tabersonine by a cytochrome P-450 in hairy root cultures of Catharanthus roseus", PHYTOCHEMISTRY, vol. 64, 2003, pages 401 - 409, XP004448655, DOI: doi:10.1016/S0031-9422(03)00269-3 |
| ROEPKE, J.SALIM, V.WU, M.THAMM, A.M.K.MURATA, J.PLOSS, K.BOLAND, W.DE LUCA, V.: "Vinca drug components accumulate exclusively in leaf exudates of Madagascar periwinkle", PROC. NATL. ACAD. SCI. USA., vol. 107, 2010, pages 15287 - 15292 |
| SALIM, V.WIENS, B.MASADA-ATSUMI, S.YU, F.DE LUCA, V.: "7-deoxyloganetic acid synthase catalyzes a key 3 step oxidation to form 7-deoxyloganetic acid in Catharanthus roseus iridoid biosynthesis", PHYTOCHEMISTRY, vol. 101, 2014, pages 23 - 31 |
| SCHWEIZER FABIAN ET AL: "An engineered combinatorial module of transcription factors boosts production of monoterpenoid indole alkaloids inCatharanthus roseus", METABOLIC ENGINEERING, ACADEMIC PRESS, US, vol. 48, 28 May 2018 (2018-05-28), pages 150 - 162, XP085437894, ISSN: 1096-7176, DOI: 10.1016/J.YMBEN.2018.05.016 * |
| SIMKIN, A.J.MIETTINEN, K.CLAUDEL, P.BURLAT, V.GUIRIMAND, G.COURDAVAULT, V.PAPON, N.MEYER, S.GODET, S.ST-PIERRE, B.: "Characterization of the plastidial geraniol synthase from Madagascar periwinkle which initiates the monoterpenoid branch of the alkaloid pathway in internal phloem associated parenchyma", PHYTOCHEMISTRY, vol. 85, 2013, pages 36 - 43, XP055468224, DOI: doi:10.1016/j.phytochem.2012.09.014 |
| SMOLEN, G.A.PAWLOWSKI, L.WILENSKY, S.E.BENDER, J.: "Dominant alleles of the basic helix-loop-helix transcription factor ATR2 activate stress-responsive genes in Arabidopsis", GENETICS, vol. 161, 2002, pages 1235 - 1246 |
| STAFFORD, H.A., BOTANICAL REVIEW, vol. 66, 2000, pages 99 - 118 |
| STAVRINIDES, A.TATSIS, E.C.CAPUTI, L.FOUREAU, E.STEVENSON, C.E.M.LAWSON, D.M.COURDAVAULT, V.O'CONNOR, S.E.: "Structural investigation of heteroyohimbine alkaloid synthesis reveals active site elements that control stereoselectivity", NAT. COMMUN., vol. 7, 2016, pages 12116, XP055587710, DOI: doi:10.1038/ncomms12116 |
| ST-PIERRE, B.VAZQUEZ-FLOTA, F.A.DE LUCA, V.: "Multicellular compartmentation of Catharanthus roseus alkaloid biosynthesis predicts intercellular translocation of a pathway intermediate", PLANT CELL, vol. 11, 1999, pages 887 - 900 |
| SUZUKI ET AL., PLANT JOURNAL, vol. 32, 2002, pages 1033 - 1048 |
| TAMURA, K.STECHER, G.PETERSON, D.FILIPSKI, A.KUMAR, S.: "MEGA6: Molecular Evolutionary Genetics Analysis version 6.0.", MOL. BIOL. EVOL., vol. 30, 2013, pages 2725 - 2729 |
| TATSIS, E.C.CARQUEIJEIRO, I.DUGE DE BERNONVILLE, T.FRANKE, J.DANG, T.-T.OUDIN, A.LANOUE, A.LAFONTAINE, F.STAVRINIDES, A.K.CLASTRE,: "A three enzyme system to generate the Strychnos alkaloid scaffold from a central biosynthetic intermediate", NAT. COMMUN, vol. 8, 2017, pages 316, XP055587754, DOI: doi:10.1038/s41467-017-00154-x |
| VAN DER FITS, L.MEMELINK, J.: "ORCA3, a jasmonate-responsive transcriptional regulator of plant primary and secondary metabolism", SCIENCE, vol. 289, 2000, pages 295 - 297, XP000938409, DOI: doi:10.1126/science.289.5477.295 |
| VAN DER HEIJDEN, R.JACOBS, D.I.SNOEIJER, W.HALLARD, D.VERPOORTE, R.: "The Catharanthus alkaloids: pharmacognosy and biotechnology", CURR. MED. CHEM., vol. 11, 2004, pages 607 - 628, XP009075461, DOI: doi:10.2174/0929867043455846 |
| VAN MOERKERCKE, A.STEENSMA, P.SCHWEIZER, F.POLLIER, J.GARIBOLDI, I.PAYNE, R.VANDEN BOSSCHE, R.MIETTINEN, K.ESPOZ, J.PURNAMA, P.C.: "The bHLH transcription factor BIS1 controls the iridoid branch of the monoterpenoid indole alkaloid pathway in Catharanthus roseus", PROC. NATL. ACAD. SCI. USA., vol. 112, 2015, pages 8130 - 8135 |
| VANDEN BOSSCHE, R.DEMEDTS, B.VANDERHAEGHEN, R.GOOSSENS, A.: "Transient expression assays in tobacco protoplasts", METHODS MOL. BIOL., vol. 1011, 2013, pages 227 - 239 |
| VOM ENDT, D.SOARES E SILVA, M.KIJNE, J.W.PASQUALI, G.MEMELINK, J.: "Identification of a bipartite jasmonate-responsive promoter element in the Catharanthus roseus ORCA3 transcription factor gene that interacts specifically with AT-hook DNA-binding proteins", PLANT PHYSIOL., vol. 144, 2007, pages 1680 - 1689 |
| WASTERNACK, C.HAUSE, B.: "Jasmonates: biosynthesis, perception, signal transduction and action in plant stress response, growth and development", ANNALS OF BOTANY. ANN. BOT., vol. 111, 2013, pages 1021 - 1058 |
| WASTERNACK, C.STRNAD, M.: "New Biotechnol.", 2018, PRESS, article "Jasmonates are signals in the biosynthesis of secondary metabolites — Pathways, transcription factors and applied aspects" |
| XIA, J.WISHART, D.S.: "Using MetaboAnalyst 3.0 for comprehensive metabolomics data analysis", CURR. PROTOC. BIOINFORM., vol. 55, 2016 |
| ZHANG HONGTAO ET AL: "The basic helix-loop-helix transcription factor CrMYC2 controls the jasmonate-responsive expression of the ORCA genes that regulate alkaloid biosynthesis in Catharanthus roseus", PLANT JOURNAL, BLACKWELL SCIENCE, OXFORD, GB, vol. 67, no. 1, 1 July 2011 (2011-07-01), pages 61 - 71, XP002738507, ISSN: 1365-313X, DOI: 10.1111/J.1365-313X.2011.04575.X * |
| ZHANG, F.YAO, J.KE, J.ZHANG, L.LAM, V.Q.XIN, X.-F.ZHOU, X.E.CHEN, J.BRUNZELLE, J.GRIFFIN, P.R.: "Structural basis of JAZ repression of MYC transcription factors in jasmonate signalling", NATURE, vol. 525, 2015, pages 269 - 273 |
| ZHANG, H.HEDHILI, S.MONTIEL, G.ZHANG, Y.CHATEL, G.PRE, M.GANTET, P.MEMELINK, J.: "The basic helix-loop-helix transcription factor CrMYC2 controls the jasmonate-responsive expression of the ORCA genes that regulate alkaloid biosynthesis in Catharanthus roseus", PLANT J., vol. 67, 2011, pages 61 - 71, XP002738507, DOI: doi:10.1111/J.1365-313X.2011.04575.X |
| ZHOU, M.MEMELINK, J.: "Jasmonate-responsive transcription factors regulating plant secondary metabolism", BIOTECHNOL. ADV., vol. 34, 2016, pages 441 - 449, XP029549282, DOI: doi:10.1016/j.biotechadv.2016.02.004 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113337519A (en) * | 2021-06-03 | 2021-09-03 | 浙江农林大学 | Application of different copies of BrMYC2/3/4 gene in plant growth |
| CN113337519B (en) * | 2021-06-03 | 2022-04-05 | 浙江农林大学 | Application of Different Copies of BrMYC2/3/4 Gene in Plant Growth |
| CN113817034A (en) * | 2021-09-06 | 2021-12-21 | 中国科学院华南植物园 | Application of DoMYC2 in increasing of geraniol content of dendrobium officinale |
| WO2023196684A3 (en) * | 2022-04-08 | 2023-12-07 | Northeastern University | Genetically engineered plants for increased production of vindoline |
| CN114891803A (en) * | 2022-05-30 | 2022-08-12 | 湖南工程学院 | Ginseng PgWRKY40 gene induced by methyl jasmonate and application thereof |
| CN114891803B (en) * | 2022-05-30 | 2023-06-23 | 湖南工程学院 | Ginseng PgWRKY40 gene induced by methyl jasmonate and application thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Liu et al. | GATA and phytochrome interacting factor transcription factors regulate light-induced vindoline biosynthesis in Catharanthus roseus | |
| Paul et al. | Mutually regulated AP2/ERF gene clusters modulate biosynthesis of specialized metabolites in plants | |
| Amato et al. | The MYB 5‐driven MBW complex recruits a WRKY factor to enhance the expression of targets involved in vacuolar hyper‐acidification and trafficking in grapevine | |
| Miao et al. | Suppression of tryptophan synthase activates cotton immunity by triggering cell death via promoting SA synthesis | |
| Lee et al. | Norcoclaurine synthase is a member of the pathogenesis-related 10/Bet v1 protein family | |
| Docimo et al. | Phenylpropanoids accumulation in eggplant fruit: characterization of biosynthetic genes and regulation by a MYB transcription factor | |
| Mishra et al. | Wound induced tanscriptional regulation of benzylisoquinoline pathway and characterization of wound inducible PsWRKY transcription factor from Papaver somniferum | |
| JP7773517B2 (en) | metabolic engineering | |
| Sui et al. | Cross-family transcription factor interaction between MYC2 and GBFs modulates terpenoid indole alkaloid biosynthesis | |
| US12041907B2 (en) | Cellulose-synthase-like enzymes and uses thereof | |
| AU2020303272B2 (en) | Transferase enzymes | |
| Facchini et al. | Opium poppy: blueprint for an alkaloid factory | |
| Ahmad et al. | GmMAX2–D14 and–KAI interaction‐mediated SL and KAR signaling play essential roles in soybean root nodulation | |
| WO2019219933A1 (en) | An engineered combinatorial module of transcription factors to boost production of monoterpenoid indole alkaloids | |
| Woldemariam et al. | NaMYC2 transcription factor regulates a subset of plant defense responses in Nicotiana attenuata | |
| JP2002535993A (en) | Methods for modulating biosynthesis of metabolites in recombinant cells | |
| Jiang et al. | The APETALA2–MYBL2 module represses proanthocyanidin biosynthesis by affecting formation of the MBW complex in seeds of Arabidopsis thaliana | |
| Li et al. | Jasmonate-responsive transcription factors NnWRKY70a and NnWRKY70b positively regulate benzylisoquinoline alkaloid biosynthesis in lotus (Nelumbo nucifera) | |
| WO2003097790A2 (en) | Genes and uses thereof to modulate secondary metabolite biosynthesis | |
| US20240315192A1 (en) | Cellulose-synthase-like enzymes and uses thereof | |
| Sun et al. | Cotton GhMAX2 promotes single-celled fiber elongation by releasing the GhS1FA-mediated inhibition of fatty acid biosynthesis | |
| US20090165167A1 (en) | Means and Methods to Enhance the Production of Vinblastine and Vincristine in Catharanthus Roseus | |
| Wu et al. | Transcriptional Regulation of the Novel Theacrine Synthase Gene CsTcS2 by the CsTINY–CsWRKY33 Module Underpins Theacrine Biosynthesis in Camellia sinensis | |
| Meng et al. | Brassinosteroids signaling component SlBZR1 promotes fruit ripening in tomato | |
| Ribeiro et al. | Medicago truncatula |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19724207 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 19724207 Country of ref document: EP Kind code of ref document: A1 |


