WO2019173780A2 - Anti-cd252 antibodies, conjugates, and methods of use - Google Patents

Anti-cd252 antibodies, conjugates, and methods of use Download PDF

Info

Publication number
WO2019173780A2
WO2019173780A2 PCT/US2019/021464 US2019021464W WO2019173780A2 WO 2019173780 A2 WO2019173780 A2 WO 2019173780A2 US 2019021464 W US2019021464 W US 2019021464W WO 2019173780 A2 WO2019173780 A2 WO 2019173780A2
Authority
WO
WIPO (PCT)
Prior art keywords
optionally substituted
antibody
adc
antigen
linker
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/021464
Other languages
English (en)
French (fr)
Other versions
WO2019173780A3 (en
Inventor
Anthony Boitano
Michael Cooke
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dianthus Therapeutics Inc
Original Assignee
Magenta Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Magenta Therapeutics Inc filed Critical Magenta Therapeutics Inc
Priority to CN201980031308.3A priority Critical patent/CN112154152A/zh
Priority to EP19763628.5A priority patent/EP3762400A4/en
Priority to JP2020547005A priority patent/JP2021517133A/ja
Publication of WO2019173780A2 publication Critical patent/WO2019173780A2/en
Publication of WO2019173780A3 publication Critical patent/WO2019173780A3/en
Priority to US17/013,172 priority patent/US20210095039A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/64Cyclic peptides containing only normal peptide links
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/404Indoles, e.g. pindolol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/28Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/12Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/6831Fungal toxins, e.g. alpha sarcine, mitogillin, zinniol or restrictocin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to the field of transplant therapy and provides methods for the treatment of graft-versus-host disease (GVHD) by administration of anti-CD252 antibodies, antigen-binding fragments thereof, and antibody-drug conjugates (ADCs).
  • GVHD graft-versus-host disease
  • ADCs antibody-drug conjugates
  • GVHD graft-versus-host disease
  • the invention features a method of treating a patient with anti-CD252 antibodies, antigen-binding fragment thereof, or antibody-drug conjugate (ADC), so as to deplete a population of antigen-presenting cells (APCs), i.e., APCs expressing the 0X40 ligand (i.e.,
  • CD252 within the patient.
  • the invention features a method of treating GVHD in a human patient in need thereof by administering to the patient an effective amount of an anti-CD252 antibody, antigen-binding fragment thereof, or ADC.
  • the invention provides a method of depleting a population of antigen- presenting cells (APCs), i.e., APCs expressing the 0X40 ligand (i.e., CD252), in a human patient having or at risk of having GVHD by administering to the patient an effective amount of an anti- CD252 antibody, antigen-binding fragment thereof, or ADC.
  • APCs antigen-presenting cells
  • CD252 antigen-presenting cells
  • the anti-CD252 antibody, antigen-binding fragment thereof, or ADC is internalized by an antigen-presenting cells (APCs) expressing CD252 (0X40 ligand) following administration to the patient.
  • APCs antigen-presenting cells
  • the anti- CD252 antibody, antigen-binding fragment thereof, or ADC may be internalized by receptor mediated endocytosis (e.g., upon binding to the cell surface of an antigen-presenting cell (APC) expressing 0X40 ligand).
  • a cytotoxin covalently bound to the anti-OX40 antibody, antigen-binding fragment thereof may be released intracellularly by chemical cleavage (for instance, by enzymatic or non-specific cleavage of a linker described herein).
  • the cytotoxin may then access its intracellular target (such as the mitotic spindle apparatus, nuclear DNA, ribosomal RNA, or topoisomerases, among others) so as to promote the death of an antigen-presenting cell (APC) expressing 0X40 ligand.
  • APC antigen-presenting cell
  • the anti-CD252 antibody, antigen-binding fragment thereof, or ADC is capable of promoting mitotic arrest and suppressing proliferation (for instance, by suppressing microtubule dynamic instability) of the antigen-presenting cell (APC) expressing CD252.
  • the antibody, antigen-binding fragment thereof, ADC may promote the death of a cell by recruiting one or more complement proteins, natural killer (NK) cells, macrophages, neutrophils, and/or eosinophils upon administration to the patient.
  • NK natural killer
  • the anti-CD252 antibody, antigen-binding fragment thereof, or ADC may promote the death of an antigen-presenting cell (APC) expressing 0X40 ligand by recruiting one or more complement proteins, natural killer (NK) cells, macrophages, neutrophils, and/or eosinophils upon administration to the patient.
  • APC antigen-presenting cell
  • NK natural killer
  • the invention features a method of preventing or reducing graft versus host disease (GVHD) in a human patient in need thereof, the method comprising administering an anti-CD252 antibody, to the human patient such that GVHD is prevented.
  • the anti- CD252 antibody is linked to a cytotoxin (i.e., an anti- CD252 ADC).
  • the method comprises administering the anti-CD252 antibody or the anti-CD252 ADC to the patient prior to the patient receiving a transplant comprising hematopoietic stem cells.
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about three days prior to the patient receiving a transplant comprising hematopoietic stem cells.
  • the method comprises administering the anti- CD252 antibody or the anti-CD252 ADC to the patient concomitant with the patient receiving a transplant comprising hematopoietic stem cells.
  • the method comprises administering the anti-CD252 antibody or the anti-CD252 ADC to the patient after the patient receives a transplant comprising hematopoietic stem cells.
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 hour to about 10 days (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 1 1 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, or about 10 days) after the patient receives a transplant comprising hematopoietic stem cells.
  • the method comprising
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 to 7 days after the patient receives a transplant comprising
  • the method comprising administering the anti- CD252 antibody or the anti-CD252 ADC to the patient about 1 to 6 days after the patient receives a transplant comprising hematopoietic stem cells. In a further embodiment, the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 to 5 days after the patient receives a transplant comprising hematopoietic stem cells. In a further
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 2 to 4 days after the patient receives a transplant comprising
  • the method comprising administering the anti- CD252 antibody or the anti-CD252 ADC to the patient about 3 to 4 days after the patient receives a transplant comprising hematopoietic stem cells.
  • the transplant is allogeneic.
  • the invention features a method of depleting a population of antigen- presenting cells (APCs) expressing CD252 in a human subject having GVHD or at risk of developing GVHD, the method comprising administering an anti-CD252 antibody or the anti- CD252 ADC to the human patient such that GVHD the population of antigen-presenting cells (APCs) expressing CD252 is depleted, wherein the anti-CD252 ADC comprises an anti- 0X40 ligand antibody linked to a cytotoxin.
  • the method comprises administering the anti-CD252 antibody or the anti-CD252 ADC to the patient prior to the patient receiving a transplant comprising hematopoietic stem cells.
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about three days prior to the patient receiving a transplant comprising hematopoietic stem cells.
  • the method comprises administering the anti-CD252 antibody or the anti-CD252 ADC to the patient concomitant with the patient receiving a transplant comprising hematopoietic stem cells.
  • the method comprises administering the anti-OX40 antibody or the anti- CD252 ADC to the patient after the patient receives a transplant comprising hematopoietic stem cells.
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 hour to about 10 days (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 1 1 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, or about 10 days), about 1 hour to about 6 hours, about 1 hour to about 12 hours, about 1 hour to about 24 hours, about 1 day to about 2 days, about 1 hour to about 3 days, about 1 day to about 4 days, about 1 day to about 5 days, about 1 day to about 6 days, about 1 day to about 7 days, about 1 day to about 8 hours, about 9
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 to 8 days after the patient receives a transplant comprising hematopoietic stem cells. In another embodiment, the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 to 7 days after the patient receives a transplant comprising
  • the method comprising administering the anti- CD252 antibody or the anti-CD252 ADC to the patient about 1 to 6 days after the patient receives a transplant comprising hematopoietic stem cells. In a further embodiment, the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 1 to 5 days after the patient receives a transplant comprising hematopoietic stem cells. In a further
  • the method comprising administering the anti-CD252 antibody or the anti-CD252 ADC to the patient about 2 to about 4 days after the patient receives a transplant comprising hematopoietic stem cells.
  • the method comprising administering the anti- CD252 antibody or the anti-CD252 ADC to the patient about 3 to about 4 days after the patient receives a transplant comprising hematopoietic stem cells.
  • the transplant is allogeneic.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 1 , and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 2.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain comprising a CDR1 , a CDR2, and a CDR3 as described in the heavy chain variable region of SEQ ID NO: 1 , and a light chain comprising a CDR1 , a CDR2, and a CDR3 as provided in the light chain variable region of SEQ ID NO: 2.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain comprising a CDR1 , a CDR2, and a CDR3 as described in SEQ ID NOs: 3-5, and a light chain comprising a CDR1 , a CDR2, and a CDR3 as provided in SEQ ID NOs: 6-8.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO:
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain comprising a CDR1 , a CDR2, and a CDR3 as described in the heavy chain variable region of SEQ ID NO: 17 and a light chain comprising a CDR1 , a CDR2, and a CDR3 as provided in the light chain variable region of SEQ ID NO: 18.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain comprising a CDR1 , a CDR2, and a CDR3 as described in SEQ ID NOs: 1 1 -13, and a light chain comprising a CDR1 , a CDR2, and a CDR3 as provided in SEQ ID NOs: 14-16.
  • the invention features an anti-CD252 antibody, or an antigen binding portion thereof, comprising a full length heavy chain comprising an amino acid sequence as set forth in SEQ ID NO: 9 and a full length light chain comprising an amino acid sequence as set forth in SEQ ID NO: 10.
  • an anti-CD252 antibody, or fragment thereof is conjugated to a cytotoxin.
  • a cytotoxin that may be conjugated to an anti-CD252 antibody (or fragment thereof) include, but are not limited to a microtubule-binding agent.
  • the invention features an anti-CD252 antibody, or an antigen binding portion thereof, comprising a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 1 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 2.
  • the invention features an anti-CD252 antibody, or an antigen binding portion thereof, comprising a heavy chain variable region comprising a CDR1 , a CDR2, and a CDR3 domain as set forth in the amino acid sequence of SEQ ID NO: 1 , and a light chain variable region comprising a CDR1 , a CDR2, and a CDR3 domain as set forth in the amino acid sequence of SEQ ID NO: 2.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain comprising a CDR1 , a CDR2, and a CDR3 as described in SEQ ID NOs: 3-5, and a light chain comprising a CDR1 , a CDR2, and a CDR3 as provided in SEQ ID NOs: 6-8.
  • the anti-CD252 antibody, or antigen binding fragment thereof has an isotype selected from the group consisting of IgG, IgA, IgM, IgD, and IgE.
  • the IgG is an lgG1 , lgG2, lgG3, or lgG4 isotype.
  • the anti-CD252 antibody is an intact antibody.
  • the anti-CD252 antibody or antigen-binding fragment thereof is a bispecific antibody, a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab’)2 molecule, or a tandem di-scFv.
  • scFv single-chain Fv molecule
  • the invention features a pharmaceutical composition
  • a pharmaceutical composition comprising the antibody or antigen binding portion thereof, of the invention, and a pharmaceutically acceptable carrier.
  • the invention features a method of treating graft failure or GVFID in a human patient in need thereof, by administering an effective amount of the anti-CD252 antibody or antigen fragment thereof, of the invention to the human patient.
  • the human patient previously received a transplant.
  • the human patient received the transplant no more than 4 days prior to the administration of the antibody, or antigen binding fragment thereof.
  • the human patient received the transplant no more than 3 days prior to the administration of the antibody, or antigen binding fragment thereof.
  • the human patient received the transplant no more than 2 days prior to the administration of the antibody, or antigen binding fragment thereof.
  • the human patient received the transplant no more than 1 day prior to the administration of the antibody, or antigen binding fragment thereof.
  • the human patient received the transplant between 1 and 4 days prior to the administration of the antibody, or antigen binding fragment thereof. In another embodiment, the human patient received the transplant no more than 1 day prior to the administration of the antibody, or antigen binding fragment thereof. In another embodiment, the human patient received the transplant between 2 and 4 days prior to the administration of the antibody, or antigen binding fragment thereof. In another embodiment, the human patient received the transplant no more than 1 day prior to the administration of the antibody, or antigen binding fragment thereof. In another embodiment, the human patient received the transplant between 3 and 4 days prior to the administration of the antibody, or antigen binding fragment thereof.
  • the invention features a method of treating human patient at risk of having graft failure or GVHD by administering an effective amount of the anti-CD252 antibody or antigen fragment thereof, of the invention to the human patient at risk of having graft failure or GVHD, and subsequently administering a transplant to the human subject.
  • the anti-CD252 antibody or antigen fragment thereof is administered to the human patient as a single dose.
  • the invention features an anti-CD252 antibody drug conjugate (ADC) comprising the anti-CD252 antibody, or antigen binding portion thereof, as described herein, conjugated to a cytotoxin via a linker.
  • ADC anti-CD252 antibody drug conjugate
  • the cytotoxin is a microtubule-binding agent or an RNA polymerase inhibitor.
  • the RNA polymerase inhibitor is an amatoxin.
  • the amatoxin is an amanitin.
  • the amatoxin is selected from the group consisting of a-amanitin, b-amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
  • the invention features an anti-CD252 ADC represented by the formula Ab-Z-L-Am, wherein Ab is an antibody or antigen-binding fragment thereof as described herein, L is a linker, Z is a chemical moiety, and Am is an amatoxin.
  • the amatoxin is conjugated to a linker.
  • the amatoxin-linker conjugate Am-L-Z is
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H, R c , or R D ;
  • R 4 is H, OH, ORc, OR d , R C , or R D ;
  • R 5 is H, OH, ORc, OR d , R c , or R D ;
  • R 6 is H, OH, ORc, OR D , R c , or R D ;
  • R 7 is H, OH, ORc, OR D , R c , or R D ;
  • R 8 is OH, NH 2 , OR C , OR d , NHR c , or NR C R D ;
  • R g is H, OH, OR c , or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • Rc is -L-Z
  • R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
  • alkyl e.g., C C 6 alkyl
  • optionally substituted heteroalkyl e.g., C C 6 heteroalkyl
  • optionally substituted alkenyl e.g., C 2 -C 6
  • Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or an antigen-binding fragment thereof, that binds CD252.
  • Am contains exactly one R c substituent.
  • linker L and the chemical moiety Z, taken together as L-Z is
  • S is a sulfur atom which represents the reactive substituent present within an antibody or antigen-binding fragment thereof, that binds CD252 (e.g., from the -SH group of a cysteine residue).
  • Am-L-Z-Ab is:
  • Am-L-Z is represented by formula (IA)
  • Ri is H, OH, OR A , or OR c ;
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H, R c , or R D ;
  • R 4 , R 5 , R 6, and R 7 are each independently H, OH, OR c , OR D , Rc, or R D ;
  • R 8 is OH, NH 2 , OR C , OR d , NHR c , or NR C R D ;
  • R g is H, OH, OR c , or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • Rc is -L-Z
  • R D is optionally substituted C C 6 alkyl, optionally substituted C C 6 heteroalkyl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted C 2 -C 6 alkynyl, optionally substituted C 2 -C 6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
  • Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
  • linker L and the chemical moiety Z, taken together as L-Z is
  • Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • the Am-L-Z is represented by formula (IB) R A and R B , when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H, R c , or R D ;
  • R 4 , R 5 , R 6, and R 7 are each independently H, OH, OR c , OR D , R c , or R D ;
  • R 8 is OH, NH 2 , OR C , OR d , NHR c , or NR C R D ;
  • R g is H, OH, OR c , or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • Rc is -L-Z
  • R D is optionally substituted C C 6 alkyl, optionally substituted C C 6 heteroalkyl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted C 2 -C 6 alkynyl, optionally substituted C 2 -C 6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
  • L is optionally substituted C C 6 alkylene, optionally substituted C C 6 heteroalkylene, optionally substituted C 2 -C 6 alkenylene, optionally substituted C 2 -C 6
  • heteroalkenylene optionally substituted C 2 -C 6 alkynylene, optionally substituted C 2 -C 6
  • Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
  • linker L and the chemical moiety Z, taken together as L-Z is
  • Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • Am-L-Z is represented by formula (II), formula (IIA), or formula
  • Ri is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof;
  • R 2 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof;
  • R 2 is the linker
  • R 2 is the linker
  • the antibody or antigen-binding fragment thereof is conjugated to the amatoxin by way of a cysteine residue in the Fc domain of the antibody or antigen-binding fragment thereof.
  • the cysteine residue is introduced by way of a mutation in the Fc domain of the antibody or antigen-binding fragment thereof.
  • the cysteine residue is selected from the group consisting of Cys1 18, Cys239, and Cys265.
  • the cysteine residue is naturally occurring in the Fc domain of the antibody or antigen-binding fragment thereof.
  • the Fc domain is an IgG Fc domain and the cysteine residue is selected from the group consisting of Cys261 , Csy321 , Cys367, and Cys425.
  • the invention features an anti-CD252 antibody, fragment thereof, or ADC as described herein, wherein the anti-CD252 antibody, fragment thereof, or ADC is internalized by an antigen presenting cell (APC).
  • the cytotoxin is a microtubule-binding agent or an auristatin.
  • the microtubule-binding agent is maytansine.
  • the microtubule-binding agent is a maytansinoid.
  • the maysantinoid is selected from the group consisting of DM1 , DM3, and DM4, and maytansinol.
  • the auristatin is monomethyl auristatin E or monomethyl auristatin F.
  • the cytotoxin is an anthracycline selected from the group consisting of daunorubicin, doxorubicin, epirubicin, and idarubicin.
  • the invention features a method of depleting a population of CD252 positive cells in a human patient suffering from or at risk for graft-versus-host disease by administering to the patient an effective amount of an antibody or antigen-binding fragment thereof or ADC as disclosed herein.
  • the method comprises administering the antibody, antigen-binding fragment thereof, or ADC as disclosed herein to the patient prior to the patient receiving a transplant comprising hematopoietic stem cells.
  • the antibody, antigen-binding fragment thereof, or ADC as disclosed herein is administered to the patient about three days prior to the patient receiving a transplant comprising hematopoietic stem cells.
  • the antibody, antigen-binding fragment thereof is administered to the patient concomitant with the patient receiving a transplant comprising hematopoietic stem cells. In yet other embodiments, the antibody, antigen-binding fragment thereof, is administered to the patient after the patient receives a transplant comprising hematopoietic stem cells.
  • the invention features a method of treating graft versus host disease (GVHD) in a human patient in need thereof, by administering an anti-CD252 antibody drug conjugate (ADC) as disclosed herein to the human patient such that GVHD is treated.
  • GVHD graft versus host disease
  • ADC anti-CD252 antibody drug conjugate
  • the invention features a pharmaceutical composition
  • a pharmaceutical composition comprising the anti- CD252 ADC as described herein, and a pharmaceutically active carrier.
  • the methods described herein are also useful for the treatment of an autoimmune disease.
  • the methods and compositions disclosed herein can be used to treat an autoimmune disease, such as, but not limited to, psoriasis, inflammatory bowel disease (Crohn's disease, ulcerative colitis), psoriatic arthritis, multiple sclerosis, rheumatoid arthritis, or ankylosing spondylitis.
  • the autoimmune disease that may be treated using the methods disclosed herein further include, for example, scleroderma, multiple sclerosis (MS), human systemic lupus (SLE), rheumatoid arthritis (RA), inflammatory bowel disease (IBD), treating psoriasis, Type 1 diabetes mellitus (Type 1 diabetes), acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicasclerosis (
  • Figure 1 graphically depicts results from a mixed lymphocyte reaction comparing a naked anti-CD252 antibody, an anti-CD45 ADC, and isotype controls.
  • Figures 2A and 2B graphically depict results from a mixed lymphocyte reaction comparing a naked anti-CD252 antibody, an anti-CD45 ADC, and isotype controls to different anti-CD252 antibodies (1 1 C3.1 , 159403, 159408, and oxelumab).
  • the results show the percent activated T cells (Figure 2A) or the nonactivated T cell count ( Figure 2B) as a function of antibody concentration.
  • the invention provides anti-CD252 antibodies (as well as fragments thereof and antibody drug conjugates (ADCs)) that bind to human CD252 (i.e., 0X40 ligand).
  • ADCs antibody drug conjugates
  • the binding regions of an anti-CD252 antibody identified herein are described below in SEQ ID NO: 1 and SEQ ID NO: 2.
  • the invention provides methods of preventing and treating graft-vs-host-disease (GVHD) by administration of an anti-CD252 antibody, antigen-binding fragment thereof, or ADC.
  • This administration can cause the selective depletion of a population of APCs that are reactive against the host.
  • the invention is based in part on the discovery that an antibody, antigen-binding fragment thereof, or ADC, capable of binding CD252 (i.e., 0X40 ligand) can be administered to a patient in in order to prevent and treat GVHD, including GVHD arising from hematopoietic stem cell transplant therapy.
  • the sections that follow provide a description of antibodies, antigen-binding fragments thereof, or ADCs, that can be administered to a patient suffering from or at risk for GVHD, as well as methods of administering such therapeutics to the patient.
  • the term“about” refers to a value that is within 10% above or below the value being described.
  • the term“about 5 nM” indicates a range of from 4.5 nM to 5.5 nM.
  • the term“allogeneic” refers to cells or tissues from individuals belonging to the same species but genetically different, and are therefore immunologically incompatible.
  • the term“allogeneic cells” refers to cell types that are genetically distinct, yet belonging to the same species.
  • the term“allogeneic” is used to define cells, such as stem cells, that are transplanted from a donor to a recipient of the same species.
  • amatoxin refers to a member of the amatoxin family of peptides produced by Amanita phalloides mushrooms, or a variant or derivative thereof, such as a variant or derivative thereof capable of inhibiting RNA polymerase II activity.
  • Amatoxins useful in conjunction with the compositions and methods described herein include compounds according to, but are not limited to, formula (III), including as a-amanitin, b-amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, or proamanullin.
  • formula (III) is as follows:
  • R 2 is H, OH, or OR B ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H or R d ;
  • R 4 is H, OH, OR d , or R D ;
  • R 5 is H, OH, OR d , or R D ;
  • R 6 is H, OH, OR d , or R D ;
  • R 7 is H, OH, OR d , or R D ;
  • R 8 is OH, NH 2 , or OR D ;
  • R g is H, OH, or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • R D is optionally substituted alkyl (e.g., Ci-C 6 alkyl), optionally substituted heteroalkyl (e.g., Ci-C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • MIA formula
  • R 2 is H, OH, or OR B ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H or R d ;
  • R 4 is H, OH, OR d , or R D ;
  • R 5 is H, OH, OR d , or R D ;
  • R 6 is H, OH, OR d , or R D ;
  • R 7 is H, OH, OR d , or R D ;
  • R 8 is OH, NH 2 , or OR D ;
  • R g is H, OH, or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • alkyl e.g., C C 6 alkyl
  • optionally substituted heteroalkyl e.g., C C 6 heteroalkyl
  • optionally substituted alkenyl e.g., C 2 -C 6
  • amatoxins useful in conjunction with the compositions and methods described herein also include compounds according to formula (IIIB), below:
  • R 2 is H, OH, or OR B ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H or R d ;
  • R 4 is H, OH, OR d , or R D ;
  • R 5 is H, OH, OR d , or R D ;
  • R 6 is H, OH, OR d , or R D ;
  • R 7 is H, OH, OR d , or R D ;
  • R 8 is OH, NH 2 , or OR D ;
  • R g is H, OH, or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • R D is optionally substituted alkyl (e.g., Ci-C 6 alkyl), optionally substituted heteroalkyl (e.g.,
  • Ci-C 6 heteroalkyl optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
  • alkenyl e.g., C 2 -C 6 alkenyl
  • heteroalkenyl e.g., C 2 -C 6 heteroalkenyl
  • alkynyl e.g., C 2 -C 6 alkynyl
  • heteroalkynyl e.g., C 2 -C 6 heteroalkynyl
  • amatoxins may be conjugated to an antibody, or antigen-binding fragment thereof, for instance, by way of a linker moiety (L) (thus forming an ADC).
  • L linker moiety
  • Exemplary methods of amatoxin conjugation and linkers useful for such processes are described below, including Table 1 .
  • Exemplary linker-containing amatoxins useful for conjugation to an antibody, or antigen-binding fragment, in accordance with the compositions and methods described herein are shown in structural formulas (I), (IA), (IB), (II), (IIA), and (IIB), recited herein.
  • antibody refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen, and includes monoclonal, genetically engineered, and otherwise modified forms of antibodies, including but not limited to chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad- specific antibodies, diabodies, triabodies, and tetrabodies), and antigen binding fragments of antibodies, including, for example, Fab', F(ab') 2 , Fab, Fv, rlgG, and scFv fragments.
  • mAb monoclonal antibody
  • mAb monoclonal antibody
  • Fab and F(ab') 2 fragments refer to antibody fragments that lack the Fc fragment of an intact antibody. Examples of these antibody fragments are described herein.
  • antibodies comprise heavy and light chains containing antigen binding regions.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as FICVR or VFI) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CH1 , CFI2 and CFI3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • the VFI, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • Each VFI and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • An“intact” or“full length” antibody refers to an antibody having two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • the VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • antigen-binding fragment refers to one or more fragments of an antibody that retain the ability to specifically bind to a target antigen.
  • the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • the antibody fragments can be, for example, a Fab, F(ab’) 2 , scFv, diabody, a triabody, an affibody, a nanobody, an aptamer, or a domain antibody.
  • binding fragments encompassed of the term “antigen-binding fragment” of an antibody include, but are not limited to: (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L , and C H 1 domains; (ii) a F(ab') 2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb including V H and V L domains; (vi) a dAb fragment that consists of a V H domain (see, e.g., Ward et al., Nature 341 :544-546, 1989); (vii) a dAb which consists of a V H or a V L domain; (viii) an isolated complementarity
  • the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al., Science 242:423-426, 1988 and Fluston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988).
  • scFv single chain Fv
  • These antibody fragments can be obtained using conventional techniques known to those of skill in the art, and the fragments can be screened for utility in the same manner as intact antibodies.
  • Antigen-binding fragments can be produced by recombinant DNA
  • the term“anti-OX40 ligand antibody” or an“anti-CD252 antibody” or“anti- 0X40 ligand ADC” or“anti-CD252 ADC” refers to an antibody or ADC that specifically binds to 0X40 ligand (i.e., CD252).
  • An antibody“which binds” an antigen of interest, i.e., CD252 is one capable of binding that antigen with sufficient affinity such that the antibody is useful in targeting a cell expressing the antigen.
  • the antibody specifically binds to human CD252 (hCD252).
  • CD252 is found on antigen presenting cells.
  • the amino acid sequence of human CD252 to which an anti-CD252 antibody (or anti-CD252 antibody drug conjugate) would bind is described below in SEQ ID NOs: 19 or 20.
  • the term“bispecific antibody” refers to an antibody that is capable of binding at two different antigens. For instance, one of the binding specificities can be directed towards a antigen presenting cell (APC) surface antigen, CD252, and the other can specifically bind a different cell surface antigen or another cell surface protein, such as a receptor or receptor subunit involved in a signal transduction pathway that potentiates cell growth, among others.
  • APC antigen presenting cell
  • CDR complementarity determining region
  • FRs framework regions
  • the amino acid positions that delineate a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions.
  • variable domains of native heavy and light chains each contain four framework regions that primarily adopt a b-sheet configuration, connected by three CDRs, which form loops that connect, and in some cases form part of, the b- sheet structure.
  • the CDRs in each chain are held together in close proximity by the framework regions in the order FR1 -CDR1 -FR2-CDR2-FR3-CDR3-FR4 and, with the CDRs from the other antibody chains, contribute to the formation of the target binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda, MD.,
  • numbering of immunoglobulin amino acid residues is performed according to the immunoglobulin amino acid residue numbering system of Kabat et al., unless otherwise indicated.
  • the term“antibody drug conjugate” or“ADC” refers to a compound formed by the chemical bonding of a reactive functional group of an antibody or antigen-binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein.
  • ADCs may include a linker between the antibody (e.g., an anti-CD252 antibody) and the cytotoxin bound to one another.
  • Such ADCs may be represented by the formula Ab-Z-L-Cy, where Ab is the antibody or antigen-binding fragment thereof, Z is a chemical moiety formed from a coupling reaction between a reactive functional group present on the linker and a reactive functional group present within the antibody, or antigen-binding fragment thereof, L is a linker, and Cy is a cytotoxin.
  • linkers that can be used for the formation of an ADC include peptide-containing linkers, such as those that contain naturally occurring or non-naturally occurring amino acids, such as D-amino acids. Linkers can be prepared using a variety of strategies described herein and known in the art.
  • a linker may be cleaved, for example, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571 -582, 2012).
  • the foregoing conjugates are also referred to
  • the term“coupling reaction” refers to a chemical reaction in which two or more substituents suitable for reaction with one another react so as to form a chemical moiety that joins (e.g., covalently) the molecular fragments bound to each substituent.
  • Coupling reactions include those in which a reactive substituent bound to a fragment that is a cytotoxin, such as a cytotoxin known in the art or described herein, reacts with a suitably reactive substituent bound to a fragment that is an antibody, or antigen-binding fragment thereof, such as an antibody, or antigen-binding fragment thereof, specific for CD252 known in the art or described herein.
  • a reactive substituent bound to a fragment that is a cytotoxin such as a cytotoxin known in the art or described herein
  • suitably reactive substituents include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others), a diene/dienophile pair (e.g., an azide/alkyne pair, among others), and the like.
  • a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others
  • diene/dienophile pair e.g., an azide/alkyne pair, among others
  • Coupling reactions include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine condensation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
  • cycloaddition e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
  • nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
  • nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloa
  • CRU competitive repopulating unit
  • the term“donor” refers to a human or animal from which one or more cells are isolated prior to administration of the cells, or progeny thereof, into a recipient.
  • the one or more cells may be, for example, a population of hematopoietic stem cells.
  • the term“diabody” refers to a bivalent antibody containing two polypeptide chains, in which each polypeptide chain includes V H and V L domains joined by a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptide chain. This configuration forces each domain to pair with a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptide chain. This configuration forces each domain to pair with a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptide chain. This configuration forces each domain to pair with a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptid
  • the term“triabody” refers to trivalent antibodies containing three peptide chains, each of which contains one V H domain and one V L domain joined by a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of V H and V L domains within the same peptide chain.
  • a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of V H and V L domains within the same peptide chain.
  • peptides configured in this way typically trimerize so as to position the V H and V L domains of neighboring peptide chains spatially proximal to one another (see, for example, Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-48, 1993).
  • a“dual variable domain immunoglobulin” refers to an antibody that combines the target-binding variable domains of two monoclonal antibodies via linkers to create a tetravalent, dual-targeting single agent (see, for example, Gu et al., Meth. Enzymol., 502:25-41 , 2012).
  • the term“endogenous” describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a cell of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
  • a hematopoietic stem cell or a cell of hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
  • exogenous describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a cell of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
  • a hematopoietic stem cell or a cell of hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
  • Exogenous substances include those that are provided from an external source to an organism or to cultured matter extracted therefrom.
  • FW region includes amino acid residues that are adjacent to the CDRs of an antibody or antigen-binding fragment thereof. FW region residues may be present in, for example, human antibodies, humanized antibodies, monoclonal antibodies, antibody fragments, Fab fragments, single chain antibody fragments, scFv fragments, antibody domains, and bispecific antibodies, among others.
  • FISCs hematopoietic stem cells
  • granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
  • erythrocytes e.g., reticulocytes, erythrocytes
  • thrombocytes e.g., megakaryoblasts, platelet producing megakaryocytes, platelets
  • monocytes e.g., monocytes, macrophages
  • dendritic cells e.g., NK cells, B-cells and T-cells.
  • Such cells may include CD34 + cells.
  • CD34 + cells are immature cells that express the CD34 cell surface marker.
  • CD34+ cells are believed to include a subpopulation of cells with the stem cell properties defined above, whereas in mice, HSCs are CD34-.
  • HSCs also refer to long term repopulating HSCs (LT-HSC) and short term repopulating HSCs (ST- HSC).
  • LT-HSCs and ST-HSCs are differentiated, based on functional potential and on cell surface marker expression.
  • human HSCs are CD34+, CD38-, CD45RA-, CD90+, CD49F+, and lin- (negative for mature lineage markers including CD2, CD3, CD4, CD7, CD8, CD10,
  • CD1 1 B CD19, CD20, CD56, CD235A
  • bone marrow LT-HSCs are CD34-, SCA-1 +, C- kit+, CD135-, Slamfl/CD150+, CD48-, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL7ra)
  • ST-HSCs are CD34+, SCA-1 +, C- kit+, CD135-, Slamfl/CD150+, and lin- (negative for mature lineage markers including T er1 19,
  • ST-HSCs are less quiescent and more proliferative than LT-HSCs under homeostatic conditions.
  • LT-HSC have greater self renewal potential (i.e., they survive throughout adulthood, and can be serially transplanted through successive recipients), whereas ST-HSCs have limited self renewal (i.e., they survive for only a limited period of time, and do not possess serial transplantation potential). Any of these HSCs can be used in the methods described herein.
  • ST-HSCs are particularly useful because they are highly proliferative and thus, can more quickly give rise to differentiated progeny.
  • hematopoietic stem cell functional potential refers to the functional properties of hematopoietic stem cells which include 1 ) multi-potency (which refers to the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing
  • multi-potency which refers to the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing
  • monocytes e.g., monocytes, macrophages
  • dendritic cells e.g., microglia, osteoclasts
  • lymphocytes e.g., NK cells, B-cells and T-cells
  • human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
  • a human antibody may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or during gene rearrangement or by somatic mutation in vivo).
  • human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • a human antibody can be produced in vitro in a human cell (for example, by recombinant expression) or by a non-human animal or a prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (such as heavy chain and/or light chain) genes.
  • a human antibody when a human antibody is a single chain antibody, it can include a linker peptide that is not found in native human antibodies.
  • an Fv can contain a linker peptide, such as two to about eight glycine or other amino acid residues, which connects the variable region of the heavy chain and the variable region of the light chain. Such linker peptides are considered to be of human origin.
  • Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences. Human antibodies can also be produced using transgenic mice that are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes (see, for example, PCT Publication Nos. WO 1998/24893; WO 1992/01047; WO 1996/34096; WO 1996/33735; U.S. Patent Nos. 5,413,923; 5,625,126;
  • microtubule-binding agent refers to a compound which acts by disrupting the microtubular network that is essential for mitotic and interphase cellular function.
  • a microtubule-binding agent include, but are not limited to, maytasine, maytansinoids, and derivatives thereof, such as those described herein or known in the art, vinca alkaloids, such as vinblastine, vinblastine sulfate, vincristine, vincristine sulfate, vindesine, and vinorelbine, taxanes, such as docetaxel and paclitaxel, macrolides, such as discodermolides, cochicine, and epothilones, and derivatives thereof, such as epothilone B or a derivative thereof.
  • Paclitaxel is marketed as TAXOL®; docetaxel as TAXOTERE®; vinblastine sulfate as VINBLASTIN R.P®; and vincristine sulfate as FARMISTIN®.
  • Generic forms of paclitaxel include, but are not limited to, betaxolol hydrochloride.
  • Various dosage forms of paclitaxel include, but are not limited to albumin nanoparticle paclitaxel marketed as ABRAXANE®; ONXOL®, CYTOTAX®.
  • Discodermolide can be obtained, e.g., as disclosed in U.S. Pat. No. 5,010,099.
  • epotholine derivatives which are disclosed in U.S. Pat. No. 6,194,181 , WO9810121 , W09825929,
  • isolated when used in the context of a protein, e.g., an antibody, refers to a protein that by virtue of its origin or source of derivation is not associated with naturally associated components that accompany it in its native state; is substantially free of other proteins from the same species; is expressed by a cell from a different species; or does not occur in nature.
  • a protein that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
  • a protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art.
  • the term“monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • the term“pharmaceutically acceptable” refers to those compounds, materials, compositions and/or dosage forms, which are suitable for contact with the tissues of a subject, such as a mammal (e.g., a human) without excessive toxicity, irritation, allergic response and other problem complications commensurate with a reasonable benefit/risk ratio.
  • the term“pharmaceutical composition” means a mixture containing a therapeutic compound to be administered to a subject, such as a mammal, e.g., a human, in order to prevent, treat or control a particular disease or condition affecting the mammal, such as an autoimmune disorder, cancer, or blood disorder, among others, e.g., as described herein.
  • the term“patient at risk for GVHD” refers to a patient with one or more risk factors for developing GVHD.
  • Risk factors include, but are not limited to, allogeneic donor transplant (e.g., transplantation of hematopoietic stem cells from a bone marrow transplant), including mismatched human leucocyte antigen (HLA) donor and sex mismatched donor, T cell replete stem cell transplant, donor and recipient age, presence of cytomegalovirus (CMV) or CMV antibodies in transplant donor or host, increased dose of total-body irradiation (TBI), conditioning regimen intensity, acute GVHD prophylaxis, lack of protective environments, splenectomy, immunoglobulin use, underlying disease, ABO compatibility, prior exposure to herpes viruses, donor blood transfusions, performance score, antibiotic gut decontamination, and post-allogeneic transplant blood transfusions.
  • HLA human leucocyte antigen
  • TBI cytomegalovirus
  • TBI total-body i
  • HLA-mismatched refers to a donor-recipient pair in which at least one HLA antigen, in particular with respect to HLA-A, HLA-B and HLA-DR, is mismatched between the donor and recipient, such as a donor providing a hematopoietic stem cell graft to a recipient in need of hematopoietic stem cell transplant therapy.
  • HLA-A, HLA-B and HLA-DR HLA-mismatched
  • HLA-mismatched donor-recipient pairs may have an increased risk of graft rejection relative to HLA-matched donor-recipient pairs, as endogenous T cells and NK cells are more likely to recognize the incoming graft as foreign in the case of an HLA-mismatched donor-recipient pair, and such T cells and NK cells are thus more likely to mount an immune response against the transplant.
  • sample refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) taken from a subject.
  • a specimen e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells
  • scFv refers to a single chain Fv antibody in which the variable domains of the heavy chain and the light chain from an antibody have been joined to form one chain.
  • scFv fragments contain a single polypeptide chain that includes the variable region of an antibody light chain (V L ) (e.g., CDR-L1 , CDR-L2, and/or CDR-L3) and the variable region of an antibody heavy chain (V H ) (e.g., CDR-H1 , CDR-H2, and/or CDR-H3) separated by a linker.
  • V L variable region of an antibody light chain
  • V H variable region of an antibody heavy chain
  • the linker that joins the V L and V H regions of a scFv fragment can be a peptide linker composed of proteinogenic amino acids.
  • linkers can be used to so as to increase the resistance of the scFv fragment to proteolytic degradation (for example, linkers containing D-amino acids), in order to enhance the solubility of the scFv fragment (for example, hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues), to improve the biophysical stability of the molecule (for example, a linker containing cysteine residues that form intramolecular or intermolecular disulfide bonds), or to attenuate the immunogenicity of the scFv fragment (for example, linkers containing glycosylation sites).
  • linkers containing D-amino acids for example, hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues
  • hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues
  • variable regions of the scFv molecules described herein can be modified such that they vary in amino acid sequence from the antibody molecule from which they were derived.
  • nucleotide or amino acid substitutions leading to conservative substitutions or changes at amino acid residues can be made (e.g., in CDR and/or framework residues) so as to preserve or enhance the ability of the scFv to bind to the antigen recognized by the corresponding antibody.
  • telomere binding refers to the ability of an antibody (or an ADC) to recognize and bind to a specific protein structure (epitope) rather than to proteins generally. If an antibody or ADC is specific for epitope "A", the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled "A” and the antibody, will reduce the amount of labeled A bound to the antibody or ADC.
  • an antibody “binds specifically” to a target if the antibody, when labeled, can be competed away from its target by the corresponding non-labeled antibody.
  • an antibody specifically binds to a target, e.g., CD252, if the antibody has a K D for the target of at least about 10 4 M, about 10 5 M, about 10 6 M, about 10 7 M, about 10 8 M, about 10 9 M, about 10 1 ° M, about 10 11 M, about 1 O 12 M, or less (less meaning a number that is less than 1 O 12 , e.g. 1 O 13 ).
  • an antibody specifically binds to a target, e.g., CD252, if the antibody has a K D for the target of at least between about 10 4 M - 10 5 M, about 10 5 M - 10 6 M, about 10 6 M - 10 7 M, about 10 7 M - 10 8 M, about 10 8 M - 10 9 M, about 10 9 M - 10 1 ° M, about 10 1 ° M - 10 11 M, about 10 11 M - 10 12 M, or less (less meaning a number that is less than 10 12 , e.g.
  • K D is determined according to standard bio-layer interferometery (BLI).
  • BBI bio-layer interferometery
  • the antibody or ADC may be capable of specifically binding to two or more antigens which are related in sequence.
  • an antibody can specifically bind to both human and a non-human (e.g., mouse or non-human primate) orthologs of CD252.
  • the terms“subject” and“patient” refer to an organism, such as a human, that receives treatment for a particular disease or condition as described herein.
  • a patient such as a human patient, may receive treatment prior to hematopoietic stem cell transplant therapy in order to promote the engraftment of exogenous hematopoietic stem cells.
  • stem cell disorder broadly refers to any disease, disorder, or condition that may be treated or cured by conditioning a subject's target tissues, and/or by ablating an endogenous stem cell population in a target tissue (e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue) and/or by engrafting or transplanting stem cells in a subject's target tissues.
  • the term“suffering from disease” refers to a subject (e.g., a human) that is experiencing symptoms associated with a disease, such as graft versus host disease (GVHD). It is not intended that the present invention be limited to any particular signs or symptoms, nor disease. Thus, it is intended that the present invention encompass subjects that are experiencing any range of disease, from sub-clinical to full-blown disease, wherein the subject exhibits at least some of the indicia (e.g., signs and symptoms) associated with GVHD.
  • GVHD graft versus host disease
  • transfection refers to any of a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, such as electroporation, lipofection, calcium- phosphate precipitation, DEAE- dextran transfection and the like.
  • the term “transplant” refers to any organ, body tissue, or cell(s) that has been transferred from its site of origin to a recipient site, or the act of doing so.
  • the terms“treat” or“treatment” refers to reducing the severity and/or frequency of disease symptoms, eliminating disease symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of disease symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by disease.
  • Beneficial or desired clinical results include, but are not limited to, promoting the engraftment of exogenous hematopoietic cells in a patient following antibody conditioning therapy as described herein and subsequent hematopoietic stem cell transplant therapy. Additional beneficial results include an increase in the cell count or relative concentration of hematopoietic stem cells in a patient in need of a hematopoietic stem cell transplant following conditioning therapy and subsequent
  • Beneficial results of therapy described herein may also include an increase in the cell count or relative concentration of one or more cells of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte, following conditioning therapy and subsequent hematopoietic stem cell transplant therapy.
  • hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte, following conditioning
  • Additional beneficial results may include the reduction in quantity of a disease-causing cell population, such as a population of cancer cells or autoimmune cells.
  • a disease-causing cell population such as a population of cancer cells or autoimmune cells.
  • the term "prevent” does not require that the disease state be completely thwarted. Rather, as used herein, the term preventing refers to the ability of the skilled artisan to identify a population that is susceptible to disorders, such that administration of the compounds of the present invention may occur prior to onset of a disease. The term does not imply that the disease state is completely avoided.
  • variants and“derivative” are used interchangeably and refer to naturally-occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein.
  • a variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
  • the term“effective amount” or“therapeutically effective amount” refers to an amount that is sufficient to achieve the desired result or to have an effect on GVHD.
  • the specific therapeutically effective dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration; the route of administration; the rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed and like factors well known in the art. Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days.
  • variable region refers to region of an antibody containing the antigen-binding sites (CDRs).
  • CDRs antigen-binding sites
  • variable regions are the amino-terminal domains of the heavy or light chain of the antibody.
  • the variable domain of the heavy chain may be referred to as "VH.”
  • the variable domain of the light chain may be referred to as "VL.” These domains are generally the most variable parts of an antibody.
  • the term“vector” includes a nucleic acid vector, such as a plasmid, a DNA vector, a plasmid, a RNA vector, virus, or other suitable replicon.
  • Expression vectors described herein may contain a polynucleotide sequence as well as, for example, additional sequence elements used for the expression of proteins and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
  • Certain vectors that can be used for the expression of antibodies and antibody fragments of the invention include plasmids that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
  • kits for expression of antibodies and antibody fragments contain polynucleotide sequences that enhance the rate of translation of these genes or improve the stability or nuclear export of the mRNA that results from gene transcription. These sequence elements may include, for example, 5’ and 3’ untranslated regions and a polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
  • the expression vectors described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker include genes that encode resistance to antibiotics, such as ampicillin, chloramphenicol, kanamycin, and nourseothricin.
  • alkyl refers to a straight- or branched-chain alkyl group having, for example, from 1 to 20 carbon atoms in the chain.
  • alkyl groups include methyl, ethyl, n-propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, tert-pentyl, hexyl, isohexyl, and the like.
  • alkylene refers to a straight- or branched-chain divalent alkyl group.
  • the divalent positions may be on the same or different atoms within the alkyl chain.
  • alkylene examples include methylene, ethylene, propylene, isopropylene, and the like.
  • heteroalkyl refers to a straight or branched-chain alkyl group having, for example, from 1 to 20 carbon atoms in the chain, and further containing one or more heteroatoms (e.g., oxygen, nitrogen, or sulfur, among others) in the chain.
  • heteroatoms e.g., oxygen, nitrogen, or sulfur, among others
  • heteroalkylene refers to a straight- or branched-chain divalent heteroalkyl group.
  • the divalent positions may be on the same or different atoms within the heteroalkyl chain.
  • the divalent positions may be one or more heteroatoms.
  • alkenyl refers to a straight- or branched-chain alkenyl group having, for example, from 2 to 20 carbon atoms in the chain.
  • alkenyl groups include vinyl, propenyl, isopropenyl, butenyl, tert-butylenyl, hexenyl, and the like.
  • alkenylene refers to a straight- or branched-chain divalent alkenyl group. The divalent positions may be on the same or different atoms within the alkenyl chain. Examples of alkenylene include ethenylene, propenylene, isopropenylene, butenylene, and the like.
  • heteroalkenyl refers to a straight- or branched-chain alkenyl group having, for example, from 2 to 20 carbon atoms in the chain, and further containing one or more heteroatoms (e.g., oxygen, nitrogen, or sulfur, among others) in the chain.
  • heteroatoms e.g., oxygen, nitrogen, or sulfur, among others
  • heteroalkenylene refers to a straight- or branched-chain divalent heteroalkenyl group.
  • the divalent positions may be on the same or different atoms within the heteroalkenyl chain.
  • the divalent positions may be one or more heteroatoms.
  • alkynyl refers to a straight- or branched-chain alkynyl group having, for example, from 2 to 20 carbon atoms in the chain.
  • alkynyl groups include propargyl, butynyl, pentynyl, hexynyl, and the like.
  • alkynylene refers to a straight- or branched-chain divalent alkynyl group. The divalent positions may be on the same or different atoms within the alkynyl chain.
  • heteroalkynyl refers to a straight- or branched-chain alkynyl group having, for example, from 2 to 20 carbon atoms in the chain, and further containing one or more heteroatoms (e.g., oxygen, nitrogen, or sulfur, among others) in the chain.
  • heteroalkynylene refers to a straight- or branched-chain divalent heteroalkynyl group.
  • the divalent positions may be on the same or different atoms within the heteroalkynyl chain.
  • the divalent positions may be one or more heteroatoms.
  • cycloalkyl refers to a monocyclic, or fused, bridged, or spiro polycyclic ring structure that is saturated and has, for example, from 3 to 12 carbon ring atoms.
  • cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, bicyclo[3.1 .0]hexane, and the like.
  • cycloalkylene refers to a divalent cycloalkyl group.
  • the divalent positions may be on the same or different atoms within the ring structure. Examples of
  • cycloalkylene include cyclopropylene, cyclobutylene, cyclopentylene, cyclohexylene, and the like.
  • heterocycloalkyl refers to a monocyclic, or fused, bridged, or spiro polycyclic ring structure that is saturated and has, for example, from 3 to 12 ring atoms per ring structure selected from carbon atoms and heteroatoms selected from, e.g., nitrogen, oxygen, and sulfur, among others.
  • the ring structure may contain, for example, one or more oxo groups on carbon, nitrogen, or sulfur ring members.
  • heterocycloalkyls include by way of example and not limitation dihydroypyridyl, tetrahydropyridyl (piperidyl), tetrahydrothiophenyl, piperidinyl, 4-piperidonyl, pyrrolidinyl, 2-pyrrolidonyl, tetrahydrofuranyl, tetrahydropyranyl, bis- tetrahydropyranyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl,
  • heterocycloalkylene refers to a divalent heterocyclolalkyl group.
  • the divalent positions may be on the same or different atoms within the ring structure.
  • aryl refers to a monocyclic or multicyclic aromatic ring system containing, for example, from 6 to 19 carbon atoms.
  • Aryl groups include, but are not limited to, phenyl, fluorenyl, naphthyl, and the like. The divalent positions may be one or more heteroatoms.
  • arylene refers to a divalent aryl group.
  • the divalent positions may be on the same or different atoms.
  • heteroaryl refers to a monocyclic heteroaromatic, or a bicyclic or a tricyclic fused-ring heteroaromatic group in which one or more ring atoms is a heteroatom, e.g., nitrogen, oxygen, or sulfur.
  • Heteroaryl groups include pyridyl, pyrrolyl, furyl, thienyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, pyrazolyl, 1 ,2,3-triazolyl, 1 ,2,4-triazolyl, 1 ,2,3- oxadiazolyl, 1 ,2,4-oxadia-zolyl, 1 ,2,5-oxadiazolyl, 1 ,3,4-oxadiazolyl, 1 ,3,4-triazinyl, 1 ,2,3-triazinyl, benzofuryl, [2,3-dihydro]benzofuryl, isobenzofuryl, benzothienyl, benzotriazolyl, isobenzothienyl, indolyl, isoindolyl, 3H-indolyl, benzimidazolyl, imidazo[1
  • heteroarylene refers to a divalent heteroaryl group.
  • the divalent positions may be on the same or different atoms.
  • the divalent positions may be one or more heteroatoms.
  • alkenylene “alkenylene”,“heteroalkenyl”,“heteroalkenylene”,“alkynyl”,“alkynylene”,“heteroalkynyl”, “heteroalkynylene”,“cycloalkyl”,“cycloalkylene”,“heterocyclolalkyl”, heterocycloalkylene”,“aryl,” “arylene”,“heteroaryl”, and“heteroarylene” groups can optionally be substituted with, for example, from 1 to 5 substituents selected from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkyl aryl, alkyl heteroaryl, alkyl cycloalkyl, alkyl heterocycloalkyl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, hetero
  • substitution may include situations in which neighboring substituents have undergone ring closure, such as ring closure of vicinal functional substituents, to form, for instance, lactams, lactones, cyclic anhydrides, acetals, hemiacetals, thioacetals, aminals, and hemiaminals, formed by ring closure, for example, to furnish a protecting group.
  • ring closure such as ring closure of vicinal functional substituents, to form, for instance, lactams, lactones, cyclic anhydrides, acetals, hemiacetals, thioacetals, aminals, and hemiaminals, formed by ring closure, for example, to furnish a protecting group.
  • radical naming conventions can include either a mono radical or a di-radical, depending on the context.
  • a substituent requires two points of attachment to the rest of the molecule, it is understood that the substituent is a di-radical.
  • a substituent identified as alkyl that requires two points of attachment includes di radicals such as -CFI2-, -CFI2CFI2-, -CFl2CFI(CFl3)CFl2-, and the like.
  • Other radical naming conventions clearly indicate that the radical is a di-radical such as "alkylene,” “alkenylene,” “arylene,”“heterocycloalkylene,” and the like.
  • the present invention is based in part on the discovery of that antibodies, or antigen binding fragments thereof, capable of binding CD252 (also referred to as 0X40 ligand (OX40L), Protein NCBI Reference Sequence: NP 003317.1 ; Uniprot Accession No: P23510; SEQ ID NOs:
  • Such antibodies can be used alone or conjugated to a cytotoxin as an antibody drug conjugate (ADC).
  • ADC antibody drug conjugate
  • methods and compositions (e.g., ADCs) described herein include an anti-CD252 antibody whose heavy and light chain amino acid sequences are set forth in SEQ ID NOs. 1 and 2, respectively.
  • an anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 1 , and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 2.
  • an anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 1 , and a light chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 2.
  • the amino acid sequences of SEQ ID NOs: 1 and 2 are provided below.
  • a anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NOs: 3-5, and a light chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 6-8.
  • the amino acid sequences of SEQ ID NOs: 3-8 are provided below.
  • Anti-CD252 VH amino acid sequence (the following CDR sequences are defined by IMGT) EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYAMNWVRQAPGKGLEWVSTISGSGGATRYADS VKGRFTISRDNSRNTVYLQMNSLRVEDTAVFYCTKDRLIMATVRGPYYYGMDVWGQGTTVTVSS
  • CDR-H2 ISGSGGAT (SEQ ID NO: 4)
  • CDR-H3 TKDRLIMATVRGPYYYGMDV (SEQ ID NO: 5)
  • Anti-CD252 VL amino acid sequence (the following CDR sequences are defined by IMGT) DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPNLLIYAASSLQSGVPSRFSGS GSETDFTLTISSLQPEDFATYYCQQSHSVSFTFGPGTKVDIK (SEQ ID NO: 2)
  • CDR-L2 AAS (SEQ ID NO: 7)
  • CDR-L3 QQSHSVSFT (SEQ ID NO: 8)
  • an anti-CD252 antibody used in the methods and compositions disclosed herein is an intact antibody comprising a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 1 , and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 2.
  • the anti-CD252 antibody is engineered to have a short half life.
  • an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is an antibody selected from 1 1 C3.1 (Biolegend, Catalog #326302), 159403 (R&D Systems, Catalog #MAB10541 ), 159408 (R&D Systems, Catalog #MAB1054), MM0505-8S23 (Novus, Catalog #NBP2-1 1969), or oxelumab (Novus Catalog
  • an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody 1 1 C3.1 or an anti-CD252 antibody comprising antigen binding regions corresponding to the 1 1 C3.1 antibody. 1 1 C3.1 (sold by Biolegend Cat. No. 326302 (date February 27, 2019)).
  • an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 1 1 C3.1 , and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 1 1 C3.1.
  • an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized 1 1 C3.1 antibody.
  • an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody 159403 or an anti-CD252 antibody comprising antigen binding regions corresponding to the 159403 antibody. 159403 (sold by R&D Systems, Catalog #MAB10541 (date February 27, 2019)).
  • an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 159403, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 159403.
  • an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized 159403 antibody.
  • an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody 159408 or an anti-CD252 antibody comprising antigen binding regions corresponding to the 159408 antibody. 159408 (sold by R&D Systems, Catalog #MAB1054 (date February 27, 2019)).
  • an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 159408, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody 159408.
  • an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized 159408 antibody.
  • an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the murine monoclonal anti-CD252 antibody MM0505-8S23 or an anti-CD252 antibody comprising antigen binding regions corresponding to the MM0505-8S23 antibody.
  • MM0505-8S23 sold by Novus, Catalog #NBP2-1 1969 (date February 27, 2019)
  • This antibody was produced from a hybridoma (mouse myeloma fused with spleen cells from a mouse immunized with human TNFSF4, also called 0X40 ligand.
  • an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody MM0505-8S23, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody MM0505-8S23.
  • an anti-CD252 antibody used in the compositions and methods disclosed herein is a humanized MM0505-8S23 antibody.
  • an anti-CD252 antibody that may be used in the methods and compositions (including ADCs) described herein is the rabbit monoclonal anti-CD252 antibody oxelumab or an anti-CD252 antibody comprising antigen binding regions corresponding to the oxelumab antibody.
  • Oxelumab sold by Novus, Catalog #NBP2-52687-0.1 (date February 27, 2019)).
  • an anti-CD252 antibody comprises a heavy chain comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody oxelumab, and a light chain variable region comprising a CDR1 , CDR2 and CDR3 of anti-CD252 antibody oxelumab.
  • an anti- CD252 antibody used in the compositions and methods disclosed herein is a humanized oxelumab antibody.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain as set forth in the amino acid sequence of SEQ ID NO: 9, and a light chain chain as set forth in the amino acid sequence of SEQ ID NO: 10.
  • the anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 17, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 18.
  • an anti-CD252 antibody, or antigen binding portion thereof comprises a heavy chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 1 1 -13, and a light chain variable region comprising CDRs as set forth in the amino acid sequence of SEQ ID NO: 14-16.
  • the antibody is an intact antibody comprising a heavy chain variable region as set forth in the amino acid sequence of SEQ ID NO: 17, and a light chain variable region as set forth in the amino acid sequence of SEQ ID NO: 18.
  • the amino acid sequences of SEQ ID NOs: 9-16 are provided below.
  • oxelumab full length heavy chain sequence (the following CDR sequences are defined by
  • IMGT the heavy chain variable region (SEQ ID NO: 17) has been underlined):
  • CDR-H1 GFTFNSYA (SEQ ID NO: 1 1 )
  • CDR-H2 ISGSGGFT (SEQ ID NO: 12)
  • CDR-H3 AKDRLVAPGTFDY (SEQ ID NO: 13) oxelumab full length light chain sequence (the following CDR sequences are defined by IMGT; the light chain variable region (SEQ ID NO: 18) has been underlined):
  • CDR-L2 AAS (SEQ ID NO: 15)
  • an anti-CD252 antibody, or binding fragment thereof, used in the methods and compositions disclosed herein comprises a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR. Certain amino acid positions within the Fc region are known through crystallography studies to make a direct contact with FcyR.
  • the anti-CD252 antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an Fc.y.R based on structural and crystallographic analysis.
  • the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
  • the Fc region comprises a D265A mutation. In one embodiment, the Fc region comprises a D265C mutation. In some embodiments, the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L234A mutation. In some embodiments, the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat.
  • the Fc region comprises a L235A mutation. In yet another embodiment, the Fc region comprises a L234A and L235A mutation . In a further embodiment, the Fc region comprises a D265C, L234A, and L235A mutation.
  • a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an Fc.gamma.R and/or C1q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
  • Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and
  • an anti-CD252 antibody comprising a modified Fc region (e.g., comprising a L234A, L235A, and a D265C mutation) has substantially reduced or abolished effector functions.
  • Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORETM. analysis or OctetTM analysis (forteBIO)), and other methods such as indirect binding assays, competitive binding assays fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
  • equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay
  • binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
  • a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
  • the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays. In this case, the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
  • the antibodies of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281 : 23514-24), (Zalevsky et al. (2010) Nat Biotechnol 28: 157-9),
  • Exemplary mutations that may be made singularly or in combination are T250Q, M252Y, 1253A, S254T, T256E, P2571 , T307A, D376V, E380A, M428L, H433K, N434S, N434A, N434H, N434F, H435A and H435R mutations.
  • the Fc region comprises a mutation resulting in a decrease in half life.
  • An antibody having a short half life may be advantageous in certain instances where the antibody is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the antibody is administered followed by FISCs. Ideally, the antibody would be substantially cleared prior to delivery of the FISCs, which also generally express CD252 but are not the target of the anti-CD252 antibody, unlike the endogenous stem cells.
  • the Fc regions comprises a mutation at position 435 (EU index according to Kabat). In one
  • the mutation is an FI435A mutation.
  • the anti-CD252 antibody described herein has a half life of equal to or less than about 14 hours, equal to or less than about 13 hours, equal to or less than about 12 hours, or equal to or less than about 1 1 hours. In one embodiment, the anti-CD252 antibody described herein has a half life of equal to or less than about 24 hours, a half life of equal to or less than about 22 hours, a half life of equal to or less than about 20 hours, a half life of equal to or less than about 18 hours, a half life of equal to or less than about 16 hours, a half life of equal to or less than about 14 hours, equal to or less than about 13 hours, equal to or less than about 12 hours, or equal to or less than about 1 1 hours.
  • the half life of the antibody is between about 1 hour to about 20 hours, between about 2 hours to about 18 hours, between about 4 hours to about 16 hours, between about 6 hours to about 14 hours, between about 8 hours to about 12 hours, between about 1 1 hours to about 12 hours, between about 1 1 hours to about 24 hours; between about 12 hours to about 22 hours; between about 10 hours to about 20 hours; between about 8 hours to about 18 hours; between about 1 hours to about 6 hours, between about 2 hours to about 5 hours, between about 3 hours to about 4 hours, or between about 14 hours to about 24 hours.
  • the Fc region comprises two or more mutations that confer reduced half- life and greatly diminish or completely abolish an effector function of the antibody.
  • the Fc region comprises a mutation resulting in a decrease in half-life and a mutation of at least one residue that can make direct contact with an FcyR (e.g., as based on structural and crystallographic analysis).
  • the Fc region comprises a FI435A mutation, a L234A mutation, and a L235A mutation.
  • the Fc region comprises a H435A mutation and a D265C mutation.
  • the Fc region comprises a FI435A mutation, a L234A mutation, a L235A mutation, and a D265C mutation.
  • the antibody or antigen-binding fragment thereof is conjugated to a cytotoxin (e.g., amatoxin) by way of a cysteine residue in the Fc domain of the antibody or antigen binding fragment thereof.
  • the cysteine residue is introduced by way of a mutation in the Fc domain of the antibody or antigen-binding fragment thereof.
  • the cysteine residue may be selected from the group consisting of Cys1 18, Cys239, and Cys265.
  • the Fc region of the anti-CD252 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat.
  • the Fc region comprises a D265C mutation.
  • the Fc region comprises a D265C and FI435A mutation. In one embodiment, the Fc region comprises a D265C, a L234A, and a L235A mutation. In one embodiment, the Fc region comprises a D265C, a L234A, a L235A, and a FI435A mutation.
  • the cysteine residue is naturally occurring in the Fc domain of the antibody or antigen-binding fragment thereof.
  • the Fc domain may be an IgG Fc domain, such as a human lgG1 Fc domain, and the cysteine residue may be selected from the group consisting of Cys261 , Csy321 , Cys367, and Cys425.
  • D265C is an Fc variant with the aspartic acid (D) at EU position 265 substituted with cysteine (C) relative to the parent Fc domain.
  • D265C/L234A/L235A defines a variant Fc variant with substitutions at EU positions 265 (D to C), 234 (L to A), and 235 (L to A) relative to the parent Fc domain.
  • a variant can also be designated according to its final amino acid composition in the mutated EU amino acid positions.
  • the L234A/L235A mutant can be referred to as LALA. It is noted that the order in which substitutions are provided is arbitrary.
  • the anti-CD252 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
  • the anti-CD252 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
  • an anti-CD252 antibody, or antigen binding fragment thereof has a certain dissociation rate which is particularly advantageous when used as a part of a conjugate.
  • an anti-CD252 antibody has, in certain embodiments, an off rate constant (Koff) for human CD252 and/or rhesus CD252 of 1 x 10 2 to 1 x 10 3 , 1 x 10 3 to 1 x 10 4 , 1 x 10 5 to 1 x 10 6 ,
  • the antibody or antigen-binding fragment thereof binds CD252 (e.g., human CD252 and/or rhesus CD252) with a K D of about 100 nM or less, about 90nM or less, about 80 nM or less, about 70 nM or less, about 60 nM or less, about 50 nM or less, about 40 nM or less, about 30 nM or less, about 20 nM or less, about 10 nM or less, about 8 nM or less, about 6 nM or less, about 4 nM or less, about 2 nM or less, about 1 nM or less as determined by a Bio-Layer Interferometry (BLI) assay.
  • BBI Bio-Layer Interferometry
  • the antibody or antigen-binding fragment thereof binds CD252 (e.g., human CD252 and/or rhesus CD252) with a K D of between about 90 nM - 100 nM, between about 80 nM - 90nM, between about 70 nM - 80 nM, between about 60 nM - 70 nM, between about 50 nM - 60 nM, between about 40 nM - 50 nM, between about 30 nM - 40 nM, between about 20 nM - 30 nM, between about 10 nM - 20 nM, between about 8 nM - 10 nM, between about 6 nM - 8 nM, between about 4 nM - 6 nM, between about 2 nM - 4 nM, between about 1 nM - 2 nM, or about 1 nM or less as determined by a Bio-Layer Interferometry (BLI) as
  • antibodies, and binding fragments thereof, disclosed herein can be used in conjugates, as described in more detail below.
  • Exemplary antigen-binding fragments of the foregoing antibodies include a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab’) 2 molecule, and a tandem di- scFv, among others.
  • scFv single-chain Fv molecule
  • the anti-CD252 antibodies described herein can be in the form of full-length antibodies, bispecific antibodies, dual variable domain antibodies, multiple chain or single chain antibodies, and/or binding fragments that specifically bind human CD252, including but not limited to Fab, Fab', (Fab')2, Fv), scFv (single chain Fv), surrobodies (including surrogate light chain construct), single domain antibodies, camelized antibodies and the like. They also can be of, or derived from, any isotype, including, for example, IgA (e.g., lgA1 or lgA2), IgD, IgE, IgG (e.g.
  • the anti-CD252 antibody is an IgG (e.g. lgG1 , lgG2, lgG3 or lgG4).
  • the anti-CD252 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
  • the anti-CD252 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
  • Anti-CD252 antibodies that can be used in the compositions and methods disclosed herein can be produced using methods known in the art.
  • Anti-CD252 antibodies can be generated from an isolated nucleic acid molecule that comprises a nucleotide sequence encoding an amino acid sequence of a CD252 binding molecule provided by the present disclosure.
  • the amino acid sequence encoded by the nucleotide sequence may be any portion of an antibody, such as a CDR, a sequence comprising one, two, or three CDRs, a variable region of a heavy chain, variable region of a light chain, or may be a full-length heavy chain or full length light chain.
  • a nucleic acid of the disclosure can be, for example, DNA or RNA, and may or may not contain intronic sequences.
  • the nucleic acid is a cDNA molecule.
  • Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567.
  • isolated nucleic acid encoding an anti- CD252 antibody described herein is provided.
  • Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors
  • a host cell comprising such nucleic acid is provided.
  • a host cell comprises (e.g., has been transformed with): (1 ) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell).
  • a method of making an anti-CLL-1 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
  • nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli.)
  • the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A);
  • human lung cells W138; human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as YO, NSO and Sp2/0.
  • anti-CD252 antibodies, antigen-binding fragments thereof, useful in the compositions and methods disclosed herein can be identified using techniques known in the art and described herein, such as by immunization, computational modeling techniques, and in vitro selection methods, such as the phage display and cell-based display platforms described below.
  • Anti-CD252 antibodies that can be used in the compositions and methods described herein can be identified using techniques known in the art, such as hybridoma production). Hybridomas can be prepared using a murine system. Protocols for immunization and subsequent isolation of splenocytes for fusion are known in the art. Fusion partners and procedures for hybridoma generation are also known. In making anti-CD252 antibodies, the CD252 antigen is isolated and/or purified. In some embodiments, the CD252 antigen may be a fragment of CD252.
  • Immunization of animals can be performed by any method known in the art. See, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, New York: Cold Spring Harbor Press, 1990. Methods for immunizing animals such as mice, rats, sheep, goats, pigs, cattle and horses are well known in the art. See, e.g., Harlow and Lane, supra, and U.S. Pat. No. 5,994,619.
  • the CD252 antigen may be administered with an adjuvant to stimulate the immune response.
  • Adjuvants known in the art include complete or incomplete Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM
  • antibody-producing immortalized cell lines are prepared from cells isolated from the immunized animal.
  • lymph node and/or splenic B cells are sacrificed.
  • Hybridomas can be selected, cloned and further screened for desirable characteristics, including robust growth, high antibody production and desirable antibody characteristics.
  • Human anti- CD252 antibodies can also be generated in mice, such as in the HuMAb-Mouse® or XenoMouseTM.
  • Methods for high throughput screening of antibody, or antibody fragment, libraries for molecules capable of binding CD252 can be used to identify and affinity mature antibodies useful for treating cancers, autoimmune diseases, and conditioning a patient (e.g., a human patient) in need of hematopoietic stem cell therapy as described herein.
  • Such methods include in vitro display techniques known in the art, such as phage display, bacterial display, yeast display, mammalian cell display, ribosome display, mRNA display, and cDNA display, among others.
  • phage display to isolate ligands that bind biologically relevant molecules has been reviewed, for example, in Felici et al., Biotechnol. Annual Rev. 1 :149-183, 1995; Katz, Annual Rev. Biophys. Biomol. Struct. 26:27-45, 1997; and Hoogenboom et al., Immunotechnology 4:1 -20,
  • Randomized combinatorial peptide libraries have been constructed to select for polypeptides that bind cell surface antigens as described in Kay, Perspect. Drug
  • computational modeling techniques can be used to design and identify antibodies, or antibody fragments, in silico that bind CD252.
  • computational modeling techniques can be used to design and identify antibodies, or antibody fragments, in silico that bind CD252.
  • one of skill in the art can screen libraries of antibodies, or antibody fragments, in silico for molecules capable of binding specific epitopes, such as extracellular epitopes of this antigen.
  • the antibodies, or antigen-binding fragments thereof, identified by these computational techniques can be used in conjunction with the therapeutic methods described herein.
  • Additional techniques can be used to identify antibodies, or antigen-binding fragments thereof, that bind CD252 on the surface of a cell (e.g., a cancer cell, autoimmune cell, or hematopoietic stem cell) and that are internalized by the cell, for instance, by receptor-mediated endocytosis.
  • a cell e.g., a cancer cell, autoimmune cell, or hematopoietic stem cell
  • the in vitro display techniques described above can be adapted to screen for antibodies, or antigen-binding fragments thereof, that bind CD252 on the surface of an APC and that are subsequently internalized.
  • Phage display represents one such technique that can be used in conjunction with this screening paradigm.
  • recombinant phage libraries can be produced that encode antibodies, antibody fragments, such as scFv fragments, Fab fragments, diabodies, triabodies, and 10 Fn3 domains, among others, that contain randomized amino acid cassettes (e.g., in one or more, or all, of the CDRs or equivalent regions thereof or an antibody or antibody fragment).
  • Exemplary antigen binding fragments of the foregoing antibodies include a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab’) 2 molecule, and a tandem di-scFv, among others.
  • the framework regions, hinge, Fc domain, and other regions of the antibodies or antibody fragments may be designed such that they are non-immunogenic in humans, for instance, by virtue of having human germline antibody sequences or sequences that exhibit only minor variations relative to human germline antibodies.
  • phage libraries containing randomized antibodies, or antibody fragments, covalently bound to the phage particles can be incubated with CD252 antigen, for instance, by first incubating the phage library with blocking agents (such as, for instance, milk protein, bovine serum albumin, and/or IgG so as to remove phage encoding antibodies, or fragments thereof, that exhibit non-specific protein binding and phage that encode antibodies or fragments thereof that bind Fc domains, and then incubating the phage library with a population of APCs.
  • blocking agents such as, for instance, milk protein, bovine serum albumin, and/or IgG so as to remove phage encoding antibodies, or fragments thereof, that exhibit non-specific protein binding and phage that encode antibodies or fragments thereof that bind Fc domains
  • the phage library can be incubated with the target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to allow CD252-specific antibodies, or antigen-binding fragments thereof, to bind cell-surface CD252 252 antigen and to subsequently be internalized by the cancer cells, autoimmune cells, or
  • hematopoietic stem cells e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C.
  • Phage containing antibodies, or fragments thereof, that do not exhibit sufficient affinity for one or more of these antigens so as to permit binding to, and internalization by, cancer cells, autoimmune cells, or hematopoietic stem cells can subsequently be removed by washing the cells, for instance, with cold (4° C) 0.1 M glycine buffer at pH 2.8.
  • Phage bound to antibodies, or fragments thereof, or that have been internalized by the cancer cells, autoimmune cells, or hematopoietic stem cells can be identified, for instance, by lysing the cells and recovering internalized phage from the cell culture medium.
  • the phage can then be amplified in bacterial cells, for example, by incubating bacterial cells with recovered phage in 2xYT medium using methods known in the art. Phage recovered from this medium can then be characterized, for instance, by determining the nucleic acid sequence of the gene(s) encoding the antibodies, or fragments thereof, inserted within the phage genome.
  • the encoded antibodies, or fragments thereof, or can subsequently be prepared de novo by chemical synthesis (for instance, of antibody fragments, such as scFv fragments) or by recombinant expression (for instance, of full-length antibodies).
  • the internalizing capacity of the prepared antibodies, or fragments thereof can be assessed, for instance, using radionuclide internalization assays known in the art.
  • antibodies, or fragments thereof, identified using in vitro display techniques described herein or known in the art can be functionalized by incorporation of a radioactive isotope, such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 211 At, 67 Ga, 111 1n, "Tc, 169 Yb, 186 Fle, 64 Cu, 67 Cu, 177 Lu, 77 As, 72 As, 86 Y, 90 Y, 89 Zr, 212 Bi, 213 Bi, or 225 Ac.
  • a radioactive isotope such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 211 At, 67 Ga, 111
  • radioactive halogens such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 1, 211 At, can be incorporated into antibodies, or fragments thereof, using beads, such as polystyrene beads, containing electrophilic halogen reagents (e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA).
  • Radiolabeled antibodies, or fragments thereof can be incubated with cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to permit internalization (e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C).
  • the cells can then be washed to remove non-internalized antibodies, or fragments thereof, (e.g., using cold (4° C) 0.1 M glycine buffer at pH 2.8).
  • Internalized antibodies, or fragments thereof can be identified by detecting the emitted radiation (e.g., y-radiation) of the resulting cancer cells, autoimmune cells, or hematopoietic stem cells in comparison with the emitted radiation (e.g., g-radiation) of the recovered wash buffer.
  • ADCs Antibody Drug Conjugates
  • Anti-CD252 antibodies, and antigen-binding fragments thereof, described herein can be conjugated (linked) to a cytotoxin, thus forming an antibody drug conjugate (ADC).
  • ADC antibody drug conjugate
  • the cytotoxic molecule is conjugated to a cell internalizing antibody, or antigen binding fragment thereof as disclosed herein such that following the cellular uptake of the
  • ADCs may be represented by the formula Ab-Z-L-Cy, where Ab is the antibody or antigen-binding fragment thereof that binds CD252, Z is a chemical moiety formed from a coupling reaction between a reactive functional group present on the linker and a reactive functional group present within the antibody, or antigen-binding fragment thereof, L is a linker, and Cy is a cytotoxin, each as disclosed herein.
  • Cytotoxins suitable for use with the compositions and methods described herein include DNA-intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin, and derivatives thereof), and agents capable of disrupting protein biosynthesis (e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain), among others known in the art.
  • DNA-intercalating agents e.g., anthracyclines
  • agents capable of disrupting the mitotic spindle apparatus e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof
  • RNA polymerase inhibitors e.g., an amatoxin, such as a-amanitin,
  • the cytotoxin is a microtubule-binding agent (for instance,
  • maytansine or a maytansinoid an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, an
  • the cytotoxin is a maytansinoid selected from the group consisting of DM1 and DM4.
  • the cytotoxin is an auristatin selected from the group consisting of monomethyl auristatin E and monomethyl
  • the cytotoxin is an anthracycline selected from the group consisting of daunorubicin, doxorubicin, epirubicin, and idarubicin.
  • the cytotoxin is a pyrrolobenzodiazepine dimer represented by formula
  • the cytotoxin is conjugated to the antibody, or the antigen-binding fragment thereof, by way of a maleimidocaproyl linker.
  • the cytotoxin is an auristatin selected from the group consisting of monomethyl auristatin E and monomethyl auristatin F.
  • the cytotoxin is an anthracycline selected from the group consisting of daunorubicin, doxorubicin, epirubicin, and idarubicin.
  • cytotoxins suitable for use with the compositions and methods described herein include, without limitation, 5-ethynyluracil, abiraterone, acylfulvene, adecypenol, adozelesin, aldesleukin, altretamine, ambamustine, amidox, amifostine, aminolevulinic acid, amrubicin, amsacrine, anagrelide, anastrozole, andrographolide, angiogenesis inhibitors, antarelix, anti-dorsalizing morphogenetic protein-1 , antiandrogen, prostatic carcinoma, antiestrogen, antineoplaston, antisense oligonucleotides, aphidicolin glycinate, apoptosis gene modulators, apoptosis regulators, apurinic acid, asulacrine, atamestane, atrimustine, axinastatin 1 , axinastatin 2, axina
  • the cytotoxin of the antibody-drug conjugate is an RNA polymerase inhibitor.
  • the RNA polymerase inhibitor is an amatoxin or derivative thereof.
  • the cytotoxin is an amatoxin or derivative thereof, such as a-amanitin, b- amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin. Structures of the various naturally occurring amatoxins are disclosed in, e.g.,
  • the cytotoxin is an amanitin.
  • the antibodies, or antigen-binding fragments, described herein may be bound to an amatoxin (i.e., the cytotoxin Cy is an amatoxin) so as to form a conjugate represented by the formula Ab-Z-L-Am, wherein Ab is the antibody, or antigen-binding fragment thereof, L is a linker,
  • amatoxin-linker conjugate Am-L-Z is represented by formula (I)
  • Ri is H, OH, OR A , or OR c ;
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H, R c , or R D ;
  • R 4 is H, OH, OR c , OR d , R c , or R D ;
  • R 5 is H, OH, ORc, OR d , R c , or R D ;
  • R 6 is H, OH, ORc, OR d , R c , or R D ;
  • R 7 is H, OH, ORc, OR d , R c , or R D ;
  • R 8 is OH, NH 2 , OR C , OR d , NHR c , or NR C R D ;
  • R g is H, OH, OR c , or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • R c is -L-Z
  • R D is optionally substituted alkyl (e.g., Ci-C 6 alkyl), optionally substituted heteroalkyl (e.g., Ci-C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
  • alkyl e.g., Ci-C 6 alkyl
  • heteroalkyl e.g., Ci-C 6 heteroalkyl
  • optionally substituted alkenyl e.g., C 2 -C 6
  • Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD252.
  • Am contains exactly one R c substituent.
  • R A and R B together with the oxygen atoms to which they are bound, combine to form a 5-membered heterocycloalkyl group of formula:
  • R E and Rp are each independently optionally substituted C C 6 alkylene-R c , optionally substituted C C 6 heteroalkylene-R c , optionally substituted C 2 -C 6 alkenylene-R c , optionally substituted C 2 -C 6 heteroalkenylene-R c , optionally substituted C 2 -C 6 alkynylene-R c , optionally substituted C 2 -C 6 heteroalkynylene-R c , optionally substituted cydoalkylene-R c , optionally substituted heterocydoalkylene-R c , optionally substituted arylene-R c , or optionally substituted heteroarylene-Rc-
  • Am-L-Z is represented by formula I,
  • R ⁇ is H, OH, OR A , or OR c ;
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
  • R 4 is H, OH, ORc, OR d , R C , or R D ;
  • R 5 is H, OH, ORc, OR d , R C , or R D ;
  • R 6 is H, OH, ORc, ORD, R c , or R D ;
  • R 7 is H, OH, ORc, ORD, R c , or R D ;
  • R 8 is OH, NH 2 , OR C , or NHR c ;
  • R g is H or OH
  • Am-L-Z is represented by formula I,
  • R ⁇ is H, OH, OR A , or OR c ;
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
  • R 3 is H or R c ;
  • R 4 and R 5 are each independently H, OH, OR c , Rc, or OR D ;
  • R 6 and R 7 are each H
  • R 8 is OH, NH 2 , OR C , or NHR c ;
  • R g is H or OH
  • Am-L-Z is represented by formula I,
  • R is H, OH, or OR A ;
  • R 2 is H, OH, or OR B ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
  • R 3 , R 4 , R 6 , and R 7 are each H;
  • R 5 is ORc!
  • R 8 is OH or NH 2 ;
  • R 9 is H or OH
  • Am-L-Z is represented by formula I,
  • R ⁇ and R 2 are each independently H or OH;
  • R 3 is R c ;
  • R 4 , R 6 , and R 7 are each H;
  • R 5 is H, OH, or OCi-C 6 alkyl
  • R 8 is OH or NH 2 ;
  • R g is H or OH
  • Am-L-Z is represented by formula I,
  • R and R 2 are each independently H or OH;
  • R 3 , R 6 , and R 7 are each H;
  • R 4 and R 5 are each independently H, OH, OR c , or R c ;
  • R 8 is OH or NH 2 ;
  • R g is H or OH
  • Am-L-Z is represented by formula I,
  • R ⁇ and R 2 are each independently H or OH;
  • R 3 , R 6 , and R 7 are each H;
  • R 4 and R 5 are each independently H or OH
  • R 8 is OH, NH 2 , OR C , or NHR c ;
  • Rg is H or OH
  • the linker comprises a -(CH 2 ) n - unit, where n is an integer from 2-6. In some embodiments, the linker includes -(CH 2 ) n - where n is 6. In some embodiments, the linker L and the chemical moiety Z, taken together as L-Z, is
  • S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD252 (e.g., from the -SH group of a cysteine residue.
  • Am-L-Z-Ab is:
  • Am-L-Z is represented by formula (IA)
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H, R c , or R D ;
  • R 4 is H, OH, ORc, OR d , R C , or R D ;
  • R 5 is H, OH, ORc, OR d , R c , or R D ;
  • R 6 is H, OH, ORc, OR D , R c , or R D ;
  • R 7 is H, OH, ORc, OR D , R c , or R D ;
  • R 8 is OH, NH 2 , OR C , OR d , NHR c , or NR C R D ;
  • R g is H, OH, OR c , or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • R c is -L-Z
  • R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
  • L is a linker, such as optionally substituted alkylene (e.g., C C 6 alkylene), optionally substituted heteroalkylene (C C 6 heteroalkylene), optionally substituted alkenylene (e.g.,
  • Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD252;
  • linker L and the chemical moiety Z, taken together as L-Z is
  • Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • Am-L-Z is represented by formula (IB)
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
  • R 3 is H, R c , or R D ;
  • R 4 is H, OH, OR c , OR d , R c , or R D ;
  • R 5 is H, OH, ORc, OR d , R c , or R D ;
  • R 6 is H, OH, ORc, OR d , R c , or R D ;
  • R 7 is H, OH, ORc, OR d , R c , or R D ;
  • R 8 is OH, NH 2 , OR C , OR d , NHR c , or NR C R D ;
  • R g is H, OH, OR c , or OR D ;
  • X is -S-, -S(O)-, or -S0 2 -;
  • R c is -L-Z
  • R D is optionally substituted alkyl (e.g., Ci-C 6 alkyl), optionally substituted heteroalkyl (e.g., Ci-C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
  • alkyl e.g., Ci-C 6 alkyl
  • heteroalkyl e.g., Ci-C 6 heteroalkyl
  • optionally substituted alkenyl e.g., C 2 -C 6
  • optionally substituted alkylene e.g., C C 6 alkylene
  • C C 6 heteroalkylene optionally substituted alkeny
  • Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD252; and wherein Am contains exactly one R c substituent.
  • R A and R B together with the oxygen atoms to which they are bound, combine to form a 5-membered heterocycloalkyl group of formula:
  • R E and Rp are each independently optionally substituted C C 6 alkylene-R c , optionally substituted C C 6 heteroalkylene-R c , optionally substituted C 2 -C 6 alkenylene-R c , optionally substituted C 2 -C 6 heteroalkenylene-R c , optionally substituted C 2 -C 6 alkynylene-R c , optionally substituted C 2 -C 6 heteroalkynylene-R c , optionally substituted cydoalkylene-R c , optionally substituted heterocydoalkylene-R c , optionally substituted arylene-R c , or optionally substituted heteroarylene-Ro
  • Am-L-Z is represented by formula (IA) or formula (IB),
  • R 2 is H, OH, ORB, or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
  • R 3 is H or R c ;
  • R 4 is H, OH, ORc, OR d , R C , or R D ;
  • R 5 is H, OH, ORc, OR d , R c , or R D ;
  • R 6 is H, OH, ORc, ORD, R c , or R D ;
  • R 7 is H, OH, ORc, OR d , R c , or R D ;
  • R 8 is OH, NH 2 , OR C , or NHR c ;
  • R g is H or OH
  • Am-L-Z is represented by formula (IA) or formula (IB), wherein Ri is H, OH, OR A , or OR c ;
  • R 2 is H, OH, OR b , or OR c ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
  • R 3 is H or R c ;
  • R 4 and R 5 are each independently H, OH, OR c , Rc, or OR D ;
  • R 6 and R 7 are each H
  • R 8 is OH, NH 2 , OR C , or NHR c ;
  • R g is H or OH
  • Am-L-Z is represented by formula (IA) or formula (IB), wherein R is H, OH, or OR A ;
  • R 2 is H, OH, or OR B ;
  • R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
  • R 3 , R 4 , R 6 , and R 7 are each H;
  • R5 is ORc!
  • R 8 is OH or NH 2 ;
  • R 9 is H or OH
  • amatoxin conjugates are described, for example, in US Patent Application Publication No. 2016/0002298, the disclosure of which is incorporated herein by reference in its entirety.
  • Am-L-Z is represented by formula (IA) or formula (IB), wherein R ⁇ and R 2 are each independently H or OH; R 3 is R c ;
  • R 4 , R 6 , and R 7 are each H;
  • R 5 is H, OH, or OC C 6 alkyl
  • R 8 is OH or NH 2 ;
  • R g is H or OH
  • amatoxin conjugates are described, for example, in US Patent Application Publication No. 2014/0294865, the disclosure of which is incorporated herein by reference in its entirety.
  • Am-L-Z is represented by formula (IA) or formula (IB),
  • R and R 2 are each independently H or OH;
  • R 3 , R 6 , and R 7 are each H;
  • R 4 and R 5 are each independently H, OH, OR c , or R c ;
  • R 8 is OH or NH 2 ;
  • R 9 is H or OH
  • amatoxin conjugates are described, for example, in US Patent Application Publication No. 2015/0218220, the disclosure of which is incorporated herein by reference in its entirety.
  • Am-L-Z is represented by formula (IA) or formula (IB),
  • R ⁇ and R 2 are each independently H or OH;
  • R 3 , R 6 , and R 7 are each H;
  • R 4 and R 5 are each independently H or OH
  • Rg is OH, NH 2 , OR C , or NHR c ;
  • Rg is H or OH
  • amatoxin conjugates are described, for example, in US Patent Nos. 9,233,173 and 9,399,681 , as well as in US 2016/0089450, the disclosures of each of which are incorporated herein by reference in their entirety.
  • linker L and the chemical moiety Z, taken together as L-Z is
  • Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • maleimide reacts with a thiol group found on a cysteine in the antibody.
  • Am-L-Z is represented by formula (II), formula (IIA), or formula (MB)
  • Ri is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen binding fragment thereof; and R 2 is H or a linker covalently bound to the antibody or antigen binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; wherein when R ⁇ is H, R 2 is the linker, and when R 2 is H, R ⁇ is the linker.
  • the linker comprises a -(CH 2 ) n - unit, where n is an integer from 2-6. In some embodiments, is the linker and R 2 is H, and the linker and chemical moiety, together as L-Z, is
  • Ab-Z-L-Am is
  • Am-L-Z-Ab is:
  • the Am-L-Z precursor is one of:
  • maleimide reacts with a thiol group found on a cysteine in the antibody.
  • the cytotoxin is an a-amanitin.
  • the a- amanitin is a compound of formula III.
  • the a-amanitin of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the a-amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an a-amanitin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB). In some
  • the cytotoxin is a b-amanitin.
  • the b - amanitin is a compound of formula III.
  • the b -amanitin of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the b -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an b -amanitin- linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB). In some
  • the cytotoxin is a g-amanitin.
  • the g-amanitin is a compound of formula III.
  • the g-amanitin of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the g -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an g -amanitin-linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
  • PAB para-aminobenzyl group
  • the cytotoxin is a e-amanitin.
  • the e -amanitin is a compound of formula III.
  • the e-amanitin of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the e -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an e -amanitin-linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
  • PAB para-aminobenzyl group
  • the cytotoxin is an amanin.
  • the amanin is a compound of formula III.
  • the amanin of formula III is attached to an anti- CD252 antibody via a linker L.
  • the linker L may be attached to the amanin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanin-linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 .
  • the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB).
  • PAB para-aminobenzyl group
  • the cytotoxin is an amaninamide.
  • the amaninamide is a compound of formula III.
  • the amaninamide of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the amaninamide of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amaninamide-linker conjugate of formula I, IA, IB, II, IIA, or I IB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 .
  • the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val- Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB).
  • PAB para-aminobenzyl group
  • the cytotoxin is an amanullin.
  • the amanullin is a compound of formula III.
  • the amanullin of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the amanullin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanullin-linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
  • PAB para-aminobenzyl group
  • the cytotoxin is an amanullinic acid.
  • the amanullinic acid is a compound of formula III.
  • the amanullinic acid of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the amanullinic acid of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanullinic acid -linker conjugate of formula I, IA, IB, II, IIA, or MB.
  • the linker is attached at position R 1 . In some embodiments, the linker is attached at position R 2 . In some embodiments, the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide.
  • the cytotoxin is a proamanullin.
  • the proamanullin is a compound of formula III.
  • the proamanullin of formula III is attached to an anti-CD252 antibody via a linker L.
  • the linker L may be attached to the
  • the linker is attached at position R 1 .
  • the linker is attached at position R 2 .
  • the linker is attached at position R 3 .
  • the linker is attached at position R 4 .
  • the linker is attached at position R 5 .
  • the linker is attached at position R 6 .
  • the linker is attached at position R 7 .
  • the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val- Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB). In some embodiments, the linker includes the moiety PAB-Cit-Val. In some embodiments, the linker includes the moiety PAB-Ala-Val.
  • PAB para-aminobenzyl group
  • Antibodies, or antigen-binding fragments, for use with the compositions and methods described herein can be conjugated to an amatoxin, such as a-amanitin or a variant thereof, for instance, by way of a linker moiety (L) (thus forming a conjugate (also referred to as an antibody drug conjugate (ADC)) using conjugation techniques known in the art or described herein.
  • L linker moiety
  • ADC antibody drug conjugate
  • antibodies, or antigen-binding fragments thereof, that recognize and bind CD252 can be conjugated to an amatoxin, such as a-amanitin or a variant thereof, as described in US
  • Exemplary antibody-drug conjugates useful in conjunction with the methods described herein may be formed by the reaction of an antibody, or antigen-binding fragment thereof, with an amatoxin that is conjugated to a linker containing a substituent suitable for reaction with a reactive residue on the antibody, or antigen-binding fragment thereof.
  • Amatoxins that are conjugated to a linker containing a substituent suitable for reaction with a reactive residue on the antibody, or antigen-binding fragment thereof, described herein include, without limitation, 7'C-(4-(6- (maleimido)hexanoyl)piperazin-1 -yl)-amatoxin; 7'C-(4-(6-(maleimido)hexanamido)piperidin-1 -yl)- amatoxin; 7'C-(4-(6-(6-(maleimido)hexanamido)hexanoyl)piperazin-1 -yl)-amatoxin; 7'C-(4-(4- ((maleimido)methyl)cyclohexanecarbonyl)piperazin-1 -yl)-amatoxin; 7'C-(4-(6-(4- ((maleimido)methyl)cyclohexanecarboxamido)hexanoy
  • cytotoxins that can be conjugated to antibodies, or antigen-binding fragments thereof, that recognize and bind CD252 for use in directly treating a GVHD or an autommine condition, include, without limitation, 5-ethynyluracil, abiraterone, acylfulvene, adecypenol, adozelesin, aldesleukin, altretamine, ambamustine, amidox, amifostine, aminolevulinic acid, amrubicin, amsacrine, anagrelide, anastrozole, andrographolide, angiogenesis inhibitors, antarelix, anti-dorsalizing morphogenetic protein-1 , antiandrogen, prostatic carcinoma, antiestrogen, antineoplaston, antisense oligonucleotides, aphidicolin glycinate, apoptosis gene modulators, apoptosis regulators, apurinic acid, asulacrine,
  • linkers can be used to conjugate antibodies, or antigen-binding fragments, or described herein (e.g., antibodies, or antigen-binding fragments thereof, that recognize and bind CD252 with a cytotoxic molecule.
  • Linker means a divalent chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches an antibody or fragment thereof (Ab) to a drug moiety (D) to form antibody-drug conjugates of the present disclosure (ADCs; Ab-Z-L-D, where D is a cytotoxin).
  • Suitable linkers have two reactive termini, one for conjugation to an antibody and the other for conjugation to a cytotoxin.
  • the antibody conjugation reactive terminus of the linker is typically a site that is capable of conjugation to the antibody through a cysteine thiol or lysine amine group on the antibody, and so is typically a thiol-reactive group such as a double bond (as in maleimide) or a leaving group such as a chloro, bromo, iodo, or an R- sulfanyl group, or an amine-reactive group such as a carboxyl group; while the antibody conjugation reactive terminus of the linker is typically a site that is capable of conjugation to the cytotoxin through formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, and so is typically a carboxyl or basic amine group.
  • linker When the term "linker” is used in describing the linker in conjugated form, one or both of the reactive termini will be absent (such as reactive moiety Z, having been converted to chemical moiety Z) or incomplete (such as being only the carbonyl of the carboxylic acid) because of the formation of the bonds between the linker and/or the cytotoxin, and between the linker and/or the antibody or antigen-binding fragment thereof.
  • conjugation reactions are described further herein below.
  • the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the drug unit from the antibody in the intracellular environment.
  • the linker unit is not cleavable and the drug is released, for example, by antibody degradation.
  • the linkers useful for the present ADCs are preferably stable extracellularly, prevent aggregation of ADC molecules and keep the ADC freely soluble in aqueous media and in a monomeric state. Before transport or delivery into a cell, the ADC is preferably stable and remains intact, i.e. the antibody remains linked to the drug moiety.
  • the linkers are stable outside the target cell and may be cleaved at some efficacious rate inside the cell.
  • An effective linker will:
  • Bivalent linker reagents which are useful to attach two or more functional or biologically active moieties, such as peptides, nucleic acids, drugs, toxins, antibodies, haptens, and reporter groups are known, and methods have been described their resulting conjugates (Hermanson, G. T. (1996) Bioconjugate Techniques;
  • Linkers include those that may be cleaved, for instance, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571 -582, 2012, the disclosure of which is incorporated herein by reference as it pertains to linkers suitable for covalent conjugation).
  • Linkers hydrolyzable under acidic conditions include, for example, hydrazones,
  • Linkers cleavable under reducing conditions include, for example, a disulfide.
  • a variety of disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl-alpha-methyl- alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT (See, e.g., Thorpe et al., 1987, Cancer Res.
  • linkers useful for the synthesis of drug-antibody conjugates conjugates include those that contain electrophiles, such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen-binding fragments, such as amine and thiol moieties.
  • linkers suitable for the synthesis of drug-antibody conjugates include, without limitation, succinimidyl 4-(N-maleimidomethyl)-cyclohexane-L-carboxylate
  • SMCC N- succinimidyl iodoacetate
  • SIA N- succinimidyl iodoacetate
  • MBS m-maleimidobenzoyl-A/- hydroxysuccinimidyl ester
  • sulfo-MBS succinimidyl iodoacetate
  • Additional linkers include the non- cleavable maleimidocaproyl linkers, which are particularly useful for the conjugation of
  • microtubule-disrupting agents such as auristatins
  • auristatins are described by Doronina et al., Bioconjugate Chem. 17:14-24, 2006, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
  • Additional linkers suitable for the synthesis of drug-antibody conjugates conjugates as described herein include those capable of releasing a cytotoxin by a 1 ,6- elimination process (a "self-immolative" group), such as p-aminobenzyl alcohol (PABC), p- aminobenzyl (PAB), 6-maleimidohexanoic acid, pH-sensitive carbonates, and other reagents described in Jain et al., Pharm. Res.
  • PABC p-aminobenzyl alcohol
  • PAB p- aminobenzyl
  • 6-maleimidohexanoic acid pH-sensitive carbonates
  • other reagents described in Jain
  • the linker includes a self-immolative group such as the afore-mentioned PAB or PABC (para-aminobenzyloxycarbonyl), which are disclosed in, for example, Carl et al., J. Med. Chem. (1981 ) 24:479-480; Chakravarty et al (1983)
  • Linkers susceptible to enzymatic hydrolysis can be, e.g., a peptide-containing linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
  • intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
  • the peptidyl linker is at least two amino acids long or at least three amino acids long.
  • Exemplary amino acid linkers include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide.
  • suitable peptides include those containing amino acids such as Valine, Alanine, Citrulline (Cit), Phenylalanine, Lysine, Leucine, and Glycine.
  • Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
  • Exemplary dipeptides include valine-citrulline (vc or val-cit) and alanine- phenylalanine (af or ala-phe).
  • Exemplary tripeptides include glycine-valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly-gly).
  • the linker includes a dipeptide such as Val-Cit, Ala-Val, or Phe-Lys, Val-Lys, Ala-Lys, Phe-Cit, Leu-Cit, lle-Cit, Phe-Arg, or Trp- Cit.
  • Linkers containing dipeptides such as Val-Cit or Phe-Lys are disclosed in, for example, U.S. Pat. No. 6,214,345, the disclosure of which is incorporated herein by reference in its entirety as it pertains to linkers suitable for covalent conjugation.
  • the linker includes a dipeptide selected from Val-Ala and Val-Cit.
  • a dipeptide is used in combination with a self-immolative linker.
  • Linkers suitable for use herein further may include one or more groups selected from C C 6 alkylene, C C 6 heteroalkylene, C 2 -C 6 alkenylene, C 2 -C 6 heteroalkenylene, C 2 -C 6 alkynylene, C 2 -C 6 heteroalkynylene, C 3 -C 6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, and combinations thereof, each of which may be optionally substituted.
  • PAB
  • the linker includes a p-aminobenzyl group (PAB).
  • PAB p-aminobenzyl group
  • the p-aminobenzyl group is disposed between the cytotoxic drug and a protease cleavage site in the linker.
  • the p-aminobenzyl group is part of a p- aminobenzyloxycarbonyl unit.
  • the p-aminobenzyl group is part of a p- aminobenzylamido unit.
  • the linker comprises PAB, Val-Cit-PAB, Val-Ala- PAB, Val-Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala-Ala- Asn-PAB, or Ala-PAB.
  • the linker comprises a combination of one or more of a peptide, oligosaccharide, -(CH 2 ) n -, -(CH 2 CH 2 0) n -, PAB, Val-Cit-PAB, Val-Ala-PAB, Val-Lys(Ac)-PAB, Phe- Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala-Ala-Asn-PAB, or Ala-PAB.
  • the linker comprises a -(CH 2 ) n - unit, wherein n is an integer from 2 to 6.
  • the linker of the ADC is N-beta-maleimidopropyl-Val-Ala-para- aminobenzyl (BMP-Val-Ala-PAB).
  • Linkers that can be used to conjugate an antibody, or antigen-binding fragment thereof, to a cytotoxic agent include those that are covalently bound to the cytotoxic agent on one end of the linker and, on the other end of the linker, contain a chemical moiety formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within the antibody, or antigen-binding fragment thereof, that binds CD252.
  • Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, that binds CD252 include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids.
  • haloaryl e.g., fluoroaryl
  • haloheteroaryl e.g., fluoroheteroaryl
  • haloalkyl e.g., fluoroheteroaryl
  • linkers useful for the synthesis of drug-antibody conjugates conjugates include those that contain electrophiles, such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen-binding fragments, such as amine and thiol moieties.
  • linkers suitable for the synthesis of drug-antibody conjugates include, without limitation, succinimidyl 4-(N-maleimidomethyl)-cyclohexane-L-carboxylate
  • SMCC N- succinimidyl iodoacetate
  • SIA N- succinimidyl iodoacetate
  • MBS m-maleimidobenzoyl-A/- hydroxysuccinimidyl ester
  • sulfo-MBS succinimidyl iodoacetate
  • Additional linkers include the non- cleavable maleimidocaproyl linkers, which are particularly useful for the conjugation of
  • microtubule-disrupting agents such as auristatins
  • auristatins are described by Doronina et al., Bioconjugate Chem. 17:14-24, 2006, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
  • Linkers useful in conjunction with the antibody-drug described herein include, without limitation, linkers containing chemical moieties formed by coupling reactions as depicted in Table 1 , below. Curved lines designate points of attachment to the antibody, or antigen-binding fragment, and the cytotoxic molecule, respectively.
  • antibody-drug conjugates useful in conjunction with the methods described herein may be formed by the reaction of an antibody, or antigen-binding fragment thereof, with a linker or cytotoxin-linker conjugate, as described herein, the linker or cytotoxin- linker conjugate including a reactive substituent Z, suitable for reaction with a reactive substituent on the antibody, or antigen-binding fragment thereof, to form the chemical moiety Z.
  • examples of suitably reactive substituents on the linker and antibody or antigen-binding fragment thereof include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ a,b -unsaturated carbonyl pair, and the like), a diene/dienophile pair (e.g., an azide/alkyne pair, or a diene/ a,b-unsaturated carbonyl pair, among others), and the like.
  • a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ a,b -unsaturated carbonyl pair, and the like
  • a diene/dienophile pair e.g., an azide/alkyne pair, or a diene/ a,
  • Coupling reactions between the reactive substitutents to form the chemical moiety Z include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine or hydroxylamine condensation, hydrazine formation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
  • the linker contains an electrophilic functional group for reaction with a nucleophilic functional group on the antibody, or antigen binding fragment thereof.
  • Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, as disclosed herein include, without limitation, nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
  • nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
  • Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, as disclosed herein include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids.
  • haloaryl e.g., fluoroaryl
  • haloheteroaryl e.g., fluoroheteroaryl
  • haloalkyl e.g., fluoroheteroaryl
  • the reactive substituents present within an antibody, or antigen binding fragment thereof as disclosed herein include, are amine or thiol moieties.
  • Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges.
  • Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
  • DTT dithiothreitol
  • Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
  • Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non native cysteine amino acid residues).
  • cysteine residues e.g., preparing mutant antibodies comprising one or more non native cysteine amino acid residues.
  • U.S. Pat. No. 7,521 ,541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
  • the reactive moiety Z attached to the linker is a nucleophilic group which is reactive with an electrophilic group present on an antibody.
  • Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups.
  • the heteroatom of a nucleophilic group can react with an electrophilic group on an antibody and form a covalent bond to the antibody.
  • Useful nucleophilic groups include, but are not limited to, hydrazide, oxime, amino, hydroxyl, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
  • Z is the product of a reaction between reactive nucleophilic substituents present within the antibodies, or antigen-binding fragments thereof, such as amine and thiol moieties, and a reactive electrophilic substituent Z.
  • Z may be a Michael acceptor (e.g., maleimide), activated ester, electron-deficient carbonyl compound, or an aldehyde, among others.
  • the ADC comprises an anti-CD252 antibody conjugated to an amatoxin of any of formulae I, IA, IB, II, I la, or MB as disclosed herein via a linker and a chemical moiety Z, wherein the linker includes a hydrazine, a disulfide, a thioether or a dipeptide.
  • the linker includes a dipeptide selected from Val-Ala and Val-Cit.
  • the linker includes a para-aminobenzyl group (PAB).
  • PAB para-aminobenzyl group
  • the linker includes the moiety PAB-Cit-Val.
  • the linker includes the moiety PAB- Ala-Val.
  • the linker includes a -(CH 2 ) n — unit, where n is an integer from 2-6.
  • the chemical moiety Z is selected from Table 1. In some embodiments, the chemical moiety Z is selected from Table 1.
  • S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD252 (e.g., from the -SH group of a cysteine residue).
  • linker L and the chemical moiety Z, taken together as L-Z is
  • linker- reactive substituent group structure prior to conjugation with the antibody or antigen binding fragment thereof, includes a maleimide as the group Z.
  • group Z includes a maleimide as the group Z.
  • linker moieties and amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2015/0218220 and Patent Application Publication No. WO2017/149077, the disclosure of each of which is incorporated herein by reference in its entirety.
  • the linker-reactive substituent group structure prior to conjugation with the antibody or antigen binding fragment thereof, is:
  • an antibody or antigen binding fragment thereof is conjugated to one or more cytotoxic drug moieties (D), e.g. about 1 to about 20 drug moieties per antibody, through a linker L and a chemical moiety Z as disclosed herein.
  • D cytotoxic drug moieties
  • the ADCs of the present disclosure may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1 ) reaction of a reactive substituent of an antibody or antigen binding fragment thereof with a bivalent linker reagent to form Ab-Z-L as described herein above, followed by reaction with a drug moiety D; or (2) reaction of a reactive substituent of a drug moiety with a bivalent linker reagent to form D- L-Z, followed by reaction with a reactive substituent of an antibody or antigen binding fragment thereof as described herein above to form an ADC of formula D-L-Z-Ab, such as Am-Z-L-Ab. Additional methods for preparing ADC are described herein.
  • the antibody or antigen binding fragment thereof has one or more lysine residues that can be chemically modified to introduce one or more sulfhydryl groups.
  • the ADC is then formed by conjugation through the sulfhydryl group's sulfur atom as described herein above.
  • the reagents that can be used to modify lysine include, but are not limited to, N-succinimidyl S- acetylthioacetate (SATA) and 2-lminothiolane hydrochloride (Traut's Reagent).
  • the antibody or antigen binding fragment thereof can have one or more carbohydrate groups that can be chemically modified to have one or more sulfhydryl groups.
  • the ADC is then formed by conjugation through the sulfhydryl group's sulfur atom as described herein above.
  • the antibody can have one or more carbohydrate groups that can be oxidized to provide an aldehyde (-CHO) group (see, for e.g., Laguzza, et al., J. Med. Chem. 1989, 32(3), 548-55).
  • the ADC is then formed by conjugation through the corresponding aldehyde as described herein above.
  • Other protocols for the modification of proteins for the attachment or association of cytotoxins are described in Coligan et al., Current Protocols in Protein Science, vol. 2, John Wiley & Sons (2002), incorporated herein by reference.
  • linker-drug moieties to cell-targeted proteins such as antibodies, immunoglobulins or fragments thereof are found, for example, in U.S. Pat. No.
  • a fusion protein comprising the antibody and cytotoxic agent may be made, e.g., by recombinant techniques or peptide synthesis.
  • the length of DNA may comprise respective regions encoding the two portions of the conjugate either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the conjugate.
  • compositions and methods described herein may be used to deplete antigen presenting cells that are associated with graft failure in order to achieve transplant tolerance.
  • the compositions and methods described herein are particularly useful for preventing and treating GVHD.
  • the methods and compositions disclosed herein are also useful in reducing the risk of transplant failure in a human patient receiving an allogenic transplant.
  • the preferred subject is human.
  • the amount of antibody, antibody-drug conjugate, or ADC administered should be sufficient to deplete cells, e.g., antigen presenting cells, which promote GVHD.
  • an effective human dose will be in the range of 0.1 -150 mg/kg (e.g., about 5 mg/kg, about 10 mg/kg, about 25 mg/kg, about 50 mg/kg, about 75 mg/kg, about 100 mg/kg, about 150 mg/kg etc.).
  • the route of administration may affect the recommended dose. Repeated systemic doses are contemplated in order to maintain an effective level, e.g., to attenuate or inhibit GVHD, depending on the mode of administration adopted.
  • the antibody, antibody-drug conjugate, or ADC can be administered to the human patient in need prior to, concomitantly with, or after transplantation of cells or a solid organ to the patient.
  • an anti-CD252 ADC is administered to the human patient in need thereof prior to (e.g., about 5 days before, about 1 days before, about 3 days before, about 2 days before, about 1 day before, about 12 hours before) transplantation of cells or a solid organ.
  • an anti-CD252 ADC is administered to the human patient in need thereof after (e.g., about 1 day after, about 2 days after, about 3 days after, about 4 days after, about 5 days after, about 6 days after, about 7 days after, about 8 days after, about 9 days after, or about 10 days after) transplantation of cells or a solid organ.
  • a single dose of an anti-CD252 ADC may be administered to the human patient either prior to, concomitantly with, or after transplantation of cells or an organ, where such single dose is sufficient to treat or prevent GVHD or graft failure.
  • Anti-CD252 ADCs may be used as an alternative to traditional agents (e.g., chemotherapy and/or radiation) used to promote acceptance of a transplant, including an allogeneic transplant.
  • Traditional agents generally reduce a patient’s immune response in order to promote engraftment and acceptance of the transplanted cells or organ.
  • the methods and compositions described herein provide a more selective therapy that allows much of the patient’s immune system to remain intact, while targeting and depleting CD252 expressing activated T cells.
  • anti-CD252 ADCs disclosed herein to selectively deplete antigen presenting cells provides an advantageous therapy over traditional therapy in the context of transplantation given that, in particular, allo-activated immune cells can be targeted and depleted in order to achieve successful transplantation of cells or a solid organ.
  • graft failure or graft rejection including failure after allogeneic hematopoietic stem cell transplantation, may be manifested generally as either lack of initial engraftment of donor cells, or loss of donor cells after initial engraftment (for review see Mattsson et al. (2008) Biol Blood Marrow Transplant. 14(Suppl 1 ): 165-170).
  • compositions and methods disclosed herein may be used to deplete CD252 expressing antigen presenting cells in a graft or transplantation scenario where graft failure is of concern, e.g., where the human patient is at risk of developing graft failure following transplantation of a solid organ or cells, particularly where the transplanted cells or organ is allogeneic.
  • the anti-CD252 antibody, antibody-drug conjugate, or ADC is used to deplete CD252 expressing donor cells by contacting the cells, graft or solid organ with the anti- CD252 antibody, antibody-drug conjugate, or ADC prior to transplantation of the cells, graft or organ to a human patient.
  • the cells, graft or organ are allogeneic.
  • the risk of GVHD remains high following transplantation with current therapies.
  • the methods and compositions disclosed herein may be used to inhibit graft versus host disease (GVHD) in a human patient.
  • the anti-CD252 antibodies or ADCs may be used to selectively target antigen presenting cells (APCs) in a patient who will be receiving a transplant, such as a stem cell transplant.
  • APCs antigen presenting cells
  • Anti-CD252 antibodies or ADCs, as described herein may also be used to reduce the risk of GVHD by targeting and depleting CD252 positive cells in a human patient who is going to be or has already received a transplant, such as but not limited to, an HSC transplant.
  • the compositions and methods disclosed herein are for treating GvHD prior to appearance of symptoms of GVHD in a patient following a transplantation therapy, e.g., allogeneic HSCs.
  • the methods described herein are also useful for preventing host versus graft (HvG) reactions.
  • An anti-CD252 antibody or ADC can also be used as an immunosuppressant to prevent host versus graft (HvG) reactions thereby preventing or reducing the risk of allogeneic graft failure.
  • Use of an anti-CD252 ADC in a patient at risk for a HvG reaction would enable engraftment of donor cells with a greater degree of HLA-mismatch. Additional uses include tolerance induction in solid organ transplant, where host versus graft reactions are prevented or dampened by the CD252-ADC. These would include solid organ transplants done with or without hematopoietic stem cell transplants, including xeno-transplants where the organ is non-human in origin and/or genetically modified.
  • an anti-CD252 antibody or ADC is used to prevent graft versus graft (GvG) in the context of allogeneic transplants where two donors are used. Examples include the use of 2 cord blood stem cell donors in adults and pediatric patients. Prevention of GvG would enable more rapid hematopoietic (e.g. neutrophil and platelet) reconstitution post-transplant as both stem cell sources would successfully engraft.
  • the transplant is allogeneic. In some embodiments, the transplant is autologous.
  • the transplant is a bone marrow transplant, a peripheral blood transplant, or a cord blood transplant.
  • the transplant includes hematopoietic cells (e.g., hematopoietic stem cells).
  • hematopoietic cells e.g., hematopoietic stem cells.
  • the transplant maybe any solid organ or skin transplant.
  • the transplant is selected from the group consisting of kidney transplant, heart transplant, liver transplant, pancreas transplant, lung transplant, intestine transplant and skin transplant.
  • the anti-CD252 antibody, antigen-binding fragment thereof, or ADC can be administered to the patient in an aqueous solution containing one or more pharmaceutically acceptable excipients, such as a viscosity-modifying agent.
  • the aqueous solution may be sterilized using techniques described herein or known in the art.
  • the antibody, antigen-binding fragment thereof, or drug-antibody conjugate can be administered to the patient at a dosage of, for example, from 0.001 mg/kg to 100 mg/kg prior to administration of a hematopoietic stem cell graft to the patient.
  • the antibody, antigen-binding fragment thereof, or ADC can be administered to the patient at a time that optimally promotes engraftment of the exogenous hematopoietic stem cells, for instance, from about 1 hour to about 7 days (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 1 1 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, or about 7 days) or more prior to the administration of the exogenous hematopoietic stem cell transplant.
  • about 1 hour to about 7 days e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about
  • the antibody, antigen-binding fragment thereof, or ADC may be administered about 3 days prior to transplant.
  • the antibody, antigen-binding fragment thereof, or ADC can be administered to the patient at a time that optimally promotes engraftment of the exogenous hematopoietic stem cells, for instance, concurrent with the administration of the exogenous hematopoietic stem cell transplant.
  • the antibody, antigen-binding fragment thereof, or ADC can be administered to the patient at a time that optimally promotes engraftment of the exogenous hematopoietic stem cells, for instance, from about 1 hour to about 10 days (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 1 1 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, or about 10 days) or more after the administration of the exogenous hematopoietic stem cell transplant.
  • about 1 hour to about 10 days e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5
  • the antibody, antigen-binding fragment thereof, or ADC may be administered about 1 to about 2 days after the transplant. In another embodiment, the antibody, antigen-binding fragment thereof, or ADC may be administered about 2 to about 3 days after the transplant. In another embodiment, the antibody, antigen-binding fragment thereof, or ADC may be administered about 3 to about 4 days after the transplant. In another embodiment, the antibody, antigen-binding fragment thereof, or ADC may be administered about 4 to about 5 days after the transplant. In another embodiment, the antibody, antigen-binding fragment thereof, or ADC may be administered about 5 to about 6 days after the transplant. In another embodiment, the antibody, antigen-binding fragment thereof, or ADC may be administered about 7 to about 8 days after the transplant.
  • the antibody, antigen-binding fragment thereof, or ADC may be administered about 8 to about 9 days after the transplant. In another embodiment, the antibody, antigen-binding fragment thereof, or ADC may be administered about 9 to about 10 days after the transplant.
  • the amount of antibody, antigen-binding fragment thereof, or ADC can be quantified, by methods known in the art, in the plasma of patients to determine when the concentration of antibody, antigen-binding fragment thereof, or ADC has reached its maximum.
  • the patient may then receive an infusion (e.g., an intravenous infusion) of exogenous hematopoietic stem cells, such as from the same physician that administered the antibody or antigen-binding fragment thereof or drug-antibody conjugate or from a different physician.
  • the physician may administer the patient an infusion of autologous, syngeneic, or allogeneic hematopoietic stem cells, for instance, at a dosage of from 1 x 10 3 to 1 x 10 9 CD34 + cells/kg.
  • the physician may monitor the engraftment of the hematopoietic stem cell transplant, for example, by withdrawing a blood sample from the patient and determining the increase in concentration of hematopoietic stem cells or cells of the hematopoietic lineage (such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen-presenting cells, macrophages, dendritic cells, natural killer cells, T cells, and B cells) following administration of the transplant.
  • This analysis may be conducted, for example, from 1 hour to 6 months, or more, following
  • hematopoietic stem cell transplant therapy e.g., about 1 hour, about 2 hours, about hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 1 1 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 2 weeks, about 3 weeks, about 4 weeks, about 5 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 9 weeks, about 10 weeks, about 1 1 weeks, about 12 weeks, about 13 weeks, about 14 weeks, about 15 weeks, about 16 weeks, about 17 weeks, about 18 weeks, about 19 weeks, about 20 weeks, about 21 weeks, about 22 weeks, about 23 weeks, about 24 weeks, or more).
  • a finding that the concentration of hematopoietic stem cells or cells of the hematopoietic lineage has increased (e.g., by about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 100%, about 200%, about 500%, or more) following the transplant therapy relative to the concentration of the corresponding cell type prior to transplant therapy provides one indication that treatment with the anti-CD252 antibody, antigen-binding fragment thereof, or ADC has successfully promoted engraftment of the transplanted hematopoietic stem cell graft.
  • the methods described herein are also useful for the treatment of an autoimmune disease.
  • the methods and compositions disclosed herein can be used to treat an autoimmune disease, such as, but not limited to, psoriasis, inflammatory bowel disease (Crohn's disease, ulcerative colitis), psoriatic arthritis, multiple sclerosis, rheumatoid arthritis, or ankylosing spondylitis.
  • the autoimmune disease that may be treated using the methods disclosed herein further include, for example, scleroderma, multiple sclerosis (MS), human systemic lupus (SLE), rheumatoid arthritis (RA), inflammatory bowel disease (IBD), treating psoriasis, Type 1 diabetes mellitus (Type 1 diabetes), acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicasclerosis (
  • a physician of skill in the art can evaluate the clinical manifestations of GVHD after administering to the human patient an antibody, antigen-binding fragment thereof, or ADC capable of binding CD252, such as an anti-CD252 antibody described herein.
  • ADCs, antibodies, or antigen-binding fragments thereof, or described herein can be administered to a patient in a variety of dosage forms.
  • antibodies, or antigen-binding fragments thereof, described herein can be administered to a patient for treating (or inhibiting) GVFID in the form of an aqueous solution, such as an aqueous solution containing one or more pharmaceutically acceptable excipients.
  • Pharmaceutically acceptable excipients for use with the compositions and methods described herein include viscosity-modifying agents.
  • the aqueous solution may be sterilized using techniques known in the art.
  • compositions comprising anti-CD252 ADCs or antibodies as described herein are prepared by mixing such ADC or anti-CD252 antibody with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as
  • octadecyldimethylbenzyl ammonium chloride hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or
  • immunoglobulins include hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • the ADCs, antibodies, or antigen-binding fragments, described herein may be administered by a variety of routes, such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intraocularly, or parenterally.
  • routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intraocularly, or parenterally.
  • the most suitable route for administration in any given case will depend on the particular antibody, or antigen-binding fragment, administered, the patient, pharmaceutical formulation methods, administration methods (e.g., administration time and administration route), the patient's age, body weight, sex, severity of the diseases being treated, the patient’s diet, and the patient’s excretion rate.
  • the effective dose of an ADC, antibody, or antigen-binding fragment thereof, described herein can range, for example from about 0.001 to about 100 mg/kg of body weight per single (e.g., bolus) administration, multiple administrations, or continuous administration, or to achieve an optimal serum concentration (e.g., a serum concentration of 0.0001 -5000 pg/mL) of the antibody, antigen-binding fragment thereof.
  • the dose may be administered one or more times (e.g., 2-10 times) per day, week, or month to a subject (e.g., a human) suffering from cancer, an autoimmune disease, or undergoing conditioning therapy in preparation for receipt of a hematopoietic stem cell transplant. In the case of a conditioning procedure prior to hematopoietic stem cell
  • the ADC, antibody, or antigen-binding fragment thereof can be administered to the patient at a time that optimally promotes engraftment of the exogenous hematopoietic stem cells, for instance, from 1 hour to 1 week (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 1 1 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, or about 7 days), from 1 hour to 2 hours, from 1 hour to 3 hours, from 1 hour to 4 hours, from 1 hour to 5 hours, from 1 hour to 6 hours, from 1 hour to 7 hours, from 1 hour to 8 hours, from 1 hour to 9 hours, from 1 hour to 10 hours, from 1
  • An anti-CD252 antibody was identified having the below heavy and light chain variable sequences.
  • VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPNLLIYAASSLQ
  • This antibody was used in a mixed lymphocyte reaction assay. As decribed in Figurel , an anti- CD252 antibody having the above sequences was effective at inhibiting activated T cells.
  • FIG. 1 and 2 The data provided in Figures 1 and 2 was obtained using a mixed lymphocyte reaction. Briefly, dendritic cells derived from CD14+ monocytes were plated at 5e3 per well in a flat bottom 384-well plate. T cells were stained with CFSE and plated on top of dendritic cells at 5e4 cells per well. Antibodies were titrated (1 urn down to 0.01 nM) on top of the cells and added at the time of plating. Four days later, wells were stained with anti-CD3 and run on a flow cytometer. Percent activated T cells was determined by gating on CD3+ cells that had undergone one or more division based on FSC and CFSE brightness. Number of non-activated T cells was determined by the number of events in the CFSE bright population using volumetric flow cytometry. Controls included an anti-CD45-Amanitin conjugate capable of killing the T cells in culture as well as the relevant isotype controls.
  • Figure 1 shows that the above anti-OX40L (CD252) antibody inhibited T cell activation when compared to isotype controls.
  • Figure 2A shows that multiple different clones of anti-CD252 antibodies are capable of blocking T cell activation.
  • Figure 2B shows that this is a blockage specific to activated T cells as non-activated T cells are unaltered in the anti-CD252 treated samples, but are depleted in the anti- CD45-Amanitin samples as this conjugate kills all T cells.
  • the antibodies shown in Figures 2A and 2B include 1 1 C3.1 (Biolegend, Catalog

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biotechnology (AREA)
  • Virology (AREA)
  • Zoology (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Transplantation (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2019/021464 2018-03-08 2019-03-08 Anti-cd252 antibodies, conjugates, and methods of use Ceased WO2019173780A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN201980031308.3A CN112154152A (zh) 2018-03-08 2019-03-08 抗cd252抗体、缀合物和使用方法
EP19763628.5A EP3762400A4 (en) 2018-03-08 2019-03-08 ANTI-CD252 ANTIBODIES, CONJUGATES AND METHODS OF USE
JP2020547005A JP2021517133A (ja) 2018-03-08 2019-03-08 抗cd252抗体、コンジュゲート、および使用方法
US17/013,172 US20210095039A1 (en) 2018-03-08 2020-09-04 Anti-cd252 antibodies, conjugates, and methods of use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862640543P 2018-03-08 2018-03-08
US62/640,543 2018-03-08

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/013,172 Continuation US20210095039A1 (en) 2018-03-08 2020-09-04 Anti-cd252 antibodies, conjugates, and methods of use

Publications (2)

Publication Number Publication Date
WO2019173780A2 true WO2019173780A2 (en) 2019-09-12
WO2019173780A3 WO2019173780A3 (en) 2019-10-17

Family

ID=67846867

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/021464 Ceased WO2019173780A2 (en) 2018-03-08 2019-03-08 Anti-cd252 antibodies, conjugates, and methods of use

Country Status (5)

Country Link
US (1) US20210095039A1 (https=)
EP (1) EP3762400A4 (https=)
JP (1) JP2021517133A (https=)
CN (1) CN112154152A (https=)
WO (1) WO2019173780A2 (https=)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025149667A1 (en) 2024-01-12 2025-07-17 Pheon Therapeutics Ltd Antibody drug conjugates and uses thereof

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2004213053C1 (en) * 2003-02-20 2009-07-16 Seagen Inc. Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders
US8614295B2 (en) * 2009-02-17 2013-12-24 Ucb Pharma S.A. Antibody molecules having specificity for human OX40
GB201403775D0 (en) * 2014-03-04 2014-04-16 Kymab Ltd Antibodies, uses & methods
CN105377304B (zh) * 2014-03-10 2018-05-15 海德堡医药有限责任公司 鹅膏毒肽衍生物
MX2017011194A (es) * 2015-03-03 2018-04-10 Kymab Ltd Anticuerpos, usos y métodos.
US9512229B2 (en) * 2015-03-03 2016-12-06 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GVHD

Also Published As

Publication number Publication date
US20210095039A1 (en) 2021-04-01
JP2021517133A (ja) 2021-07-15
CN112154152A (zh) 2020-12-29
EP3762400A2 (en) 2021-01-13
WO2019173780A3 (en) 2019-10-17
EP3762400A4 (en) 2022-03-16

Similar Documents

Publication Publication Date Title
JP7791923B2 (ja) Cd5+細胞の枯渇のための組成物および方法
US11572411B2 (en) Anti-CD117 antibodies and conjugates
JP7641452B2 (ja) Cd117+細胞を減少させるための組成物及び方法
US20200289664A1 (en) Compositions and methods for the depletion of cd137+ cells
AU2019366960A1 (en) Fc silenced antibody drug conjugates (ADCs) and uses thereof
US20200368363A1 (en) Compositions and methods for the depletion of cd2+ cells
US20220249683A1 (en) T-cell depleting therapies
US20210095039A1 (en) Anti-cd252 antibodies, conjugates, and methods of use
US20210101990A1 (en) Compositions and methods for the depletion of cd134+ cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19763628

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2020547005

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019763628

Country of ref document: EP

Effective date: 20201008

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19763628

Country of ref document: EP

Kind code of ref document: A2