WO2019090110A1 - Compositions and methods for treating cancer with anti-ror1 immunotherapy - Google Patents
Compositions and methods for treating cancer with anti-ror1 immunotherapy Download PDFInfo
- Publication number
- WO2019090110A1 WO2019090110A1 PCT/US2018/059003 US2018059003W WO2019090110A1 WO 2019090110 A1 WO2019090110 A1 WO 2019090110A1 US 2018059003 W US2018059003 W US 2018059003W WO 2019090110 A1 WO2019090110 A1 WO 2019090110A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- car
- domain
- cell
- antigen binding
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus human T-cell leukaemia-lymphoma virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70514—CD4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70525—ICAM molecules, e.g. CD50, CD54, CD102
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70535—Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70589—CD45
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- This application relates to the field of cancer, particularly to ROR1 antigen binding domains and chimeric antigen receptors (CARs) containing such ROR1 antigen binding domains and methods of use thereof.
- CARs chimeric antigen receptors
- Cancer is one of the most deadly threats to human health. In the U.S. alone, cancer affects nearly 1.3 million new patients each year, and is the second leading cause of death after cardiovascular disease, accounting for approximately 1 in 4 deaths. Solid tumors are responsible for most of those deaths. Although there have been significant advances in the medical treatment of certain cancers, the overall 5-year survival rate for all cancers has improved only by about 10% in the past 20 years. Cancers, or malignant tumors, metastasize and grow rapidly in an uncontrolled manner, making treatment extremely difficult.
- RORl receptor tyrosine kinase-like orphan receptor 1
- CLL CLL
- carcinoma of the breast glioblastoma
- lung adenocarcinoma and sarcomas Ewing sarcoma, osteosarcoma, rhabdomyosarcoma, and fibrosarcoma
- RORl receptor tyrosine kinase-like orphan receptor 1
- RORl has three splice variants, including a 104 kDa (up to 120 kDa depending on glycosylation) transmembrane glycoprotein comprised of 937 amino acids (1 -29 signal peptide), and 2 smaller variants of intracellular and secreted forms (GeneBank NP_005003, Masiakowski, P., and Carroll, R.D., 1992, A Novel Family of Cell Surface Receptors with Tyrosine Kinase-like Domain, J Biol Chem 36: 26181-26190.).
- RORl The presence of RORl on the surface of transformed cells indicates that targeting RORl will enable novel cancer treatments to be developed for a range of liquid cancer such as chronic lymphocytic leukemia (CLL) and other solid tumors (Borcherding, N., Kusner, D. et al., 2014, RORl, an embryonic protein with an emerging role in cancer biology. Protein & Cell, 5 :496-502).
- CLL chronic lymphocytic leukemia
- RORl receptor contains a cytosolic protein kinase domain, which, according to some reports, participates in Wnt and EGFR signaling (Borcherding, N., Kusner, D. et al., 2014, RORl, an embryonic protein with an emerging role in cancer biology.
- RORl can induce epithelial to mesenchymal transition (EMT), and promote tumor proliferation, aggressiveness, and metastases formation, and mediate resistance to apoptosis (Yamaguchi, Tomoya, et al., 2012, "NKX2-1/TITF1/TTF-1 -Induced RORl is required to sustain EGFR survival signaling in lung adenocarcinoma.” Cancer cell 21.3: 348-361 ; Borcherding, N., Kusner, D. et al., 2014, RORl, an embryonic protein with an emerging role in cancer biology. Protein & Cell, 5 :496-502). Its role in contributing to tumor phenotype indicates that it may serve an important function in tumor initiation or progression and therefore is a driver protein.
- EMT epithelial to mesenchymal transition
- the B-cell tumor-associated antigen ROR1 can be targeted with T cells modified to express a ROR1 -specific chimeric antigen receptor. Blood 116:4532-41.).
- MAbs, 4:3, 349-361. The present standard of care for B-lineage leukemias may consists of remission induction treatment by high dose of chemotherapy or radiation, followed by consolidation, and may feature stem cell transplantation and additional courses of chemotherapy as needed (see the world wide web at cancer.gov). High toxicity associated with these treatments, as well as the risk of complications, such as relapse, secondary malignancy, or GVHD, motivate the search for better therapeutic alternatives.
- Chimeric Antigen Receptors are hybrid molecules comprising three essential units: (1) an extracellular antigen-binding motif, (2) linking/transmembrane motifs, and (3) intracellular T-cell signaling motifs (Long AH, Haso WM, Orentas RJ. Lessons leamed from a highly-active CD22-specific chimeric antigen receptor, Oncolmmunology. 2013; 2 (4):e23621).
- the antigen-binding motif of a CAR is commonly fashioned after a single chain Fragment variable (ScFv), the minimal binding domain of an immunoglobulin (Ig) molecule.
- Alternate antigen-binding motifs such as receptor ligands (i.e., IL-13 has been engineered to bind tumor expressed IL-13 receptor), intact immune receptors, library-derived peptides, and innate immune system effector molecules (such as NKG2D) also have been engineered.
- Alternate cell targets for CAR expression such as NK or gamma-delta T cells are also under development (Brown CE et al Clin Cancer Res. 2012;18(8):2199-209; Lehner M et al. PLoS One. 2012; 7 (2):e31210).
- the linking motifs of a CAR can be a relatively stable structural domain, such as the constant domain of IgG, or designed to be an extended flexible linker.
- Structural motifs such as those derived from IgG constant domains, can be used to extend the ScFv binding domain away from the T-cell plasma membrane surface. This may be important for some tumor targets where the binding domain is particularly close to the tumor cell surface membrane (such as for the disialoganglioside GD2; Orentas et al., unpublished observations).
- the signaling motifs used in CARs always include the CD3 ⁇ chain because this core motif is the key signal for T cell activation.
- the first reported second-generation CARs featured CD28 signaling domains and the CD28 transmembrane sequence.
- This motif was used in third-generation CARs containing CD137 (4-1BB) signaling motifs as well (Zhao Y et al J Immunol. 2009; 183 (9): 5563-74). With the advent of new technology, the activation of T cells with beads linked to anti-CD3 and anti- CD28 antibody, and the presence of the canonical "signal 2" from CD28 was no longer required to be encoded by the CAR itself.
- third-generation vectors were found to be not superior to second-generation vectors in in vitro assays, and they provided no clear benefit over second-generation vectors in mouse models of leukemia (Haso W, Lee DW, Shah NN, Stetler-Stevenson M, Yuan CM, Pastan IH, Dimitrov DS, Morgan RA, FitzGerald DJ, Barrett DM, Wayne AS, Mackall CL, Orentas RJ.
- CD 19-specific CARs that are in a second generation CD28/CD3 ⁇ (Lee DW et al. American Society of Hematology Annual Meeting. New Orleans, LA; December 7-10, 2013) and CD137/CD3 ⁇ signaling formats (Porter DL et al. N Engl J Med. 2011 ; 365 (8): 725-33).
- CD137 other tumor necrosis factor receptor superfamily members such as OX40 also are able to provide important persistence signals in CAR-transduced T cells (Yvon E et al. Clin Cancer Res. 2009;15(18):5852-60).
- CD3 ⁇ and CD28 signal units are split between two different CAR constructs expressed in the same cell; in another, two CARs are expressed in the same T cell, but one has a lower affinity and thus requires the alternate CAR to be engaged first for full activity of the second (Lanitis E et al. Cancer Immunol Res.
- a second challenge for the generation of a single ScFv-based CAR as an immunotherapeutic agent is tumor cell heterogeneity.
- At least one group has developed a CAR strategy for glioblastoma whereby the effector cell population targets multiple antigens (HER2, IL-13Ra, EphA2) at the same time in the hope of avoiding the outgrowth of target antigen-negative populations.
- HER2, IL-13Ra, EphA2 multiple antigens
- T-cell-based immunotherapy has become a new frontier in synthetic biology; multiple promoters and gene products are envisioned to steer these highly potent cells to the tumor microenvironment, where T cells can both evade negative regulatory signals and mediate effective tumor killing.
- the elimination of unwanted T cells through the drug-induced dimerization of inducible caspase 9 constructs with chemical-based dimerizers, such as AP1903, demonstrates one way in which a powerful switch that can control T-cell populations can be initiated pharmacologically (Di Stasi A et al. N Engl J Med. 2011 ;365(18): 1673-83).
- effector T-cell populations that are immune to the negative regulatory effects of transforming growth factor- ⁇ by the expression of a decoy receptor further demonstrates the degree to which effector T cells can be engineered for optimal antitumor activity (Foster AE et al. J Immunother. 2008;31(5):500-5).
- CARs can trigger T-cell activation in a manner similar to an endogenous T-cell receptor, a major impediment to the clinical application of this technology to date has been limited in vivo expansion of CAR+ T cells, rapid disappearance of the cells after infusion, and disappointing clinical activity. This may be due in part to the murine origin of some of the CAR sequences employed.
- the present invention addresses these needs by providing CAR compositions and therapeutic methods that can be used to treat cancers and other diseases and/or conditions.
- the present invention as disclosed and described herein provides CARs that may be used for the treatment of diseases, disorders or conditions associated with dysregulated expression of ROR1 and which CARs contain ROR1 antigen binding domains that exhibit a high surface expression on transduced T cells, exhibit a high degree of cytolysis of ROR1 -expressing cells, and in which the transduced T cells demonstrate in vivo expansion and persistence.
- Novel anti-RORl antibodies or antigen binding domains thereof and chimeric antigen receptors (CARs) that contain such ROR1 antigen binding domains are provided herein, as well as host cells (e.g., T cells) expressing the receptors, and nucleic acid molecules encoding the receptors.
- the CARs exhibit a high surface expression on transduced T cells, with a high degree of cytolysis, and with transduced T cell expansion and persistence in vivo.
- Methods of using the disclosed CARs, host cells, and nucleic acid molecules are also provided, for example, to treat a cancer in a subject.
- an isolated polynucleotide encoding a human anti-RORl antibody or a fragment thereof comprising a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 1 and 7.
- an isolated polynucleotide encoding a fully human anti-RORl antibody or a fragment thereof is provided, wherein the antibody or a fragment thereof comprises a fragment selected from the group consisting of an Fab fragment, an F(ab')2 fragment, an Fv fragment, and a single chain Fv (ScFv).
- an isolated polynucleotide encoding a fully human anti-RORl antibody or a fragment thereof is provided, wherein the antibody or a fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 and 8.
- an isolated nucleic acid molecule encoding a chimeric antigen receptor comprising, from N-terminus to C-terminus, at least one RORl antigen binding domain encoded by a nucleotide sequence comprising a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 1 and 7, at least one transmembrane domain, and at least one intracellular signaling domain.
- CAR chimeric antigen receptor
- an isolated nucleic acid molecule encoding the CAR wherein the encoded extracellular RORl antigen binding domain comprises at least one single chain variable fragment of an antibody that binds to RORl .
- an isolated nucleic acid molecule encoding the CAR wherein the encoded extracellular RORl antigen binding domain comprises at least one heavy chain variable region of an antibody that binds to RORl .
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded CAR extracellular RORl antigen binding domain further comprises at least one lipocalin-based antigen binding antigen (anticalins) that binds to RORl .
- the encoded CAR extracellular RORl antigen binding domain further comprises at least one lipocalin-based antigen binding antigen (anticalins) that binds to RORl .
- an isolated nucleic acid molecule wherein the encoded extracellular RORl antigen binding domain is connected to the transmembrane domain by a linker domain.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded RORl extracellular antigen binding domain is preceded by a sequence encoding a leader or signal peptide.
- an isolated nucleic acid molecule encoding the CAR comprising at least one RORl antigen binding domain encoded by a nucleotide sequence comprising a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 1 and 7, and wherein the CAR additionally encodes an extracellular antigen binding domain targets an antigen that includes, but is not limited to, CD19, CD20, CD22, mesothelin, CD33, CD38, CD123 (IL3RA), CD138, BCMA (CD269), GPC2, GPC3, FGFR4, c-Met, PSMA, Glycolipid F77, EGFRvIII, GD-2, TSLPR, NY-ESO-1 TCR, MAGE A3 TCR, or any combination thereof.
- an isolated nucleic acid molecule encoding the CAR wherein the additionally encoded extracellular antigen binding domain comprises an anti-CD 19 ScFv antigen binding domain, an anti-CD20 ScFv antigen binding domain, an anti-CD22 ScFv antigen binding domain, an anti-mesothelin ScFv antigen binding domain, an anti-CD33 ScFv antigen binding domain, an anti-CD38 ScFv antigen binding domain, an anti-CD123 (IL3RA) ScFv antigen binding domain, an anti-CD138 ScFv antigen binding domain, an anti-BCMA (CD269) ScFv antigen binding domain, an anti-GPC2 ScFv antigen binding domain, an anti- GPC3 ScFv antigen binding domain, an anti-FGFR4 ScFv antigen binding domain, an anti- TSLPR ScFv antigen binding domain an anti-c-Met ScFv antigen binding domain, an anti-PMSA ScFv antigen binding domain, an anti-glycolipid F77 Sc
- the CARs provided herein further comprise a linker or spacer domain.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the extracellular RORl antigen binding domain, the intracellular signaling domain, or both are connected to the transmembrane domain by a linker (L), hinge (H), or spacer domain.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded linker domain is derived from the extracellular domain of CD8 or CD28, and is linked to a transmembrane domain.
- an isolated nucleic acid molecule encoding the CAR wherein the encoded CAR further comprises a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD83, CD86, CD134, CD137 and CD154, or a combination thereof.
- a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD83, CD86, CD134, CD137 and CD154, or a combination thereof.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded intracellular signaling domain further comprises a CD3 zeta intracellular domain.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded intracellular signaling domain is arranged on the N-terminal side relative to the CD3 zeta intracellular domain.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded at least one intracellular signaling domain comprises a costimulatory domain, a primary signaling domain, or a combination thereof.
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded at least one costimulatory domain comprises a functional signaling domain of OX40, CD70, CD27, CD28, CD5, ICAM-1 , LFA-1 (CDl l a/CD18), ICOS (CD278), DAP10, DAP 12, and 4- IBB (CD 137), or a combination thereof.
- an isolated nucleic acid molecule encoding the CAR is provided that further contains a leader sequence or signal peptide wherein the leader or signal peptide (LP) nucleotide sequence comprises the nucleotide sequence of SEQ ID NO: 19.
- LP leader or signal peptide
- an isolated nucleic acid molecule encoding the CAR is provided wherein the encoded leader sequence comprises the amino acid sequence of SEQ ID NO: 20.
- a chimeric antigen receptor comprising, from N- terminus to C-terminus, at least one ROR1 antigen binding domain, at least one transmembrane domain, and at least one intracellular signaling domain.
- a CAR wherein the extracellular ROR1 antigen binding domain comprises at least one single chain variable fragment of an antibody that binds to the antigen, or at least one heavy chain variable region of an antibody that binds to the antigen, or a combination thereof.
- a CAR wherein the at least one transmembrane domain comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, TNFRSF19, or a combination thereof.
- a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, TNFRSF19, or a combination thereof.
- the CAR is provided wherein CAR additionally encodes an extracellular antigen binding domain comprising CD19, CD20, CD22, mesothelin, CD33, CD38, CD123 (IL3RA), CD138, BCMA (CD269), GPC2, GPC3, FGFR4, TSLPR, c-Met, PSMA, Glycolipid F77, EGFRvIII, GD-2, TSLPR, NY-ESO-1 TCR, MAGE A3 TCR, or an amino acid sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, or any combination thereof.
- CAR additionally encodes an extracellular antigen binding domain comprising CD19, CD20, CD22, mesothelin, CD33, CD38, CD123 (IL3RA), CD138, BCMA (CD269), GPC2, GPC3, FGFR4, TSLPR, c-Met, PSMA, Glycolipid F77, EGFRvIII, GD-2, TSLPR, NY-ESO-1
- the CAR is provided wherein the extracellular antigen binding domain comprises an anti-CD19 ScFv antigen binding domain, an anti-CD20 ScFv antigen binding domain, an anti-CD22 ScFv antigen binding domain, an anti -mesothelin ScFv antigen binding domain, an anti-CD33 ScFv antigen binding domain, an anti-CD38 ScFv antigen binding domain, an anti-CD123 (IL3RA) ScFv antigen binding domain, an anti-CD138 ScFv antigen binding domain, an anti-BCMA (CD269) ScFv antigen binding domain, an anti-GPC2 ScFv antigen binding domain, an anti-GPC3 ScFv antigen binding domain, an anti-FGFR4 ScFv antigen binding domain, anti-TSLPR ScFv antigen binding domain, an anti-c-Met ScFv antigen binding domain, an anti-PMSA ScFv antigen binding domain, an anti-glycolipid F77 ScFv antigen binding domain, an anti-EGFRvIII
- a CAR is provided wherein the at least one intracellular signaling domain comprises a costimulatory domain and a primary signaling domain.
- a CAR wherein the at least one intracellular signaling domain comprises a costimulatory domain comprising a functional signaling domain of a protein selected from the group consisting of OX40, CD70, CD27, CD28, CD5, ICAM-1, LFA- 1 (CDl la/CD18), ICOS (CD278), DAP10, DAP 12, and 4-1BB (CD137), or a combination thereof.
- a protein selected from the group consisting of OX40, CD70, CD27, CD28, CD5, ICAM-1, LFA- 1 (CDl la/CD18), ICOS (CD278), DAP10, DAP 12, and 4-1BB (CD137), or a combination thereof.
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 3 (LTG 1941 LP-ScFV4-CD8H/CD8TM-41BB-CD3zeta CAR nucleic acid sequence (FIGURE 2A)). In one embodiment, the nucleic acid sequence encodes a CAR comprising the amino acid sequence of SEQ ID NO: 4 (LTG 1941 LP-ScFv4-CD8H/CD8TM- 41BB-CD3zeta CAR amino acid sequence (FIGURE 2A)).
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 5 (LTG 2528 LP-ScFv4-IgG4H/CD8TM-41BB-CD3zeta CAR nucleic acid sequence (FIGURE 2B)).
- the nucleic acid sequence encodes a CAR comprising the amino acid sequence of SEQ ID NO: 6 (LTG 2528 LP-ScFv4-l- IgG4H/CD8TM-41BB-CD3 zeta CAR amino acid sequence (FIGURE 2B)).
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 9 (LTG1942 LP-ScFv9-CD8H/CD8TM-41BB-CD3zeta CAR nucleotide sequence (FIGURE 2C)).
- the nucleic acid sequence encodes a CAR comprising the amino acid sequence of SEQ ID NO: 10 (LTG1942 LP-ScFv9- CD8H/CD8TM-41BB-CD3zeta CAR amino acid sequence (FIGURE 2C)).
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 11 (LTG2529 LP-ScFv9-IgG4H/CD8TM-41BB-CD3zeta CAR nucleic acid sequence (FIGURE 2D)).
- the nucleic acid sequence encodes a CAR comprising the amino acid sequence of SEQ ID NO: 12 (LTG2529 LP-ScFv9-IgG4H/CD8 TM-41BB-CD3zeta CAR amino acid sequence (FIGURE 2D)).
- the CARs disclosed herein are modified to express or contain a detectable marker for use in diagnosis, monitoring, and/or predicting the treatment outcome such as progression free survival of cancer patients or for monitoring the progress of such treatment.
- the nucleic acid molecule encoding the disclosed CARs can be contained in a vector, such as a viral vector.
- the vector is a DNA vector, an RNA vector, a plasmid vector, a cosmid vector, a herpes virus vector, a measles virus vector, a lentivirus vector, adenoviral vector, or a retrovirus vector, or a combination thereof.
- the vector further comprises a promoter wherein the promoter is an inducible promoter, a tissue specific promoter, a constitutive promoter, a suicide promoter or any combination thereof.
- the vector expressing the CAR can be further modified to include one or more operative elements to control the expression of CAR T cells, or to eliminate CAR-T cells by virtue of a suicide switch.
- the suicide switch can include, for example, an apoptosis inducing signaling cascade or a drug that induces cell death.
- the vector expressing the CAR can be further modified to express an enzyme such thymidine kinase (TK) or cytosine deaminase (CD).
- host cells including the nucleic acid molecule encoding the CAR are also provided.
- the host cell is a T cell, such as a primary T cell obtained from a subject.
- the host cell is a CD8+ T cell.
- a pharmaceutical composition comprising an anti-tumor effective amount of a population of human T cells, wherein the T cells comprise a nucleic acid sequence that encodes a chimeric antigen receptor (CAR), wherein the CAR comprises at least one extracellular antigen binding domain comprising a human RORl antigen binding domain comprising the amino acid sequence of SEQ ID NO. 2, or 8, at least one linker domain, at least one transmembrane domain, and at least one intracellular signaling domain, wherein the T cells are T cells of a human having a cancer.
- CAR chimeric antigen receptor
- the cancer includes, inter alia, a hematological cancer such as leukemia (e.g., chronic lymphocytic leukemia (CLL), acute lymphocytic leukemia (ALL), or chronic myelogenous leukemia (CML), lymphoma (e.g., mantle cell lymphoma, non-Hodgkin's lymphoma or Hodgkin's lymphoma) or multiple myeloma, or a combination thereof.
- leukemia e.g., chronic lymphocytic leukemia (CLL), acute lymphocytic leukemia (ALL), or chronic myelogenous leukemia (CML)
- lymphoma e.g., mantle cell lymphoma, non-Hodgkin's lymphoma or Hodgkin's lymphoma
- multiple myeloma e.g., multiple myeloma, or a combination thereof.
- a pharmaceutical composition wherein the at least one transmembrane domain of the CAR contains a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, Mesothelin, CD33, CD37, CD64, CD80, CD83, CD86, CD134, CD137, CD154, TNFRSF19, or a combination thereof.
- a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, Mesothelin, CD33, CD37, CD64, CD80, CD83, CD86, CD134, CD137, CD154, TNFRSF19, or a combination thereof.
- a pharmaceutical composition wherein the human cancer includes an adult carcinoma comprising coral and pharynx cancer (tongue, mouth, pharynx, head and neck), digestive system cancers (esophagus, stomach, small intestine, colon, rectum, anus, liver, interhepatic bile duct, gallbladder, pancreas), respiratory system cancers (larynx, lung and bronchus), bones and joint cancers, soft tissue cancers, skin cancers (melanoma, basal and squamous cell carcinoma), pediatric tumors (neuroblastoma, rhabdomyosarcoma, osteosarcoma, Ewing's sarcoma), tumors of the central nervous system (brain, astrocytoma, glioblastoma, glioma), and cancers of the breast, the genital system (uterine cervix, uterine corpus, ovary, vulva, vagina, prostate, testis,
- a pharmaceutical composition comprising an antitumor effective amount of a population of human T cells of a human having a cancer wherein the cancer is a refractory cancer non-responsive to one or more chemotherapeutic agents.
- the cancer includes hematopoietic cancer, myelodysplastic syndrome pancreatic cancer, head and neck cancer, cutaneous tumors, minimal residual disease (MRD) in acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adult B cell malignancies including, CLL (Chronic lymphocytic leukemia), CML (chronic myelogenous leukemia), non-Hodgkin's lymphoma (NHL), pediatric B cell malignancies (including B lineage ALL (acute lymphocytic leukemia)), multiple myeloma lung cancer, breast cancer, ovarian cancer, prostate cancer, colon cancer, melanoma or other hematological cancer and solid tumors, or any combination thereof.
- ALL acute lymphoblastic le
- CAR-T cells methods of making CAR-containing T cells.
- the methods include transducing a T cell with a vector or nucleic acid molecule encoding a disclosed CAR that specifically binds ROR1, thereby making the CAR-T cell.
- a method of generating a population of RNA-engineered cells comprises introducing an in vitro transcribed RNA or synthetic RNA of a nucleic acid molecule encoding a disclosed CAR into a cell of a subject, thereby generating a CAR- expressing cell.
- a method for diagnosing a disease, disorder or condition associated with the expression of ROR1 on a cell comprising a) contacting the cell with a human anti-RORl antibody or fragment thereof, wherein the antibody or a fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, or 8; and b) detecting the presence of RORl wherein the presence of RORl diagnoses for the disease, disorder or condition associated with the expression of RORl .
- the disease, disorder or condition associated with the expression of RORl is cancer including hematopoietic cancer, myelodysplastic syndrome pancreatic cancer, head and neck cancer, cutaneous tumors, minimal residual disease (MRD) in acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adult B cell malignancies including, CLL (Chronic lymphocytic leukemia), CML (chronic myelogenous leukemia), non-Hodgkin's lymphoma (NHL), pediatric B cell malignancies (including B lineage ALL (acute lymphocytic leukemia)), multiple myeloma lung cancer, breast cancer, ovarian cancer, prostate cancer, colon cancer, melanoma or other hematological cancer and solid tumors, or any combination thereof.
- ALL acute lymphoblastic leukemia
- AML acute myeloid leukemia
- adult B cell malignancies including, CLL (Chronic lymphocytic leukemia), CML (chronic
- a method of diagnosing, prognosing, or determining risk of a RORl -related disease in a mammal comprising detecting the expression of RORl in a sample derived from the mammal comprising: a) contacting the sample with a human anti-RORl antibody or fragment thereof, wherein the antibody or a fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, or 8; and b) detecting the presence of RORl wherein the presence of RORl diagnoses for a RORl -related disease in the mammal.
- a method of inhibiting RORl -dependent T cell inhibition comprising contacting a cell with a human anti-RORl antibody or fragment thereof, wherein the antibody or a fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, or 8.
- the cell is selected from the group consisting of a RORl -expressing tumor cell, a tumor-associated macrophage, and any combination thereof.
- a method of blocking T-cell inhibition mediated by a ROR1- expressing cell and altering the tumor microenvironment to inhibit tumor growth in a mammal comprising administering to the mammal an effective amount of a composition comprising an isolated anti-RORl antibody or fragment thereof, wherein the antibody or a fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, and 8.
- the cell is selected from the group consisting of a ROR1 - expressing tumor cell, a tumor-associated macrophage, and any combination thereof.
- a method of inhibiting, suppressing or preventing immunosuppression of an anti-tumor or anti-cancer immune response in a mammal comprising administering to the mammal an effective amount of a composition comprising an isolated anti-RORl antibody or fragment thereof, wherein the antibody or a fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, and 8.
- the antibody or fragment thereof inhibits the interaction between a first cell with a T cell, wherein the first cell is selected from the group consisting of a ROR1 -expressing tumor cell, a tumor-associated macrophage, and any combination thereof.
- a method for inducing an anti-tumor immunity in a mammal comprising administering to the mammal a therapeutically effective amount of a T cell transduced with vector or nucleic acid molecule encoding a disclosed CAR.
- a method of treating or preventing cancer in a mammal comprising administering to the mammal one or more of the disclosed CARs, in an amount effective to treat or prevent cancer in the mammal.
- the method includes administering to the subject a therapeutically effective amount of host cells expressing a disclosed CAR that specifically binds ROR1 and/or one or more of the aforementioned antigens, under conditions sufficient to form an immune complex of the antigen binding domain on the CAR and the extracellular domain of ROR1 and/or one or more of the aforementioned antigens in the subject.
- a method for treating a mammal having a disease, disorder or condition associated with an elevated expression of a tumor antigen comprising administering to the subject a pharmaceutical composition comprising an anti -tumor effective amount of a population of T cells, wherein the T cells comprise a nucleic acid sequence that encodes a chimeric antigen receptor (CAR), wherein the CAR includes at least one extracellular ROR1 antigen binding domain comprising the amino acid sequence of SEQ ID NOs. 2, and 8, or any combination thereof, at least one linker or spacer domain, at least one transmembrane domain, at least one intracellular signaling domain, and wherein the T cells are T cells of the subject having cancer.
- CAR chimeric antigen receptor
- a method for treating cancer in a subject in need thereof comprising administering to the subject a pharmaceutical composition comprising an antitumor effective amount of a population of T cells, wherein the T cells comprise a nucleic acid sequence that encodes a chimeric antigen receptor (CAR), wherein the CAR comprises at least one ROR1 antigen binding domain comprising the amino acid sequence of SEQ ID NOs. 2, or 8, or any combination thereof, at least one linker or spacer domain, at least one transmembrane domain, at least one intracellular signaling domain, wherein the T cells are T cells of the subject having cancer.
- CAR chimeric antigen receptor
- the at least one transmembrane domain comprises a transmembrane the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD19, CD22, Mesothelin, CD33, CD37, CD64, CD80, CD83, CD86, CD134, CD137, CD154, TNFRSF16, TNFRSF19, or a combination thereof.
- a method for generating a persisting population of genetically engineered T cells in a human diagnosed with cancer.
- the method comprises administering to a human a T cell genetically engineered to express a CAR wherein the CAR comprises at least one ROR1 antigen binding domain comprising the amino acid sequence of SEQ ID NOs.
- At least one transmembrane domain at least one intracellular signaling domain wherein the persisting population of genetically engineered T cells, or the population of progeny of the T cells, persists in the human for at least one month, two months, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, twelve months, two years, or three years after administration.
- the progeny T cells in the human comprise a memory T cell.
- the T cell is an autologous T cell.
- any of the aforementioned cancers, diseases, disorders or conditions associated with an elevated expression of a tumor antigen that may be treated or prevented or ameliorated using one or more of the CARs disclosed herein,
- kits for making a chimeric antigen receptor T-cell as described supra or for preventing, treating, or ameliorating any of the cancers, diseases, disorders or conditions associated with an elevated expression of a tumor antigen in a subject as described supra, comprising a container comprising any one of the nucleic acid molecules, vectors, host cells, or compositions disclosed supra or any combination thereof, and instructions for using the kit.
- FIGURE 1 depicts a schematic of the general domain structure of CARs with novel extracellular ROR1 antigen binding domain sequences.
- a chimeric antigen receptor is composed of an extracellular RORl -binding ScFv domain, a spacer or hinge domain (derived from IgG4 or CD8), a transmembrane domain, an intracellular signaling CD137 costimulatory domain, and a CD3zeta signaling domain.
- FIGURES 2A-F depict nucleic acid and amino acid sequences of several chimeric antigen receptors (CARs) containing novel human extracellular RORl antigen binding domain sequences.
- the general scheme for the CARs includes, from the N terminus to the C terminus, a Signal Peptide (SP or LP, leader peptide), an human anti-RORl binder single chain fragment variable (ScFv), an extracellular linker (or hinge, H), a transmembrane domain (TM), a 4-1BB (CD137) signaling domain, and a CD3zeta signaling domain.
- SP or LP Signal Peptide
- ScFv human anti-RORl binder single chain fragment variable
- TM transmembrane domain
- 4-1BB CD137
- FIGURE 2A depicts a lentiviral vector expressing the CAR LTG1941 (LP-ScFv4- CD8H/CD8TM-41BB-CD3zeta) nucleic acid sequence (SEQ ID NO: 3) and the encoded amino acid sequence (SEQ ID NO: 4).
- FIGURE 2B depicts a lentiviral vector expressing the CAR LTG2528 (LP-ScFv4- IgG4H/CD8TM-41BB-CD3zeta) nucleic acid sequence (SEQ ID NO: 5) and the encoded amino acid sequence (SEQ ID NO: 6).
- FIGURE 2C depicts a lentiviral vector expressing the CAR LTG1942 (LP-ScFv9- CD8H/CD8TM-41BB-CD3zeta) nucleotide sequence (SEQ ID NO: 9) and the encoded amino acid sequence (SEQ ID NO: 10).
- FIGURE 2D depicts a lentiviral vector expressing the CAR LTG2529 (LP-ScFv9- IgG4H/CD8TM-41BB-CD3 zeta) nucleic acid sequence (SEQ ID NO 11) and the encoded amino acid sequence (SEQ ID NO: 12).
- FIGURE 2E depicts a lentiviral vector expressing the CAR LTG 1943 (LP-ControlScFv- CD8H/CD8TM-41BB-CD3zeta) nucleic acid sequence (SEQ ID NO: 15) and the encoded amino acid sequence (SEQ ID NO: 16).
- FIGURE 2F depicts a lentiviral vector expressing the CAR LTG2527: (LP-ControlScFv- IgG4H/CD8TM-41BB-CD3zeta) nucleic acid sequence (SEQ ID NO: 17) and the encoded amino acid sequence (SEQ ID NO: 18).
- FIGURE 3 depicts anti-RORl CAR surface expression in primary human T cells.
- CAR T cells redirected to RORl tumor antigen via the use of ScFv domains were generated by lentiviral transduction with CAR expression constructs.
- CART detection was performed by flow cytometry. T cells were washed twice in cold PBS-EDTA buffer and stained with RORl-Fc peptide followed by fluorescently labeled anti-human-Fc polyclonal F(ab)'2 fragment. Cells were gated based on forward scatter and side scatter, singlet discrimination, and 7AAD negativity so that only viable cells were analyzed. Data were acquired on MACSQuant 10 flow cytometer in the APC channel.
- FIGURE 4 depicts anti-RORl CAR T cells incorporating ScFv binders (LTG1941 , LTG1942, and LTG1943) mediating cytolysis of RORl -positive tumors in vitro.
- CAR T cells expressing anti-RORl constructs were incubated with RORl -positive cell lines (Jeko-Luc and A431-Luc), or RORl -negative line (Reh-luc), each line is stably transduced with firefly luciferase, at effector to target ratio (E:T) listed on the x-axis, overnight.
- E:T effector to target ratio
- an antigen includes single or plural antigens and can be considered equivalent to the phrase “at least one antigen.”
- the term “comprises” means “includes.”
- “comprising an antigen” means “including an antigen” without excluding other elements.
- the phrase “and/or” means “and” or “or.” It is further to be understood that any and all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for descriptive purposes, unless otherwise indicated.
- the present disclosure provides for ROR1 antibodies or fragments thereof as well as chimeric antigen receptors (CARs) having such ROR1 antigen binding domains.
- the enhancement of the functional activity of the CAR directly relates to the enhancement of functional activity of the CAR-expressing T cell.
- the CARs exhibit both a high degree of cytokine-induced cytolysis and cell surface expression on transduced T cells, along with an increased level of in vivo T cell expansion and persistence of the transduced CAR-expressing T cell.
- CARs Chimeric Antigen Receptors
- the choice of each of these protein domains is a key design feature, as is the way in which they are specifically combined.
- Each design domain is an essential component that can be used across different CAR platforms to engineer the function of lymphocytes. For example, the choice of the extracellular binding domain can make an otherwise ineffective CAR be effective.
- the invariable framework components of the immunoglobulin-derived protein sequences used to create the extracellular antigen binding domain of a CAR can either be entirely neutral, or they can self-associate and drive the T cell to a state of metabolic exhaustion, thus making the therapeutic T cell expressing that CAR far less effective. This occurs independently of the antigen binding function of this CAR domain. Furthermore, the choice of the intracellular signaling domain(s) also can govern the activity and the durability of the therapeutic lymphocyte population used for immunotherapy.
- human sequence-derived CAR binders may be used for the treatment of human cancer, leukemias, and lymphomas that express the RORl antigen, including; but not limited to, B-CLL, ovarian cancer, triple negative breast cancer, lung adenocarcinoma, and glioblastoma (Balakrishnan, A., et al., 2016, Clin Cancer Res, 23 :3061 -3071 ; and Baskar, S., et al., 2008, Clin Cancer Res 14:396-404; and Jung, E.H., et al., Cell Biochem Fund, 34: 149-157).
- B-CLL ovarian cancer
- triple negative breast cancer lung adenocarcinoma
- glioblastoma glioblastoma
- the CARs disclosed herein are expressed at a high level in a cell.
- a cell expressing the CAR has a high in vivo proliferation rate, produces large amounts of cytokines, and has a high cytotoxic activity against a cell having, on its surface, a RORl antigen to which a CAR binds.
- the use of a human extracellular RORl antigen-binding domain results in generation of a CAR that functions better in vivo, while avoiding the induction of anti-CAR immunity in the host immune response and the killing of the CAR T cell population.
- the CARs expressing the entirely human extracellular RORl ScFv antigen-binding domain exhibit superior activities/properties including i) prevention of poor CAR T persistence and function as seen with mouse-derived binding sequences; ii) lack of regional (i.e. intrapleural) delivery of the CAR to be efficacious; and iii) ability to generate CAR T cell designs based both on binders with high and low affinity to RORl .
- the CARs disclosed herein comprise at least one ROR1 antigen binding domain capable of binding to ROR1, at least one transmembrane domain, and at least one intracellular domain.
- a chimeric antigen receptor is an artificially constructed hybrid protein or polypeptide containing the antigen binding domains of an antibody (e.g., single chain variable fragment (ScFv)) linked to T-cell signaling domains via the transmembrane domain.
- Characteristics of CARs include their ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, and exploiting the antigen-binding properties of monoclonal antibodies.
- the non-MHC-restricted antigen recognition gives T cells expressing CARs the ability to recognize antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
- CARs advantageously do not dimerize with endogenous T cell receptor (TCR) alpha and beta chains.
- the intracellular T cell signaling domains of the CARs can include, for example, a T cell receptor signaling domain, a T cell costimulatory signaling domain, or both.
- the T cell receptor signaling domain refers to a portion of the CAR comprising the intracellular domain of a T cell receptor, such as, for example, and not by way of limitation, the intracellular portion of the CD3 zeta protein.
- the costimulatory signaling domain refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule, which is a cell surface molecule other than an antigen receptor or their ligands that are required for an efficient response of lymphocytes to antigen.
- the CAR comprises a target-specific binding element otherwise referred to as an antigen binding domain or moiety.
- the choice of domain depends upon the type and number of ligands that define the surface of a target cell.
- the antigen binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
- cell surface markers that may act as ligands for the antigen binding domain in the CAR include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
- the CAR can be engineered to target a tumor antigen of interest by way of engineering a desired antigen binding domain that specifically binds to an antigen on a tumor cell.
- Tumor antigens are proteins that are produced by tumor cells that elicit an immune response, particularly T-cell mediated immune responses. The selection of the antigen binding domain will depend on the particular type of cancer to be treated. Tumor antigens include, for example, a glioma-associated antigen, carcinoembryonic antigen (CEA), .beta.
- telomere reverse transcriptase RU1, RU2 (AS)
- intestinal carboxyl esterase mut hsp70- 2
- M-CSF intestinal carboxyl esterase
- PAP prostate-specific antigen
- PAP PAP
- NY-ESO-1 LAGE-la
- p53 prostein
- PSMA Her2/neu
- survivin and telomerase prostate-carcinoma tumor antigen-1 (PCTA-1)
- MAGE ELF2M
- neutrophil elastase neutrophil elastase
- ephrinB2 CD20
- CD22 ROR1, insulin growth factor (IGF)-
- tumor antigens disclosed herein are merely included by way of example. The list is not intended to be exclusive and further examples will be readily apparent to those of skill in the art.
- the tumor antigen comprises one or more antigenic cancer epitopes associated with a malignant tumor.
- Malignant tumors express a number of proteins that can serve as target antigens for an immune attack. These molecules include, but are not limited to, tissue- specific antigens such as MART-1, tyrosinase and GP 100 in melanoma and prostatic acid phosphatase (PAP) and prostate-specific antigen (PSA) in prostate cancer.
- Other target molecules belong to the group of transformation-related molecules such as the oncogene HER-2/Neu/ErbB-
- target antigens are onco-fetal antigens such as carcinoembryonic antigen (CEA).
- CEA carcinoembryonic antigen
- B-cell differentiation antigens such as CD 19, CD20, CD22, BCMA, ROR1, and CD37 are other candidates for target antigens in B-cell lymphoma.
- Some of these antigens (CEA, HER-2, CD19, CD20, idiotype) have been used as targets for passive immunotherapy with monoclonal antibodies with limited success.
- the tumor antigen is ROR1 and the tumors associated with expression of ROR1 comprise lung mesothelioma, ovarian, and pancreatic cancers that express high levels of the extracellular protein ROR1, or any combination thereof.
- the type of tumor antigen may also be a tumor-specific antigen (TSA) or a tumor- associated antigen (TAA).
- TSA tumor-specific antigen
- TAA tumor-associated antigen
- a TSA is unique to tumor cells and does not occur on other cells in the body.
- a TAA is not unique to a tumor cell and instead is also expressed on a normal cell under conditions that fail to induce a state of immunologic tolerance to the antigen.
- the expression of the antigen on the tumor may occur under conditions that enable the immune system to respond to the antigen.
- TAAs may be antigens that are expressed on normal cells during fetal development when the immune system is immature and unable to respond or they may be antigens that are normally present at extremely low levels on normal cells but which are expressed
- TSAs or TAAs include the following: Differentiation antigens such as MART- 1 /MelanA (MART-I), gplOO (Pmel 17), tyrosinase, TRP-1, TRP-2 and tumor- specific multi-lineage antigens such as MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, pl5; overexpressed embryonic antigens such as CEA; overexpressed oncogenes and mutated tumor- suppressor genes such as p53, Ras, HER-2/neu; unique tumor antigens resulting from chromosomal translocations; such as BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR; and viral antigens, such as the Epstein Barr virus antigens EBVA and the human papillomavirus (HPV) antigens E6 and E7.
- Differentiation antigens such as MART- 1 /MelanA (M
- the antigen binding domain portion of the CAR targets an antigen that includes but is not limited to CD19, CD20, CD22, ROR1, CD33, CD38, CD123, CD138, BCMA, c-Met, PSMA, Glycolipid F77, EGFRvIII, GD-2, FGFR4, TSLPR, NY-ESO-1 TCR, MAGE A3 TCR, and the like.
- the antigen binding domain portion of the CAR targets the extracellular ROR1 antigen.
- the isolated nucleic acid molecule encoding the extracellular ROR1 binding domain scFv4 comprises a nucleotide sequence of SEQ ID NO: 1, or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof.
- an isolated nucleic acid molecule is provided wherein the encoded extracellular ROR1 antigen binding domain scFv4 comprises an amino acid sequence of SEQ ID NO: 2, or an amino acid sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity to an amino acid sequence of SEQ ID NO: 2.
- the isolated nucleic acid molecule encoding the extracellular RORl antigen binding domain ScV9 comprises a nucleotide sequence of SEQ ID NO: 7, or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof.
- an isolated nucleic acid molecule is provided wherein the encoded extracellular RORl antigen binding domain ScFv9 comprises an amino acid sequence of SEQ ID NO: 8, or an amino acid sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity to an amino acid sequence of SEQ ID NO: 8.
- the isolated nucleic acid molecule encoding the extracellular RORl control ScFv antigen binding domain comprises a nucleotide sequence of SEQ ID NO: 13, or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof.
- an isolated nucleic acid molecule is provided wherein the encoded extracellular RORl control ScFv antigen binding domain comprises an amino acid sequence of SEQ ID NO: 14, or an amino acid sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity to an amino acid sequence of SEQ ID NO: 14.
- the general scheme is set forth in FIGURE 1 and includes, from the N-terminus to the C-terminus, a signal or leader peptide, anti-RORl ScFv, extracellular linker or hinge (H) domain, transmembrane (TM) domain, 4-1 BB, CD3 zeta, wherein the bolded text represents the cloning sites for linking domains.
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 3, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 4 [LTG1941 LP-ScFv4-CD8H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2A)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 3, or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 4 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof LTG1941 LP- ScFv4-CD8H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2A)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 5, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 6 [LTG2528 LP-ScFv4-IgG4H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2B)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 5 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 6 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof [LTG2528 LP-ScFv4-CD8H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2B)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 9, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 10 LTG1942 LP-ScFv9-CD8H/CD8TM-41BB-CD3zeta CAR amino acid sequence (as depicted in Figure 2C)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 9 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 10 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof [LTG1942 LP-ScFv9-CD8H/CD8TM-41BB-CD3zeta CAR amino acid sequence (as depicted in Figure 2C)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 11, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 12 [LTG2529 LP-ScFv9-IgG4H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2D)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 11 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 12 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof [LTG2529 LP-ScFv9-IgG4H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2D)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 15, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 16 [LTG1943 LP-controlScFv-CD8H/CD8TM-41BB- CD3zeta amino acid sequence (as depicted in Figure 2E)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 15 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 16 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof [LTG1943 LP-controlScFv-CD8H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2E)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 17, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 18 [(LTG2527 LP-controlScFv-IgG4H/CD8TM-41BB- CD3zeta amino acid sequence (as depicted in Figure 2F)].
- the nucleic acid sequence encoding a CAR comprises the nucleic acid sequence of SEQ ID NO: 17 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof, and encodes the CAR comprising the amino acid sequence as set forth in SEQ ID NO: 18 or a sequence with 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereof [LTG2527 LP-controlScFv-IgG4H/CD8TM-41BB-CD3zeta amino acid sequence (as depicted in Figure 2F)].
- Example 2 The surface expression of anti-RORl CARs incorporating single chain fragment variable (ScFv) sequences reactive with RORl antigen, is shown in Example 2 infra and summarized in Table 2.
- the expression level for each ScFv-containing CAR was determined by flow cytometric analysis of LV-transduced T cells from healthy donors using a recombinant RORl-Fc peptide, followed by anti-human Fc F(ab')2 fragment conjugated to AF647, and detected in the APC channel, (c.f, Figure 3).
- the ScFv-based anti-RORl CAR constructs LTG1941, LTG1942- LTG1943 were highly expressed in human primary T cells (as indicated by the gated population) as compared to non-transduced T cell controls (non-gated cell population). Representative results from one donor are shown.
- Example 2 and Figure 4 high cytolytic activity of the RORl CARs was demonstrated when lentiviral vectors (LV) expressing the following CARs were created and tested for anti-leukemia activity.
- Each experimental CAR contains the 4-lBB/CD3-zeta chain signaling motif and the specific anti-RORl binding motif/domain noted therein.
- Leukemia target lines with RORl surface expression were used: Jeko and A431 ; and RORl negative Reh.
- ScFv- based anti-RORl CAR constructs LTG1941, LTG1942, and LTG1943 were able to efficiently lyse A431 , whereas they had no specific lytic activity against Reh, (c.f, Figure 4).
- the ability to lyse Jeko by anti-RORl CARs LTG1941 and LTG1942 differed, indicating differential biological activity.
- Negative controls (untransduced T cells, UN, or T cells transduced with the control LTG1398 LV) yielded no appreciable cytokine induction.
- the results seen in cytolytic and cytokine function highlight that LTG1942 performs similarly to the control ScFv- bearing CAR, LTG1943, whereas LTG1941 has much lower cytokine production and ability to lyse the Jeko leukemia cell line.
- the ability to lyse A431 by LTG1941 indicates that we have a differentiated product that may be preferred if LTG1942 proves to active or too toxic in clinical studies of CAR-T.
- the enhanced therapeutic function associated with the exemplary CARs of the invention include, for example, and not by way of limitation, a) improved lateral movement within the plasma membrane allowing for more efficient signal transduction, b) superior location within plasma membrane microdomains, such as lipid rafts, and greater ability to interact with transmembrane signaling cascades associated with T cell activation, c) superior location within the plasma membrane by preferential movement away from dampening or down-modulatory interactions, such as less proximity to or interaction with phosphatases such as CD45, and d) superior assembly into T cell receptor signaling complexes (i.e. the immune synapse), or any combination thereof.
- ROR1 ScFv antigen binding domains While the disclosure has been illustrated with an exemplary extracellular ROR1 ScFv antigen binding domains, other nucleotide and/or amino acid variants within the ROR1 variable ScFv antigen binding domains may be used to derive heavy-chain only binding domains, or subsets thereof, and thus comprise the ROR1 antigen binding domains for use in the CARs described herein.
- the CAR can be additionally engineered to include the appropriate antigen binding domain that is specific to the desired antigen target.
- an antibody for ROR1 can be used as the antigen bind domain incorporation into the CAR.
- the antigen binding domain portion of the CAR additionally targets CD33.
- the antigen binding domain in the CAR is anti-CD33 ScFv, wherein the nucleic acid sequence of the anti-CD33 ScFv comprises the sequence set forth in SEQ ID NO: 34.
- the anti-CD33 ScFv comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 35.
- the anti-CD33 ScFv portion of the CAR comprises the amino acid sequence set forth in SEQ ID NO: 35.
- the antigen binding domain portion of the CAR additionally targets mesothelin.
- the antigen binding domain in the CAR is anti- mesothelin ScFv, wherein the nucleic acid sequence of the anti-mesothelin ScFv comprises the sequence set forth in SEQ ID NO: 36.
- the anti-mesothelin ScFv comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 37.
- the anti-mesothelin ScFv portion of the CAR comprises the amino acid sequence set forth in SEQ ID NO: 37.
- the antigen binding domain portion of the CAR additionally targets CD19.
- the antigen binding domain in the CAR is anti-CD19 ScFv, wherein the nucleic acid sequence of the anti-mesothelin ScFv comprises the sequence set forth in SEQ ID NO: 32.
- the anti-mesothelin ScFv comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 33.
- the anti-CD19 ScFv portion of the CAR comprises the amino acid sequence set forth in SEQ ID NO: 33.
- a CAR capable of binding to a non-TSA or non-TAA including, for example and not by way of limitation, an antigen derived from Retroviridae (e.g. human immunodeficiency viruses such as HIV-1 and HIV-LP), Picornaviridae (e.g.
- poliovirus hepatitis A virus, enterovirus, human coxsackievirus, rhinovirus, and echovirus
- rubella virus coronavirus
- vesicular stomatitis virus rabies virus
- ebola virus parainfluenza virus
- mumps virus measles virus
- respiratory syncytial virus influenza virus
- hepatitis B virus parvovirus
- Adenoviridae Herpesviridae [e.g. type 1 and type 2 herpes simplex virus (HSV), varicella-zoster virus, cytomegalovirus (CMV), and herpes virus]
- Herpesviridae e.g. type 1 and type 2 herpes simplex virus (HSV), varicella-zoster virus, cytomegalovirus (CMV), and herpes virus
- Herpesviridae e.g. type 1 and type 2 herpes simplex virus (HSV), varicella-zoster virus
- a CAR capable of binding to an antigen derived from a bacterial strain of Staphylococci, Streptococcus, Escherichia coli, Pseudomonas, or Salmonella.
- a CAR capable of binding to an antigen derived from an infectious bacterium, for example, Helicobacter pyloris, Legionella pneumophilia, a bacterial strain of Mycobacteria sps. (e.g. M. tuberculosis, M. avium, M. intracellulare, M. kansaii, or M.
- the CAR comprises one or more transmembrane domains fused to the extracellular ROR1 antigen binding domain of the CAR.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- Transmembrane regions of particular use in the CARs described herein may be derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T- cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD 16, CD22, mesothelin, CD33, CD37, CD64, CD80, CD83, CD86, CD134, CD137, CD154, TNFRSF16, or TNFRSF19.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
- a glycine-serine doublet provides a particularly suitable linker.
- the transmembrane domain that naturally is associated with one of the domains in the CAR is used in addition to the transmembrane domains described supra.
- the transmembrane domain can be selected or by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain in the CAR of the invention is the CD8 transmembrane domain.
- the CD8 transmembrane domain comprises the nucleic acid sequence of SEQ ID NO: 21.
- the CD8 transmembrane domain comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 22.
- the CD8 transmembrane domain comprises the amino acid sequence of SEQ ID NO: 22.
- the encoded transmembrane domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO: 22, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 22.
- the transmembrane domain of the CAR comprises the CD 8. alpha. hinge domain.
- the CD8 hinge domain comprises the nucleic acid sequence of SEQ ID NO: 23.
- the CD8 hinge domain comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 24.
- the CD8 hinge domain comprises the amino acid sequence of SEQ ID NO: 24, or a sequence with 95-99% identify thereof.
- an isolated nucleic acid molecule wherein the encoded linker domain is derived from the extracellular domain of CD8, and is linked to the transmembrane CD8 domain, the transmembrane CD28 domain, or a combination thereof.
- a spacer domain can be arranged between the extracellular domain and the transmembrane domain, or between the intracellular domain and the transmembrane domain.
- the spacer domain means any oligopeptide or polypeptide that serves to link the transmembrane domain with the extracellular domain and/or the transmembrane domain with the intracellular domain.
- the spacer domain comprises up to 300 amino acids, preferably 10 to 100 amino acids, and most preferably 25 to 50 amino acids.
- the linker can include a spacer element, which, when present, increases the size of the linker such that the distance between the effector molecule or the detectable marker and the antibody or antigen binding fragment is increased.
- spacers are known to the person of ordinary skill, and include those listed in U.S. Pat. Nos.
- the spacer domain preferably has a sequence that promotes binding of a CAR with an antigen and enhances signaling into a cell.
- an amino acid that is expected to promote the binding include cysteine, a charged amino acid, and serine and threonine in a potential glycosylation site, and these amino acids can be used as an amino acid constituting the spacer domain.
- the spacer domain As the spacer domain, the entire or a part of amino acid numbers 137-206 (SEQ ID NO: 25) which is a hinge region of CD8. alpha. (NCBI RefSeq: NP.sub. ⁇ 001759.3), amino acid numbers 135 to 195 of CD8.beta. (GenBank: AAA35664.1), amino acid numbers 315 to 396 of CD4 (NCBI RefSeq: NP.sub. -000607.1), or amino acid numbers 137 to 152 of CD28 (NCBI RefSeq: NP.sub.—006130.1) can be used. Also, as the spacer domain, a part of a constant region of an antibody H chain or L chain can be used. Further, the spacer domain may be an artificially synthesized sequence.
- a spacer domain can also be comprised of elements of Immunoglobulin (Ig) constant domains, such as those derived for IgG4, including sequences that link immunoglobulin domains that comprise an immunoglobulin protein.
- the spacer or hinge domain exists at the C-terminus of the scFv ROR1 -binding domain and extends to the CAR transmembrane domain.
- the IgG4 hinge (H) domain comprises the nucleic acid sequence of SEQ ID NO: 38.
- the CD8 hinge domain comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 39.
- the CD8 hinge domain comprises the amino acid sequence of SEQ ID NO: 39, or a sequence with 95-99% identify thereof.
- the IgG4 constant regions serve as a hinge (H) and are linked to the transmembrane domain of CD8.
- the IgG4H domain is linked to the CD8 transmembrane domain and together comprises the nucleic acid sequence of SEQ ID NO: 40.
- the IgG4H domain linked to the CD8 transmembrane domain comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 41.
- the IgG4H linked to the CD8 transmembrane domain comprises the amino acid sequence of SEQ ID NO: 41, or a sequence with 95-99% identify thereof.
- a signal peptide sequence can be linked to the N-terminus.
- the signal peptide sequence exists at the N-terminus of many secretory proteins and membrane proteins, and has a length of 15 to 30 amino acids. Since many of the protein molecules mentioned above as the intracellular domain have signal peptide sequences, the signal peptides can be used as a signal peptide for the CAR.
- the signal peptide comprises the amino acid sequence shown in SEQ ID NO: 20.
- the cytoplasmic domain or otherwise the intracellular signaling domain of the CAR is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed in.
- effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
- intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
- intracellular signaling domains for use in the CAR include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
- TCR T cell receptor
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co- stimulatory signal (secondary cytoplasmic signaling sequences).
- primary cytoplasmic signaling sequences those that initiate antigen-dependent primary activation through the TCR
- secondary cytoplasmic signaling sequences those that act in an antigen-independent manner to provide a secondary or co- stimulatory signal
- Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary cytoplasmic signaling sequences examples include those derived from TCR zeta (CD3 Zeta), FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d.
- Specific, non-limiting examples, of the ITAM include peptides having sequences of amino acid numbers 51 to 164 of CD3.zeta. (NCBI RefSeq: NP.sub. -932170.1), amino acid numbers 45 to 86 of Fc.epsilon.RI.gamma. (NCBI RefSeq: NP.sub.
- NCBI RefSeq amino acid numbers 201 to 244 of Fc.epsilon.RI.beta.
- NCBI RefSeq amino acid numbers 139 to 182 of CD3.
- gamma. NCBI RefSeq: NP.sub. -000064.1
- amino acid numbers 128 to 171 of CD3 .delta. NCBI RefSeq: NP.sub. -000723.1
- NCBI RefSeq: NP.sub. ⁇ 000724.1 amino acid numbers 402 to 495 of CD5 (NCBI RefSeq: NP.sub. ⁇ 055022.2), amino acid numbers 707 to 847 of 0022 (NCBI RefSeq: NP.sub. -001762.2), amino acid numbers 166 to 226 of CD79a (NCBI RefSeq: NP.sub.-- 001774.1), amino acid numbers 182 to 229 of CD79b (NCBI RefSeq: NP.sub. ⁇ 000617.1), and amino acid numbers 177 to 252 of CD66d (NCBI RefSeq: NP. sub.
- the cytoplasmic signaling molecule in the CAR comprises a cytoplasmic signaling sequence derived from CD3 zeta.
- the intracellular domain of the CAR can be designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR.
- the intracellular domain of the CAR can comprise a CD3 zeta chain portion and a costimulatory signaling region.
- the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
- costimulatory molecules examples include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
- costimulatory molecules include peptides having sequences of amino acid numbers 236 to 351 of CD2 (NCBI RefSeq: NP. sub.
- NCBI RefSeq amino acid numbers 421 to 458 of CD4 (NCBI RefSeq: NP.sub. ⁇ 000607.1), amino acid numbers 402 to 495 of CD5 (NCBI RefSeq: NP.sub. -055022.2), amino acid numbers 207 to 235 of CD8. alpha. (NCBI RefSeq: NP.sub. ⁇ 001759.3), amino acid numbers 196 to 210 of CD83 (GenBank: AAA35664.1), amino acid numbers 181 to 220 of CD28 (NCBI RefSeq: NP.sub. ⁇ 006130.1), amino acid numbers 214 to 255 of CD137 (4-1BB, NCBI RefSeq: NP.sub.2), amino acid numbers 421 to 458 of CD4 (NCBI RefSeq: NP.sub. ⁇ 000607.1), amino acid numbers 402 to 495 of CD5 (NCBI RefSeq: NP.sub. -055022.2), amino acid numbers 207
- the cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet provides a particularly suitable linker.
- the intracellular domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28.
- the intracellular domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of 4-lBB.
- the intracellular domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28 and 4-lBB.
- the intracellular domain in the CAR is designed to comprise the signaling domain of 4-1 BB and the signaling domain of CD3-zeta, wherein the signaling domain of 4-lBB comprises the nucleic acid sequence set forth in SEQ ID NO: 26 and the signaling domain of CD3-zeta comprises the nucleic acid sequence set forth in SEQ ID NO: 28 and in the variant nucleic acid sequence set forth in SEQ ID NO: 30.
- the intracellular domain in the CAR is designed to comprise the signaling domain of 4-lBB and the signaling domain of CD3-zeta, wherein the signaling domain of 4-lBB comprises the nucleic acid sequence set forth in SEQ ID NO: 26 and the signaling domain of CD3-zeta comprises the nucleic acid sequence set forth in SEQ ID NO: 28 and in the variant nucleic acid sequence set forth in SEQ ID NO: 30.
- the intracellular domain in the CAR is designed to comprise the signaling domain of 4-1 BB and the signaling domain of CD3-zeta
- the signaling domain of 4-1 BB comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 27
- the signaling domain of CD3-zeta comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 29 and in the variant nucleic acid that encodes the amino acid sequence of SEQ ID NO: 31.
- the intracellular domain in the CAR is designed to comprise the signaling domain of 4-1 BB and the signaling domain of CD3-zeta, wherein the signaling domain of 4- IBB comprises the amino acid sequence set forth in SEQ ID NO: 27 and the signaling domain of CD3-zeta comprises the amino acid sequence set forth in SEQ ID NO: 29 and the variant amino acid sequence set forth in SEQ ID NO: 31.
- the term "functional portion" when used in reference to a CAR refers to any part or fragment of one or more of the CARs disclosed herein, which part or fragment retains the biological activity of the CAR of which it is a part (the parent CAR).
- Functional portions encompass, for example, those parts of a CAR that retain the ability to recognize target cells, or detect, treat, or prevent a disease, to a similar extent, the same extent, or to a higher extent, as the parent CAR.
- the functional portion can comprise, for instance, about 10%, 25%, 30%, 50%, 68%, 80%, 90%, 95%, or more, of the parent CAR.
- the functional portion can comprise additional amino acids at the amino or carboxy terminus of the portion, or at both termini, which additional amino acids are not found in the amino acid sequence of the parent CAR.
- the additional amino acids do not interfere with the biological function of the functional portion, e.g., recognize target cells, detect cancer, treat or prevent cancer, etc. More desirably, the additional amino acids enhance the biological activity, as compared to the biological activity of the parent CAR.
- the term "functional variant” as used herein refers to a CAR, polypeptide, or protein having substantial or significant sequence identity or similarity to a parent CAR, which functional variant retains the biological activity of the CAR of which it is a variant.
- Functional variants encompass, for example, those variants of the CAR described herein (the parent CAR) that retain the ability to recognize target cells to a similar extent, the same extent, or to a higher extent, as the parent CAR.
- the functional variant can, for instance, be at least about 30%, 50%, 75%, 80%, 90%, 98% or more identical in amino acid sequence to the parent CAR.
- a functional variant can, for example, comprise the amino acid sequence of the parent CAR with at least one conservative amino acid substitution.
- the functional variants can comprise the amino acid sequence of the parent CAR with at least one non-conservative amino acid substitution.
- the non-conservative amino acid substitution may enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the parent CAR.
- Amino acid substitutions of the CARs are preferably conservative amino acid substitutions.
- Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties.
- the conservative amino acid substitution can be an acidic/negatively charged polar amino acid substituted for another acidic/negatively charged polar amino acid (e.g., Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g., Ala, Gly, Val, He, Leu, Met, Phe, Pro, Trp, Cys, Val, etc.), a basic/positively charged polar amino acid substituted for another basic/positively charged polar amino acid (e.g.
- an acidic/negatively charged polar amino acid substituted for another acidic/negatively charged polar amino acid e.g., Asp or Glu
- an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain e.g., Ala, Gly, Val, He, Leu, Met, Phe, Pro, Trp, Cys, Val, etc.
- an uncharged amino acid with a polar side chain substituted for another uncharged amino acid with a polar side chain e.g., Asn, Gin, Ser, Thr, Tyr, etc.
- an amino acid with a beta- branched side-chain substituted for another amino acid with a beta-branched side-chain e.g., He, Thr, and Val
- an amino acid with an aromatic side-chain substituted for another amino acid with an aromatic side chain e.g., His, Phe, Trp, and Tyr
- the CAR can consist essentially of the specified amino acid sequence or sequences described herein, such that other components, e.g., other amino acids, do not materially change the biological activity of the functional variant.
- the CARs can be of any length, i.e., can comprise any number of amino acids, provided that the CARs (or functional portions or functional variants thereof) retain their biological activity, e.g., the ability to specifically bind to antigen, detect diseased cells in a mammal, or treat or prevent disease in a mammal, etc.
- the CAR can be about 50 to about 5000 amino acids long, such as 50, 70, 75, 100, 125, 150, 175, 200, 300, 400, 500, 600, 700, 800, 900, 1000 or more amino acids in length.
- the CARs can comprise synthetic amino acids in place of one or more naturally-occurring amino acids.
- Such synthetic amino acids are known in the art, and include, for example, amino cyclohexane carboxylic acid, norleucine, -amino n-decanoic acid, homoserine, S-acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4-aminophenylalanine, 4- nitrophenyl alanine, 4- chlorophenylalanine, 4-carboxyphenyl alanine, ⁇ -phenylserine ⁇ -hydroxyphenylalanine, phenylglycine, a-naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, l,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, aminomal
- the CARs can be glycosylated, amidated, carboxylated, phosphorylated, esterified, N-acylated, cyclized via, e.g., a disulfide bridge, or converted into an acid addition salt and/or optionally dimerized or polymerized, or conjugated.
- the CARs can be obtained by methods known in the art.
- the CARs may be made by any suitable method of making polypeptides or proteins. Suitable methods of de novo synthesizing polypeptides and proteins are described in references, such as Chan et al., Fmoc Solid Phase Peptide Synthesis, Oxford University Press, Oxford, United Kingdom, 2000; Peptide and Protein Drug Analysis, ed. Reid, R., Marcel Dekker, Inc., 2000; Epitope Mapping, ed. Westwood et al., Oxford University Press, Oxford, United Kingdom, 2001 ; and U.S. Patent 5,449,752.
- polypeptides and proteins can be recombinantly produced using the nucleic acids described herein using standard recombinant methods. See, for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, NY 2001 ; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY, 1994. Further, some of the CARs (including functional portions and functional variants thereof) can be isolated and/or purified from a source, such as a plant, a bacterium, an insect, a mammal, e.g., a rat, a human, etc.
- a source such as a plant, a bacterium, an insect, a mammal, e.g., a rat, a human, etc.
- the CARs described herein can be commercially synthesized by companies.
- the CARs can be synthetic, recombinant, isolated, and/or purified.
- One embodiment further provides a CAR, a T cell expressing a CAR, an antibody, or antigen binding domain or portion thereof, which specifically binds to one or more of the antigens disclosed herein.
- a "T cell expressing a CAR,” or a “CAR T cell” means a T cell expressing a CAR, and has antigen specificity determined by, for example, the antibody-derived targeting domain of the CAR.
- antibody can include an antibody and antigen binding fragments thereof.
- antibody is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multi-specific antibodies (e.g., bispecific antibodies), and antigen binding fragments thereof, so long as they exhibit the desired antigen-binding activity.
- Non-limiting examples of antibodies include, for example, intact immunoglobulins and variants and fragments thereof known in the art that retain binding affinity for the antigen.
- a “monoclonal antibody” is an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic epitope. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- a monoclonal antibody is an antibody produced by a single clone of B lymphocytes or by a cell into which nucleic acid encoding the light and heavy variable regions of the antibody of a single antibody (or an antigen binding fragment thereof) have been transfected, or a progeny thereof.
- monoclonal antibodies are isolated from a subject. Monoclonal antibodies can have conservative amino acid substitutions which have substantially no effect on antigen binding or other immunoglobulin functions. Exemplary methods of production of monoclonal antibodies are known, for example, see Harlow & Lane, Antibodies, A Laboratory Manual, 2nd ed. Cold Spring Harbor Publications, New York (2013).
- an immunoglobulin typically has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
- Immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable domain genes.
- Each heavy and light chain contains a constant region (or constant domain) and a variable region (or variable domain; see, e.g., Kindt et al. Kuby Immunology, 6 th ed., W.H. Freeman and Co., page 91 (2007).)
- the heavy and the light chain variable regions combine to specifically bind the antigen.
- only the heavy chain variable region is required.
- naturally occurring camelid antibodies consisting of a heavy chain are functional and stable in the absence of light chain (see, e.g., Hamers- Casterman et al., Nature, 363 :446-448, 1993; Sheriff et al., Nat. Struct. Biol., 3:733-736, 1996).
- VH refers to the variable region of an antibody heavy chain, including that of an antigen binding fragment, such as Fv, ScFv, dsFv or Fab.
- VL refers to the variable domain of an antibody light chain, including that of an Fv, ScFv, dsFv or Fab.
- Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions” or "CDRs" (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991).
- CDRs complementarity-determining regions
- the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
- the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three-dimensional space.
- the CDRs are primarily responsible for binding to an epitope of an antigen.
- amino acid sequence boundaries of a given CDR can be readily determined using any of a number of well-known schemes, including those described by Kabat et al. ("Sequences of Proteins of Immunological Interest," 5 th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991 ; "Kabat” numbering scheme), Al-Lazikani et al., (JMB 273,927-948, 1997; “Chothia” numbering scheme), and Lefranc et al. (“IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains," Dev. Comp. Immunol., 27:55-77, 2003; “IMGT” numbering scheme).
- the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3 (from the N-terminus to C-terminus), and are also typically identified by the chain in which the particular CDR is located.
- a VH CDR3 is the CDR3 from the variable domain of the heavy chain of the antibody in which it is found
- a VL CDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
- Light chain CDRs are sometimes referred to as LCDR1 , LCDR2, and LCDR3.
- Heavy chain CDRs are sometimes referred to as LCDR1, LCDR2, and LCDR3.
- an "antigen binding fragment” is a portion of a full length antibody that retains the ability to specifically recognize the cognate antigen, as well as various combinations of such portions.
- antigen binding fragments include Fv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; linear antibodies; single-chain antibody molecules (e.g. ScFv); and multi-specific antibodies formed from antibody fragments.
- Antibody fragments include antigen binding fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA methodologies (see, e.g., Kontermann and Dubel (Ed), Antibody Engineering, Vols. 1-2, 2nd Ed., Springer Press, 2010).
- a single-chain antibody is a genetically engineered molecule containing the VH and VL domains of one or more antibody(ies) linked by a suitable polypeptide linker as a genetically fused single chain molecule (see, for example, Bird et al., Science, 242:423 426, 1988; Huston et al., Proc. Natl. Acad. Sci., 85:5879 5883, 1988; Ahmad et al., Clin. Dev. Immunol., 2012, doi: 10.1155/2012/980250; Marbry, IDrugs, 13:543-549, 2010).
- VH-domain-linker domain-VL-domain VL- domain-linker domain- VH-domain
- Diabodies which are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see, for example, Holliger et al., Proc. Natl. Acad. Sci., 90:6444 6448, 1993; Poljak et al., Structure, 2: 1121 1123, 1994).
- Antibodies also include genetically engineered forms such as chimeric antibodies (such as humanized murine antibodies) and heteroconjugate antibodies (such as bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, IL); Kuby, J., Immunology, 3rd Ed., W.H. Freeman & Co., New York, 1997.
- Non-naturally occurring antibodies can be constructed using solid phase peptide synthesis, can be produced recombinantly, or can be obtained, for example, by screening combinatorial libraries consisting of variable heavy chains and variable light chains as described by Huse et al., Science 246: 1275-1281 (1989), which is incorporated herein by reference.
- These and other methods of making, for example, chimeric, humanized, CDR-grafted, single chain, and bifunctional antibodies are well known to those skilled in the art (Winter and Harris, Immunol.
- an "antibody that binds to the same epitope” as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
- Antibody competition assays are known, and an exemplary competition assay is provided herein.
- a “humanized” antibody or antigen binding fragment includes a human framework region and one or more CDRs from a non-human (such as a mouse, rat, or synthetic) antibody or antigen binding fragment.
- the non-human antibody or antigen binding fragment providing the CDRs is termed a "donor,” and the human antibody or antigen binding fragment providing the framework is termed an "acceptor.”
- all the CDRs are from the donor immunoglobulin in a humanized immunoglobulin. Constant regions need not be present, but if they are, they can be substantially identical to human immunoglobulin constant regions, such as at least about 85-90%, such as about 95% or more identical.
- all parts of a humanized antibody or antigen binding fragment, except possibly the CDRs are substantially identical to corresponding parts of natural human antibody sequences.
- a “chimeric antibody” is an antibody which includes sequences derived from two different antibodies, which typically are of different species.
- a chimeric antibody includes one or more CDRs and/or framework regions from one human antibody and CDRs and/or framework regions from another human antibody.
- a “fully human antibody” or “human antibody” is an antibody which includes sequences from (or derived from) the human genome, and does not include sequence from another species.
- a human antibody includes CDRs, framework regions, and (if present) an Fc region from (or derived from) the human genome.
- Human antibodies can be identified and isolated using technologies for creating antibodies based on sequences derived from the human genome, for example by phage display or using transgenic animals (see, e.g., Barbas et al. Phage display: A Laboratory Manuel. 1 st Ed. New York: Cold Spring Harbor Laboratory Press, 2004. Print.; Lonberg, Nat. Biotech., 23 : 1117-1125, 2005; Lonenberg, Curr. Opin. Immunol., 20:450- 459, 2008).
- An antibody may have one or more binding sites. If there is more than one binding site, the binding sites may be identical to one another or may be different. For instance, a naturally- occurring immunoglobulin has two identical binding sites, a single-chain antibody or Fab fragment has one binding site, while a bispecific or bifunctional antibody has two different binding sites.
- Methods of testing antibodies for the ability to bind to any functional portion of the CAR include any antibody-antigen binding assay, such as, for example, radioimmunoassay (RIA), ELISA, Western blot, immunoprecipitation, and competitive inhibition assays (see, e.g., Janeway et al., infra, U.S. Patent Application Publication No. 2002/0197266 Al, and U.S. Patent No. 7,338,929).
- RIA radioimmunoassay
- ELISA ELISA
- Western blot Western blot
- immunoprecipitation immunoprecipitation
- competitive inhibition assays see, e.g., Janeway et al., infra, U.S. Patent Application Publication No. 2002/0197266 Al, and U.S. Patent No. 7,338,929.
- a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof can be modified to comprise a detectable label, such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
- a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
- FITC fluorescein isothiocyanate
- PE phycoerythrin
- an enzyme e
- a CAR, a T cell expressing a CAR, or monoclonal antibodies, or antigen binding fragments thereof, specific for one or more of the antigens disclosed herein can be conjugated to an agent, such as an effector molecule or detectable marker, using any number of means known to those of skill in the art. Both covalent and noncovalent attachment means may be used. Conjugates include, but are not limited to, molecules in which there is a covalent linkage of an effector molecule or a detectable marker to an antibody or antigen binding fragment that specifically binds one or more of the antigens disclosed herein.
- effector molecules and detectable markers can be used, including (but not limited to) chemotherapeutic agents, anti-angiogenic agents, toxins, radioactive agents such as 125 1, 32 P, 14 C, 3 H and 35 S and other labels, target moieties and ligands, etc.
- the choice of a particular effector molecule or detectable marker depends on the particular target molecule or cell, and the desired biological effect.
- the effector molecule can be a cytotoxin that is used to bring about the death of a particular target cell (such as a tumor cell).
- the procedure for attaching an effector molecule or detectable marker to an antibody or antigen binding fragment varies according to the chemical structure of the effector.
- Polypeptides typically contain a variety of functional groups; such as carboxylic acid (COOH), free amine (- NH2) or sulfhydryl (-SH) groups, which are available for reaction with a suitable functional group on an antibody to result in the binding of the effector molecule or detectable marker.
- the antibody or antigen binding fragment is derivatized to expose or attach additional reactive functional groups.
- the derivatization may involve attachment of any of a number of known linker molecules such as those available from Pierce Chemical Company, Rockford, IL.
- the linker can be any molecule used to join the antibody or antigen binding fragment to the effector molecule or detectable marker.
- the linker is capable of forming covalent bonds to both the antibody or antigen binding fragment and to the effector molecule or detectable marker.
- Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers.
- the linkers may be joined to the constituent amino acids through their side groups (such as through a disulfide linkage to cysteine) or to the alpha carbon amino and carboxyl groups of the terminal amino acids.
- the linker can include a spacer element, which, when present, increases the size of the linker such that the distance between the effector molecule or the detectable marker and the antibody or antigen binding fragment is increased.
- spacers are known to the person of ordinary skill, and include those listed in U.S. Pat. Nos.
- the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the effector molecule or detectable marker from the antibody or antigen binding fragment in the intracellular environment.
- the linker is not cleavable and the effector molecule or detectable marker is released, for example, by antibody degradation.
- the linker is cleavable by a cleaving agent that is present in the intracellular environment (for example, within a lysosome or endosome or caveolea).
- the linker can be, for example, a peptide linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
- the peptide linker is at least two amino acids long or at least three amino acids long.
- the linker can be 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 amino acids long, such as 1-2, 1 -3, 2-5, 3-10, 3-15, 1 -5, 1-10, 1-15 amino acids long.
- Proteases can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside target cells (see, for example, Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67- 123).
- a peptide linker that is cleavable by the thiol-dependent protease cathepsin-B can be used (for example, a Phenylalanine -Leucine or a Glycine- Phenylalanine -Leucine-Glycine linker).
- Other examples of such linkers are described, for example, in U.S. Pat. No. 6,214,345, incorporated herein by reference.
- the peptide linker cleavable by an intracellular protease is a Valine-Citruline linker or a Phenylalanine-Lysine linker (see, for example, U.S. Pat. No. 6,214,345, which describes the synthesis of doxorubicin with the Valine- Citruline linker).
- the cleavable linker is pH-sensitive, i.e., sensitive to hydrolysis at certain pH values.
- the pH-sensitive linker is hydrolyzable under acidic conditions.
- an acid-labile linker that is hydrolyzable in the lysosome for example, a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
- an acid-labile linker that is hydrolyzable in the lysosome for example, a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
- the hydrolyzable linker is a thioether linker (such as, for example, a thioether attached to the therapeutic agent via an acylhydrazone bond (see, for example, U.S. Pat. No. 5,622,929).
- the linker is cleavable under reducing conditions (for example, a disulfide linker).
- a disulfide linker for example, a disulfide linker.
- disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3- (2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N- succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene)-, SPDB and SMPT.
- SATA N-succinimidyl-S-acetylthioacetate
- SPDP N-succinimidyl-3- (2-pyri
- the linker is a malonate linker (Johnson et al., 1995, Anticancer Res. 15: 1387-93), a maleimidobenzoyl linker (Lau et al., 1995, Bioorg-Med-Chem. 3(10): 1299-1304), or a 3'-N-amide analog (Lau et al., 1995, Bioorg-Med-Chem. 3(10): 1305-12).
- the linker is not cleavable and the effector molecule or detectable marker is released by antibody degradation. (See U. S. Publication No. 2005/0238649 incorporated by reference herein in its entirety).
- the linker is resistant to cleavage in an extracellular environment. For example, no more than about 20%, no more than about 15%, no more than about 10%, no more than about 5%, no more than about 3%, or no more than about 1 % of the linkers, in a sample of conjugate, are cleaved when the conjugate is present in an extracellular environment (for example, in plasma). Whether or not a linker is resistant to cleavage in an extracellular environment can be determined, for example, by incubating the conjugate containing the linker of interest with plasma for a predetermined time period (for example, 2, 4, 8, 16, or 24 hours) and then quantitating the amount of free effector molecule or detectable marker present in the plasma.
- a predetermined time period for example, 2, 4, 8, 16, or 24 hours
- linkers that can be used in conjugates are described in WO 2004-010957, U.S. Publication No. 2006/0074008, U. S. Publication No. 20050238649, and U.S. Publication No. 2006/0024317, each of which is incorporated by reference herein in its entirety.
- conjugates of a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof, and one or more small molecule toxins such as a calicheamicin, maytansinoids, dolastatins, auristatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are provided.
- small molecule toxins such as a calicheamicin, maytansinoids, dolastatins, auristatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity
- Maytansine compounds suitable for use as maytansinoid toxin moieties are well known in the art, and can be isolated from natural sources according to known methods, produced using genetic engineering techniques (see Yu et al (2002) PNAS 99:7968-7973), or maytansinol and maytansinol analogues prepared synthetically according to known methods.
- Maytansinoids are mitototic inhibitors which act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S.
- Additional toxins can be employed with a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof.
- exemplary toxins include Pseudomonas exotoxin (PE), ricin, abrin, diphtheria toxin and subunits thereof, ribotoxin, ribonuclease, saporin, and calicheamicin, as well as botulinum toxins A through F.
- PE Pseudomonas exotoxin
- ricin ricin
- abrin diphtheria toxin and subunits thereof
- ribotoxin ribonuclease
- saporin and calicheamicin
- botulinum toxins A through F as well known in the art and many are readily available from commercial sources (for example, Sigma Chemical Company, St. Louis, MO).
- Contemplated toxins also include variants of the toxins (see, for example, see, U. S. Patent Nos
- Saporin is a toxin derived from Saponaria officinalis that disrupts protein synthesis by inactivating the 60S portion of the ribosomal complex (Stirpe et al., Bio/Technology, 10:405-412, 1992).
- the toxin has no mechanism for specific entry into cells, and therefore requires conjugation to an antibody or antigen binding fragment that recognizes a cell-surface protein that is internalized in order to be efficiently taken up by cells.
- Diphtheria toxin is isolated from Corynebacterium diphtheriae. Typically, diphtheria toxin for use in immunotoxins is mutated to reduce or to eliminate non-specific toxicity.
- a mutant known as CRM107 which has full enzymatic activity but markedly reduced non-specific toxicity, has been known since the 1970's (Laird and Groman, J. Virol. 19:220, 1976), and has been used in human clinical trials. See, U. S. Patent No. 5,792,458 and U.S. Patent No. 5,208,021.
- Ricin is the lectin RCA60 from Ricinus communis (Castor bean).
- Ricinus communis (Castor bean).
- ricin see, U.S. Patent No. 5,079,163 and U.S. Patent No. 4,689,401.
- Ricinus communis agglutinin (RCA) occurs in two forms designated RCA60 and RCA120 according to their molecular weights of approximately 65 and 120 kD, respectively (Nicholson & Blaustein, J. Biochim. Biophys. Acta 266:543, 1972). The A chain is responsible for inactivating protein synthesis and killing cells.
- the B chain binds ricin to cell-surface galactose residues and facilitates transport of the A chain into the cytosol (Olsnes et al., Nature 249:627-631, 1974 and U.S. Patent No. 3,060,165).
- Ribonucleases have also been conjugated to targeting molecules for use as immunotoxins (see Suzuki et al., Nat. Biotech. 17:265-70, 1999).
- Exemplary ribotoxins such as a-sarcin and restrictocin are discussed in, for example Rathore et al, Gene 190:31-5, 1997; and Goyal and Batra, Biochem. 345 Pt 2:247-54, 2000.
- Calicheamicins were first isolated from Micromonospora echinospora and are members of the enediyne antitumor antibiotic family that cause double strand breaks in DNA that lead to apoptosis (see, for example Lee et al., J. Antibiot. 42: 1070-87,1989). The drug is the toxic moiety of an immuno toxin in clinical trials (see, for example, Gillespie et al., Ann. Oncol. 11 :735-41, 2000).
- Abrin includes toxic lectins from Abrus precatorius.
- the toxic principles, abrin a, b, c, and d have a molecular weight of from about 63 and 67 kD and are composed of two disulfide- linked polypeptide chains A and B.
- the A chain inhibits protein synthesis; the B chain (abrin-b) binds to D-galactose residues (see, Funatsu et al., Agr. Biol. Chem. 52: 1095, 1988; and Olsnes, Methods Enzymol. 50:330-335, 1978).
- a CAR, a T cell expressing a CAR, monoclonal antibodies, antigen binding fragments thereof, specific for one or more of the antigens disclosed herein, can also be conjugated with a detectable marker; for example, a detectable marker capable of detection by ELISA, spectrophotometry, flow cytometry, microscopy or diagnostic imaging techniques (such as computed tomography (CT), computed axial tomography (CAT) scans, magnetic resonance imaging (MRI), nuclear magnetic resonance imaging NMRI), magnetic resonance tomography (MTR), ultrasound, fiberoptic examination, and laparoscopic examination).
- CT computed tomography
- CAT computed axial tomography
- MRI magnetic resonance imaging
- NMRI nuclear magnetic resonance imaging
- MMR magnetic resonance tomography
- detectable markers include fluorophores, chemiluminescent agents, enzymatic linkages, radioactive isotopes and heavy metals or compounds (for example super paramagnetic iron oxide nanocrystals for detection by MRI).
- useful detectable markers include fluorescent compounds, including fluorescein, fluorescein isothiocyanate, rhodamine, 5- dimethylamine-l -napthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors and the like.
- Bioluminescent markers are also of use, such as luciferase, Green fluorescent protein (GFP), Yellow fluorescent protein (YFP).
- a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof can also be conjugated with enzymes that are useful for detection, such as horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like.
- enzymes that are useful for detection such as horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like.
- a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof may also be conjugated with biotin, and detected through indirect measurement of avidin or streptavidin binding. It should be noted that the avidin itself can be conjugated with an enzyme or a fluorescent label.
- a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof may be conjugated with a paramagnetic agent, such as gadolinium. Paramagnetic agents such as superparamagnetic iron oxide are also of use as labels.
- Antibodies can also be conjugated with lanthanides (such as europium and dysprosium), and manganese.
- An antibody or antigen binding fragment may also be labeled with a predetermined polypeptide epitopes recognized by a secondary reporter (such as leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
- a CAR, a T cell expressing a CAR, an antibody, or antigen binding portion thereof, can also be conjugated with a radiolabeled amino acid.
- the radiolabel may be used for both diagnostic and therapeutic purposes. For instance, the radiolabel may be used to detect one or more of the antigens disclosed herein and antigen expressing cells by x-ray, emission spectra, or other diagnostic techniques. Further, the radiolabel may be used therapeutically as a toxin for treatment of tumors in a subject, for example for treatment of a neuroblastoma.
- labels for polypeptides include, but are not limited to, the following radioisotopes or radionucleotides: 3 H, 14 C, 15 N, 35 S, 90 Y, "Tc, m In, 125 I, 131 I.
- radiolabels may be detected using photographic film or scintillation counters
- fluorescent markers may be detected using a photodetector to detect emitted illumination.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
- nucleic acid comprising a nucleotide sequence encoding any of the CARs, an antibody, or antigen binding portion thereof, described herein (including functional portions and functional variants thereof).
- the nucleic acids of the invention may comprise a nucleotide sequence encoding any of the leader sequences, antigen binding domains, transmembrane domains, and/or intracellular T cell signaling domains described herein.
- the nucleotide sequence may be codon-modified. Without being bound to a particular theory, it is believed that codon optimization of the nucleotide sequence increases the translation efficiency of the mRNA transcripts. Codon optimization of the nucleotide sequence may involve substituting a native codon for another codon that encodes the same amino acid, but can be translated by tRNA that is more readily available within a cell, thus increasing translation efficiency. Optimization of the nucleotide sequence may also reduce secondary mRNA structures that would interfere with translation, thus increasing translation efficiency.
- the nucleic acid may comprise a codon-modified nucleotide sequence that encodes the antigen binding domain of the inventive CAR. In another embodiment of the invention, the nucleic acid may comprise a codon-modified nucleotide sequence that encodes any of the CARs described herein (including functional portions and functional variants thereof).
- Nucleic acid as used herein includes “polynucleotide,” “oligonucleotide,” and “nucleic acid molecule,” and generally means a polymer of DNA or RNA, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and which can contain a natural, non-natural or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide.
- the nucleic acid does not comprise any insertions, deletions, inversions, and/or substitutions. However, it may be suitable in some instances, as discussed herein, for the nucleic acid to comprise one or more insertions, deletions, inversions, and/or substitutions.
- a recombinant nucleic acid may be one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques, such as those described in Sambrook et al, supra.
- the nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. See, for example, Sambrook et al., supra, and Ausubel et al., supra.
- a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides).
- modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5- chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxymethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydro uracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1 - methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5- methylcytosine, N6-substituted adenine, 7-methylguanine, 5-methylaminomethyluracil, 5- methoxyaminomethyl-2-thiouracil, beta-D-mannos
- the nucleic acid can comprise any isolated or purified nucleotide sequence which encodes any of the CARs or functional portions or functional variants thereof.
- the nucleotide sequence can comprise a nucleotide sequence which is degenerate to any of the sequences or a combination of degenerate sequences.
- An embodiment also provides an isolated or purified nucleic acid comprising a nucleotide sequence which is complementary to the nucleotide sequence of any of the nucleic acids described herein or a nucleotide sequence which hybridizes under stringent conditions to the nucleotide sequence of any of the nucleic acids described herein.
- the nucleotide sequence which hybridizes under stringent conditions may hybridize under high stringency conditions.
- high stringency conditions is meant that the nucleotide sequence specifically hybridizes to a target sequence (the nucleotide sequence of any of the nucleic acids described herein) in an amount that is detectably stronger than non-specific hybridization.
- High stringency conditions include conditions which would distinguish a polynucleotide with an exact complementary sequence, or one containing only a few scattered mismatches from a random sequence that happened to have a few small regions (e.g., 3-10 bases) that matched the nucleotide sequence.
- Relatively high stringency conditions would include, for example, low salt and/or high temperature conditions, such as provided by about 0.02-0.1 M NaCl or the equivalent, at temperatures of about 50-70 °C.
- Such high stringency conditions tolerate little, if any, mismatch between the nucleotide sequence and the template or target strand, and are particularly suitable for detecting expression of any of the inventive CARs. It is generally appreciated that conditions can be rendered more stringent by the addition of increasing amounts of formamide.
- nucleic acid comprising a nucleotide sequence that is at least about 70% or more, e.g., about 80%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to any of the nucleic acids described herein.
- the nucleic acids can be incorporated into a recombinant expression vector.
- an embodiment provides recombinant expression vectors comprising any of the nucleic acids.
- the term "recombinant expression vector” means a genetically-modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell.
- the vectors are not naturally-occurring as a whole.
- the recombinant expression vectors can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double- stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides.
- the recombinant expression vectors can comprise naturally-occurring or non-naturally-occurring intemucleotide linkages, or both types of linkages.
- the non-naturally occurring or altered nucleotides or intemucleotide linkages do not hinder the transcription or replication of the vector.
- the recombinant expression vector can be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host cell.
- Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses.
- the vector can be selected from the group consisting of the pUC series (Fermentas Life Sciences, Glen Burnie, MD), the pBluescript series (Stratagene, LaJolla, CA), the pET series (Novagen, Madison, WI), the pGEX series (Pharmacia Biotech, Uppsala, Sweden), and the pEX series (Clontech, Palo Alto, CA).
- Bacteriophage vectors such as ⁇ , ⁇ 1 , ZapII (Stratagene), EMBL4, and ⁇ 149, also can be used.
- plant expression vectors include pBIOl, pBI101.2, pBHOl .3, pBI121 and pBIN19 (Clontech).
- animal expression vectors include pEUK-Cl, pMAM, and pMAMneo (Clontech).
- the recombinant expression vector may be a viral vector, e.g., a retroviral vector or a lentiviral vector.
- a lenti viral vector is a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
- Other examples of lentivirus vectors that may be used in the clinic include, for example, and not by way of limitation, the LENTIVECTOR.RTM. gene delivery technology from Oxford BioMedica pic, the LENTIMAX.TM. vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
- Transfection methods include calcium phosphate co-precipitation (see, e.g., Graham et al., supra), direct micro injection into cultured cells (see, e.g., Capecchi, Cell, 22: 479-488 (1980)), electroporation (see, e.g., Shigekawa et al., BioTechniques, 6: 742-751 (1988)), liposome mediated gene transfer (see, e.g., Mannino et al., BioTechniques, 6: 682-690 (1988)), lipid mediated transduction (see, e.g., Feigner et al., Proc. Natl. Acad. Sci. USA, 84: 7413-7417 (1987)), and nucleic acid delivery using high velocity microprojectiles (see, e.g., Klein et al, Nature, 327: 70-73 (1987)).
- the recombinant expression vectors can be prepared using standard recombinant DNA techniques described in, for example, Sambrook et al., supra, and Ausubel et al., supra.
- Constructs of expression vectors, which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell.
- Replication systems can be derived, e.g., from ColEl, 2 ⁇ plasmid, ⁇ , SV40, bovine papilloma virus, and the like.
- the recombinant expression vector may comprise regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host cell (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate, and taking into consideration whether the vector is DNA- or RNA-based.
- the recombinant expression vector may comprise restriction sites to facilitate cloning.
- the recombinant expression vector can include one or more marker genes, which allow for selection of transformed or transfected host cells.
- Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like.
- Suitable marker genes for the inventive expression vectors include, for instance, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes.
- the recombinant expression vector can comprise a native or nonnative promoter operably linked to the nucleotide sequence encoding the CAR (including functional portions and functional variants thereof), or to the nucleotide sequence which is complementary to or which hybridizes to the nucleotide sequence encoding the CAR.
- the selection of promoters e.g., strong, weak, inducible, tissue-specific and developmental-specific, is within the ordinary skill of the artisan.
- the combining of a nucleotide sequence with a promoter is also within the skill of the artisan.
- the promoter can be a non-viral promoter or a viral promoter, e.g., a cytomegalovirus (CMV) promoter, an SV40 promoter, an RSV promoter, or a promoter found in the long-terminal repeat of the murine stem cell virus.
- CMV cytomegalovirus
- the recombinant expression vectors can be designed for either transient expression, for stable expression, or for both. Also, the recombinant expression vectors can be made for constitutive expression or for inducible expression.
- the recombinant expression vectors can be made to include a suicide gene.
- suicide gene refers to a gene that causes the cell expressing the suicide gene to die.
- the suicide gene can be a gene that confers sensitivity to an agent, e.g., a drug, upon the cell in which the gene is expressed, and causes the cell to die when the cell is contacted with or exposed to the agent.
- agent e.g., a drug
- HSV Herpes Simplex Virus
- TK thymidine kinase
- An embodiment further provides a host cell comprising any of the recombinant expression vectors described herein.
- the term "host cell” refers to any type of cell that can contain the inventive recombinant expression vector.
- the host cell can be a eukaryotic cell, e.g., plant, animal, fungi, or algae, or can be a prokaryotic cell, e.g., bacteria or protozoa.
- the host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human.
- the host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension.
- Suitable host cells are known in the art and include, for instance, DH5a E. coli cells, Chinese hamster ovarian cells, monkey VERO cells, COS cells, HEK293 cells, and the like.
- the host cell may be a prokaryotic cell, e.g., a DH5a cell.
- the host cell may be a mammalian cell.
- the host cell may be a human cell.
- the host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage, the host cell may be a peripheral blood lymphocyte (PBL) or a peripheral blood mononuclear cell (PBMC).
- PBL peripheral blood lymphocyte
- PBMC peripheral blood mononuclear cell
- the host cell may be a T cell.
- the T cell can be any T cell, such as a cultured T cell, e.g., a primary T cell, or a T cell from a cultured T cell line, e.g., Jurkat, SupTl, etc., or a T cell obtained from a mammal. If obtained from a mammal, the T cell can be obtained from numerous sources, including but not limited to blood, bone marrow, lymph node, the thymus, or other tissues or fluids. T cells can also be enriched for or purified.
- the T cell may be a human T cell.
- the T cell may be a T cell isolated from a human.
- the T cell can be any type of T cell and can be of any developmental stage, including but not limited to, CD4+/CD8+ double positive T cells, CD4+ helper T cells, e.g., Thl and Th2 cells, CD8+ T cells (e.g., cytotoxic T cells), tumor infiltrating cells, memory T cells, memory stem cells, i.e. Tscm, naive T cells, and the like.
- the T cell may be a CD 8+ T cell or a CD4+ T cell.
- the CARs as described herein can be used in suitable non-T cells.
- suitable non-T cells are those with an immune-effector function, such as, for example, NK cells, and T-like cells generated from pluripotent stem cells.
- the population of cells can be a heterogeneous population comprising the host cell comprising any of the recombinant expression vectors described, in addition to at least one other cell, e.g., a host cell (e.g., a T cell), which does not comprise any of the recombinant expression vectors, or a cell other than a T cell, e.g., a B cell, a macrophage, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cell, a muscle cell, a brain cell, etc.
- a host cell e.g., a T cell
- a cell other than a T cell e.g., a B cell, a macrophage, a neutrophil, an erythrocyte, a hepatocyte, an endothelial cell, an epithelial cell, a muscle cell, a brain cell, etc.
- the population of cells can be a substantially homogeneous population, in which the population comprises mainly host cells (e.g., consisting essentially of) comprising the recombinant expression vector.
- the population also can be a clonal population of cells, in which all cells of the population are clones of a single host cell comprising a recombinant expression vector, such that all cells of the population comprise the recombinant expression vector.
- the population of cells is a clonal population comprising host cells comprising a recombinant expression vector as described herein.
- CARs including functional portions and variants thereof
- nucleic acids can be isolated and/or purified.
- a purified (or isolated) host cell preparation is one in which the host cell is more pure than cells in their natural environment within the body. Such host cells may be produced, for example, by standard purification techniques.
- a preparation of a host cell is purified such that the host cell represents at least about 50%, for example at least about 70%, of the total cell content of the preparation.
- the purity can be at least about 50%, can be greater than about 60%, about 70% or about 80%, or can be about 100%.
- an embodiment provides a method of treating or preventing cancer in a mammal, comprising administering to the mammal the CARs, the nucleic acids, the recombinant expression vectors, the host cells, the population of cells, the antibodies and/or the antigen binding portions thereof, and/or the pharmaceutical compositions in an amount effective to treat or prevent cancer in the mammal.
- An embodiment further comprises lymphodepleting the mammal prior to administering the CARs disclosed herein.
- lymphodepletion include, but may not be limited to, nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, total body irradiation, etc.
- the cells can be cells that are allogeneic or autologous to the mammal.
- the cells are autologous to the mammal.
- allogeneic means any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.
- autologous means any material derived from the same individual to whom it is later to be re-introduced into the individual.
- the mammal referred to herein can be any mammal.
- the term "mammal” refers to any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, and mammals of the order Logomorpha, such as rabbits.
- the mammals may be from the order Carnivora, including Felines (cats) and Canines (dogs).
- the mammals may be from the order Artiodactyla, including Bovines (cows) and Swines (pigs) or of the order Perssodactyla, including Equines (horses).
- the mammals may be of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes).
- the mammal is a human.
- the cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bladder cancer (e.g., bladder carcinoma), bone cancer, brain cancer (e.g., meduUoblastoma), breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, head and neck cancer (e.g., head and neck squamous cell carcinoma), Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, leukemia,
- bladder cancer
- the treatment or prevention provided by the method can include treatment or prevention of one or more conditions or symptoms of the disease, e.g., cancer, being treated or prevented.
- prevention can encompass delaying the onset of the disease, or a symptom or condition thereof.
- Another embodiment provides a method of detecting the presence of cancer in a mammal, comprising: (a) contacting a sample comprising one or more cells from the mammal with the CARs, the nucleic acids, the recombinant expression vectors, the host cells, the population of cells, the antibodies, and/or the antigen binding portions thereof, or the pharmaceutical compositions, thereby forming a complex, (b) and detecting the complex, wherein detection of the complex is indicative of the presence of cancer in the mammal.
- the sample may be obtained by any suitable method, e.g., biopsy or necropsy.
- a biopsy is the removal of tissue and/or cells from an individual. Such removal may be to collect tissue and/or cells from the individual in order to perform experimentation on the removed tissue and/or cells. This experimentation may include experiments to determine if the individual has and/or is suffering from a certain condition or disease-state.
- the condition or disease may be, e.g., cancer.
- the sample comprising cells of the mammal can be a sample comprising whole cells, lysates thereof, or a fraction of the whole cell lysates, e.g., a nuclear or cytoplasmic fraction, a whole protein fraction, or a nucleic acid fraction.
- the cells can be any cells of the mammal, e.g., the cells of any organ or tissue, including blood cells or endothelial cells.
- the contacting can take place in vitro or in vivo with respect to the mammal.
- the contacting is in vitro.
- the CARs disclosed herein, polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, populations of cells, or antibodies, or antigen binding portions thereof, described herein can be labeled with a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles) as disclosed supra.
- a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles) as disclosed supra
- cytokines e.g., interferon- ⁇ , granulocyte/monocyte colony stimulating factor (GM-CSF), tumor necrosis factor a (TNF-a) or interleukin 2 (IL-2)
- cytokines e.g., interferon- ⁇ , granulocyte/monocyte colony stimulating factor (GM-CSF), tumor necrosis factor a (TNF-a) or interleukin 2 (IL-2)
- GM-CSF granulocyte/monocyte colony stimulating factor
- TNF-a tumor necrosis factor a
- IL-2 interleukin 2
- Another embodiment provides for the use of the CARs, nucleic acids, recombinant expression vectors, host cells, populations of cells, antibodies, or antigen binding portions thereof, and/or pharmaceutical compositions of the invention, for the treatment or prevention of a proliferative disorder, e.g., cancer, in a mammal.
- a proliferative disorder e.g., cancer
- the cancer may be any of the cancers described herein.
- any method of administration can be used for the disclosed therapeutic agents, including local and systemic administration.
- topical, oral, intravascular such as intravenous, intramuscular, intraperitoneal, intranasal, intradermal, intrathecal and subcutaneous administration can be used.
- the particular mode of administration and the dosage regimen will be selected by the attending clinician, taking into account the particulars of the case (for example the subject, the disease, the disease state involved, and whether the treatment is prophylactic).
- one or more routes of administration may be used; for example, a chemotherapeutic agent may be administered orally and an antibody or antigen binding fragment or conjugate or composition may be administered intravenously.
- Methods of administration include injection for which the CAR, CAR T Cell, conjugates, antibodies, antigen binding fragments, or compositions are provided in a nontoxic pharmaceutically acceptable carrier such as water, saline, Ringer's solution, dextrose solution, 5% human serum albumin, fixed oils, ethyl oleate, or liposomes.
- a nontoxic pharmaceutically acceptable carrier such as water, saline, Ringer's solution, dextrose solution, 5% human serum albumin, fixed oils, ethyl oleate, or liposomes.
- local administration of the disclosed compounds can be used, for instance by applying the antibody or antigen binding fragment to a region of tissue from which a tumor has been removed, or a region suspected of being prone to tumor development.
- sustained intra-tumoral (or near-tumoral) release of the pharmaceutical preparation that includes a therapeutically effective amount of the antibody or antigen binding fragment may be beneficial.
- the conjugate is applied as an eye drop topically to the cornea
- the disclosed therapeutic agents can be formulated in unit dosage form suitable for individual administration of precise dosages.
- the disclosed therapeutic agents may be administered in a single dose or in a multiple dose schedule.
- a multiple dose schedule is one in which a primary course of treatment may be with more than one separate dose, for instance 1 -10 doses, followed by other doses given at subsequent time intervals as needed to maintain or reinforce the action of the compositions.
- Treatment can involve daily or multi-daily doses of compound(s) over a period of a few days to months, or even years.
- the dosage regime will also, at least in part, be determined based on the particular needs of the subject to be treated and will be dependent upon the judgment of the administering practitioner.
- Typical dosages of the antibodies or conjugates can range from about 0.01 to about 30 mg/kg, such as from about 0.1 to about 10 mg/kg.
- the subject is administered a therapeutic composition that includes one or more of the conjugates, antibodies, compositions, CARs, CAR T cells or additional agents, on a multiple daily dosing schedule, such as at least two consecutive days, 10 consecutive days, and so forth, for example for a period of weeks, months, or years.
- the subject is administered the conjugates, antibodies, compositions or additional agents for a period of at least 30 days, such as at least 2 months, at least 4 months, at least 6 months, at least 12 months, at least 24 months, or at least 36 months.
- the disclosed methods include providing surgery, radiation therapy, and/or chemotherapeutics to the subject in combination with a disclosed antibody, antigen binding fragment, conjugate, CAR or T cell expressing a CAR (for example, sequentially, substantially simultaneously, or simultaneously).
- chemotherapeutics for example, sequentially, substantially simultaneously, or simultaneously.
- Methods and therapeutic dosages of such agents and treatments are known to those skilled in the art, and can be determined by a skilled clinician.
- Preparation and dosing schedules for the additional agent may be used according to manufacturer's instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service, (1992) Ed., M. C. Perry, Williams & Wilkins, Baltimore, Md.
- the combination therapy can include administration of a therapeutically effective amount of an additional cancer inhibitor to a subject.
- additional therapeutic agents that can be used with the combination therapy include microtubule binding agents, DNA intercalators or cross-linkers, DNA synthesis inhibitors, DNA and RNA transcription inhibitors, antibodies, enzymes, enzyme inhibitors, gene regulators, and angiogenesis inhibitors. These agents (which are administered at a therapeutically effective amount) and treatments can be used alone or in combination.
- any suitable anticancer or anti-angiogenic agent can be administered in combination with the CARS, CAR- T cells, antibodies, antigen binding fragment, or conjugates disclosed herein. Methods and therapeutic dosages of such agents are known to those skilled in the art, and can be determined by a skilled clinician.
- Additional chemotherapeutic agents include, but are not limited to alkylating agents, such as nitrogen mustards (for example, chlorambucil, chlormethine, cyclophosphamide, ifosfamide, and melphalan), nitrosoureas (for example, carmustine, fotemustine, lomustine, and streptozocin), platinum compounds (for example, carboplatin, cisplatin, oxaliplatin, and BBR3464), busulfan, dacarbazine, mechlorethamine, procarbazine, temozolomide, thiotepa, and uramustine; antimetabolites, such as folic acid (for example, methotrexate, pemetrexed, and raltitrexed), purine (for example, cladribine, clofarabine, fludarabine, mercaptopurine, and tioguanine), pyrimidine (for example, capecitabine),
- the combination therapy may provide synergy and prove synergistic, that is, the effect achieved when the active ingredients used together is greater than the sum of the effects that results from using the compounds separately.
- a synergistic effect may be attained when the active ingredients are: (1) co-formulated and administered or delivered simultaneously in a combined, unit dosage formulation; (2) delivered by alternation or in parallel as separate formulations; or (3) by some other regimen.
- a synergistic effect may be attained when the compounds are administered or delivered sequentially, for example by different injections in separate syringes.
- an effective dosage of each active ingredient is administered sequentially, i.e. serially
- combination therapy effective dosages of two or more active ingredients are administered together.
- an effective amount of an antibody or antigen binding fragment that specifically binds to one or more of the antigens disclosed herein or a conjugate thereof is administered to a subject having a tumor following anti-cancer treatment. After a sufficient amount of time has elapsed to allow for the administered antibody or antigen binding fragment or conjugate to form an immune complex with the antigen expressed on the respective cancer cell, the immune complex is detected. The presence (or absence) of the immune complex indicates the effectiveness of the treatment. For example, an increase in the immune complex compared to a control taken prior to the treatment indicates that the treatment is not effective, whereas a decrease in the immune complex compared to a control taken prior to the treatment indicates that the treatment is effective.
- compositions are provided herein for use in gene therapy, immunotherapy and/or cell therapy that include one or more of the disclosed CARs, or T cells expressing a CAR, antibodies, antigen binding fragments, conjugates, CARs, or T cells expressing a CAR that specifically bind to one or more antigens disclosed herein, in a carrier (such as a pharmaceutically acceptable carrier).
- a carrier such as a pharmaceutically acceptable carrier.
- the compositions can be prepared in unit dosage forms for administration to a subject. The amount and timing of administration are at the discretion of the treating clinician to achieve the desired outcome.
- the compositions can be formulated for systemic (such as intravenous) or local (such as intra-tumor) administration.
- a disclosed CARs, or T cells expressing a CAR, antibody, antigen binding fragment, conjugate is formulated for parenteral administration, such as intravenous administration.
- Compositions including a CAR, or T cell expressing a CAR, a conjugate, antibody or antigen binding fragment as disclosed herein are of use, for example, for the treatment and detection of a tumor, for example, and not by way of limitation, a neuroblastoma.
- the compositions are useful for the treatment or detection of a carcinoma.
- the compositions including a CAR, or T cell expressing a CAR, a conjugate, antibody or antigen binding fragment as disclosed herein are also of use, for example, for the detection of pathological angiogenesis.
- compositions for administration can include a solution of the CAR, or T cell expressing a CAR, conjugate, antibody or antigen binding fragment dissolved in a pharmaceutically acceptable carrier, such as an aqueous carrier.
- a pharmaceutically acceptable carrier such as an aqueous carrier.
- aqueous carriers can be used, for example, buffered saline and the like. These solutions are sterile and generally free of undesirable matter.
- These compositions may be sterilized by conventional, well known sterilization techniques.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents, adjuvant agents, and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
- concentration of a CAR, or T cell expressing a CAR, antibody or antigen binding fragment or conjugate in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the subject's needs. Actual methods of preparing such dosage forms for use in in gene therapy, immunotherapy and/or cell therapy are known, or will be apparent, to those skilled in the art.
- a typical composition for intravenous administration includes about 0.01 to about 30 mg/kg of antibody or antigen binding fragment or conjugate per subject per day (or the corresponding dose of a CAR, or T cell expressing a CAR, conjugate including the antibody or antigen binding fragment).
- Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 19th ed., Mack Publishing Company, Easton, PA (1995).
- a CAR, or T cell expressing a CAR, antibodies, antigen binding fragments, or conjugates may be provided in lyophilized form and rehydrated with sterile water before administration, although they are also provided in sterile solutions of known concentration.
- the CARs, or T cells expressing a CAR, antibody or antigen binding fragment or conjugate solution is then added to an infusion bag containing 0.9% sodium chloride, USP, and in some cases administered at a dosage of from 0.5 to 15 mg/kg of body weight.
- a CAR, or T cell expressing a CAR, antibodies, antigen binding fragments and conjugates thereof can be administered by slow infusion, rather than in an intravenous push or bolus.
- a higher loading dose is administered, with subsequent, maintenance doses being administered at a lower level.
- an initial loading dose of 4 mg/kg antibody or antigen binding fragment (or the corresponding dose of a conjugate including the antibody or antigen binding fragment) may be infused over a period of some 90 minutes, followed by weekly maintenance doses for 4-8 weeks of 2 mg/kg infused over a 30 minute period if the previous dose was well tolerated.
- Controlled release parenteral formulations can be made as implants, oily injections, or as particulate systems.
- Particulate systems include microspheres, microp articles, microcapsules, nanocapsules, nanospheres, and nanop articles.
- Microcapsules contain the therapeutic protein, such as a cytotoxin or a drug, as a central core. In microspheres, the therapeutic is dispersed throughout the particle.
- Particles, microspheres, and microcapsules smaller than about 1 ⁇ are generally referred to as nanoparticles, nanospheres, and nanocapsules, respectively.
- Capillaries have a diameter of approximately 5 ⁇ so that only nanoparticles are administered intravenously.
- Microparticles are typically around 100 ⁇ in diameter and are administered subcutaneously or intramuscularly. See, for example, Kreuter, J., Colloidal Drug Delivery Systems, J. Kreuter, ed., Marcel Dekker, Inc., New York, NY, pp. 219- 342 (1994); and Tice & Tabibi, Treatise on Controlled Drug Delivery, A. Kydonieus, ed., Marcel Dekker, Inc. New York, NY, pp. 315-339, (1992).
- Polymers can be used for ion-controlled release of the CARs, or T cells expressing a CAR, antibody or antigen binding fragment or conjugate compositions disclosed herein.
- Various degradable and nondegradable polymeric matrices for use in controlled drug delivery are known in the art (Langer, Accounts Chem. Res. 26:537-542, 1993).
- the block copolymer, polaxamer 407 exists as a viscous yet mobile liquid at low temperatures but forms a semisolid gel at body temperature. It has been shown to be an effective vehicle for formulation and sustained delivery of recombinant interleukin-2 and urease (Johnston et al, Pharm. Res.
- hydroxyapatite has been used as a microcarrier for controlled release of proteins (Ijntema et al., Int. J. Pharm.112:215-224, 1994).
- liposomes are used for controlled release as well as drug targeting of the lipid-capsulated drug (Betageri et al, Liposome Drug Delivery Systems, Technomic Publishing Co., Inc., Lancaster, PA (1993)). Numerous additional systems for controlled delivery of therapeutic proteins are known (see U.S. Patent No. 5,055,303; U.S. Patent No. 5,188,837; U.S. Patent No.
- kits employing the CARs disclosed herein are also provided.
- kits for treating a tumor in a subject, or making a CAR T cell that expresses one or more of the CARs disclosed herein will typically include a disclosed antibody, antigen binding fragment, conjugate, nucleic acid molecule, CAR or T cell expressing a CAR as disclosed herein. More than one of the disclosed antibodies, antigen binding fragments, conjugates, nucleic acid molecules, CARs or T cells expressing a CAR can be included in the kit.
- the kit can include a container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container typically holds a composition including one or more of the disclosed antibodies, antigen binding fragments, conjugates, nucleic acid molecules, CARs or T cells expressing a CAR.
- the container may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- a label or package insert indicates that the composition is used for treating the particular condition.
- the label or package insert typically will further include instructions for use of a disclosed antibodies, antigen binding fragments, conjugates, nucleic acid molecules, CARs or T cells expressing a CAR, for example, in a method of treating or preventing a tumor or of making a CAR T cell.
- the package insert typically includes instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products.
- the instructional materials may be written, in an electronic form (such as a computer diskette or compact disk) or may be visual (such as video files).
- the kits may also include additional components to facilitate the particular application for which the kit is designed.
- the kit may additionally contain means of detecting a label (such as enzyme substrates for enzymatic labels, filter sets to detect fluorescent labels, appropriate secondary labels such as a secondary antibody, or the like).
- the kits may additionally include buffers and other reagents routinely used for the practice of a particular method. Such kits and appropriate contents are well known to those of skill in the art.
- a naive human ScFv (recombinant single chain fragment variable of immunoglobulin) phage display library (approximate diversity, 10 10 unique specificities), constructed from peripheral blood B cells of 50 healthy donors (Z. Y. Zhu and D. S. Dimitrov, unpublished data), were used for selection of ScFvs for recombinant human RORl protein.
- Amplified libraries of 10 12 phage-displayed ScFv were incubated with 5, 3, and 1, ⁇ g of coated RORl in a 5 ⁇ 100- ⁇ 1 volume, distributed equally in 5 wells of a 96-well plate for 2 h at room temperature during the first, second and third rounds of biopanning, respectively.
- the wells were washed 5 times for the first round and 10 times for the later rounds with phosphate- buffered saline containing 0.05% Tween 20 (PBST) to remove nonspecifically bound phage, the bound phage were mixed with TGI competent cells for 1 hour at 37°C, and the phage was amplified from the infected cells and used in the next round of biopanning.
- PBST phosphate- buffered saline containing 0.05% Tween 20
- the bound phage were mixed with TGI competent cells for 1 hour at 37°C, and the phage was amplified from the infected cells and used in the next round of biopanning.
- 380 clones were randomly picked from the infected TGI cells and each inoculated into 150 ⁇ 2YT medium containing 100 ⁇ g/ml carbenicillin and 0.2% glucose in 96-well plates.
- helper phage M13K07 at a multiplicity of infection (MOI) of 10 and kanamycin at 50 ⁇ g/ml (final concentration) were added to the medium, and the plates were further incubated at 30°C overnight in a shaker at 250 rpm.
- the phage supernatants were mixed with 3% nonfat milk in PBS at a 4: 1 volume ratio and used for enzyme-linked immunosorbent assay (ELISA) to identify clones of phage displaying ScFvs with high RORl binding affinity.
- ELISA enzyme-linked immunosorbent assay
- VH and VL of the selected clones were DNA sequenced, and the ScFvs encoded by clones with unique sequences were expressed and purified as described below. Plasmids extracted from these clones were used for transformation of HB2151 cells. A single colony was picked from the plate containing freshly transformed cells, inoculated into 200 ml 2YT medium containing 100 ⁇ g/ml ampicillin and 0.2% glucose, and incubated at 37°C with shaking at 250 rpm. When the culture OD at 600 nm reached 0.90, isopropyl- -d-thiogalactopyranoside at a 0.5 mM final concentration was added, and the culture was further incubated overnight at 30°C.
- the bacterial pellet was collected after centrifugation at 8,000 ⁇ g for 20 min and resuspended in PBS buffer containing 0.5 mU polymixin B (Sigma-Aldrich, St. Louis, MO). After 30 min incubation with rotation at 50 rpm at room temperature, the resuspended pellet was centrifuged at 25,000 ⁇ g for 25 min at 4°C, and the supernatant was used for ScFv purification using the Ni-NTA resin following vendor protocol (Qiagen). c) ELISA binding assay
- Homo sapiens RORl receptor tyrosine kinas-like orphan receptor 1
- CLL chronic lymphocytic leukemia
- various solid tumors such as subsets of sarcoma, carcinomas, or adenocarcinoma of the lung.
- a phase one study of anti-RORl antibody UC-961 (Cirtuzumab) for relapsed or refractory chronic lymphocytic leukemia is currently active (Sponsor, Thomas Kipps, NCT02222688). Results for this first-in-class study are pending.
- novel anti-RORl CAR-T constructs described here have high levels of cell surface expression in primary human T cells and specific and potent cytotoxic and cytokine functions against RORl -positive tumor cells.
- RORl CARs were designed using RORl binding sequences derived from ScFv candidates identified by phage display, as in Example 1, and for characterization were cloned into lentiviral expression vectors that contained selected structural and signaling domains under the control of the EFla promoter and tested in vitro for transduction efficiency, killing function and cytokine production in both model cell lines and primary human T cells. Table 1 summarizes the nomenclature used.
- CAR Construct LTG1943 is the relevant comparator, as this sequence has been proposed for clinical use (See KTE-C19, Kite Pharma, and CTL019, Novartis).
- the acute lymphocytic leukemia cell line REH and the mantle cell lymphoma line Jeko-1 were cultured in RPMI-1640 medium supplemented with 10% heat-inactivated fetal bovine serum (FBS, Hyclone, Logan, UT) and 2mM L-Glutamax (Thermo Fisher Scientific, Grand Island, NY).
- ROR1 CAR constructs were generated by linking each scFv in frame to either CD8 hinge and transmembrane domains (aa 141182-191, UniProt ID P01732), or IgG4 hinge domain (aa 99- 110, UniProt sequence ID P01861), followed by CD8 transmembrane domain (aa 183-203, UniProt sequence ID P01732), 4-1BB (CD137, aa 214-255, UniProt sequence ID Q07011) transactivation domain and CD3 zeta signaling domain (CD247, aa 52-163, Ref sequence ID: NP_000725.1.).
- CD8 hinge and transmembrane domains aa 141182-191, UniProt ID P01732
- IgG4 hinge domain a 99- 110, UniProt sequence ID P01861
- CD8 transmembrane domain aa 183-203, UniProt sequence ID P01732
- 4-1BB CD137, aa 214-
- CAR constructs were codon optimized and cloned into a third generation lentiviral plasmid backbone (Lentigen Technology Inc., Gaithersburg, MD).
- T cells Human primary T cells from healthy volunteers were purified from whole blood or buffy coats (purchased from commercial provider with donor's written consent) using immuno magnetic bead selection of CD4 + and CD8 + cells according to manufacturer's protocol (Miltenyi Biotec, Bergisch Gladbach, Germany). T cells were cultivated in TexMACS medium supplemented with 200 IU/ml IL-2 at a density of 0.3 to 2 x 10 6 cells/ml, activated with CD3/CD28 MACS® GMP T Cell TransAct reagent (Miltenyi Biotec) and transduced on day 2 with lentiviral vectors encoding CAR constructs in the presence of 10 ug/ml protamine sulfate (Sigma- Aldrich, St. Louis, MO) overnight, and media exchanged on day 3. Cultures were propagated in TexMACS medium supplemented with 200 IU/ml IL-2 until harvest on day 8-12.
- CTL assay To determine cell-mediated cytotoxicity (CTL assay), 5,000 target cells stably transduced with firefly luciferase were combined with CAR T cells at various effector to target ratios (E:T) and incubated overnight. SteadyGlo reagent (Promega, Madison WI) was added to each well and the resulting luminescence was analyzed on an EnSpire plate reader (Perkin Elmer, Shelton, Connecticut) and recorded as counts per second (sample CPS). Target only wells (max CPS) and target only wells plus 1 % Tween-20 (min CPS) were used to determine assay range.
- CTL assay To determine cell-mediated cytotoxicity (CTL assay), 5,000 target cells stably transduced with firefly luciferase were combined with CAR T cells at various effector to target ratios (E:T) and incubated overnight. SteadyGlo reagent (Promega, Madison WI) was added to each well and
- Percent specific lysis was calculated as: (l-(sample CPS-min CPS)/(max CPS-min CPS)). Cytokine release assay was performed on supematants harvested post co incubation of effector and tumor cell lines at E:T ratio of 10. Cytokines IFNg, than and IL-2 were measured by ELISA in triplicates (Thermo Fischer, Waltham, MA).
- CAR T transduced cells were harvested from culture, washed two times in cold AutoMACS buffer supplemented with 0.5% bovine serum albumin (Miltenyi Biotec), and CAR surface expression detected by staining with ROR1 -Fc peptide (R&D, Minneapolis, MN) followed by anti Fc-AF647 conjugate (Jackson ImmunoResearch, West Grove, PA).
- ROR1 -Fc peptide R&D, Minneapolis, MN
- anti Fc-AF647 conjugate Jackson ImmunoResearch, West Grove, PA
- Non-transduced cells were used as negative controls. Dead cells in all studies were excluded by 7AAD staining (BD Biosciences, San Jose, CA). Cells were washed twice and resuspended in 200 ul Staining Buffer before quantitative analysis by flow cytometry. Flow cytometric analysis was performed on a MACSQuant®10 Analyzer (Miltenyi Biotec), and data plots were generated using FlowJo
- Fully human CAR T constructs targeting the ROR1 tumor antigen were designed by combining in frame the sequences of leader peptide derived from GMCSFR, anti-human ROR1 ScFv, CD8 or IgG4 hinge, CD8 transmembrane domain, 4-1BB costimulatiory domain and CD3z activation domain.
- Schematic diagram of the CAR T constructs and list of constructs designed and respective ScFv targeting domains is provided ( Figure 1 and Table 1).
- Untransduced T cells grown under the same conditions (UTD) were included as controls.
- CAR T cells were combined with RORl + mantle cell lymphoma Jeko-1, RORl + epidermoid carcinoma A431, or RORl " Reh leukemia cells at E:T ratios of 40: 1, 20:1, or 10:1 to assess CAR T cytotoxic function ( Figure 3).
- CAR construct LTG1942 The greatest cytotoxicity against RORl + tumor lines (80% at E:T ratio of 40:1 in Jeko-1 RORl + cells), was demonstrated by CAR construct LTG1942, which was comparable in magnitude of tumor killing to control CAR construct LTG1943, based on R12 anti RORl scFv (ref. 9).
- CAR construct, LTG1941 was also cytotoxic to RORl + tumor lines, but to a lesser degree, and achieved maximal specific lysis of 40% for Jeko-1 cells at E:T ratio of 40:1.
- A431 line which is less sensitive to CART-mediate lysis, CAR LTG1941 was ineffective, however CAR LTG1942 was equally or more effective than the positive control CAR LTG1943.
- TNF-alpha, IFN-gamma and IL-2 were strongly induced by CAR T cell construct LTG1942 and the positive control LTG1493, and to a lesser degree by CARLTG1491 when challenged with RORl + Jeko-1, or A431 lines, but not to RORl " Reh control line. No cytokines induction was seen in the negative control GFP or UTD groups. Notably, LTG1941 cytokine production levels were quite low indicating a differential ability to activity T cell expressing this vector. This corresponded to the lower level of cytolysis against the Jeko cell line, but not A431 , when comparing LTG1941 to LTG1942.
- CAR LTG 1942 and LTG1941 demonstrated functional specificity manifested as tumor lytic activity and elaboration of cytokines in response to RORl + tumors.
- the constructs described in this application are thus promising candidates for clinical applications.
- nucleic and amino acid sequences listed below are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. In the accompanying sequence listing:
- SEQ ID NO: 25 Amino Acid Sequence of amino acid numbers 137 TO 206 hinge and transmembrane region of CD8.alpha. (NCBI REFSEQ: NP.SUB.--001759.3) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYC
- SEQ ID NO: 28 Nucleotide Sequence of intracellular signaling domain of CD3-zeta
- SEQ ID NO: 30 Nucleotide Sequence of intracellular signaling domain of CD3-zeta, variant
- SEQ ID NO: 37 Amino Acid sequence of anti-mesothelin ScFV (LTG1904)
- SEQ ID NO: 40 Nucleotide Sequence of hinge domain of IgG4H linked to CD8 TM (transmembrane)
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2018360031A AU2018360031B2 (en) | 2017-11-03 | 2018-11-02 | Compositions and methods for treating cancer with anti-ROR1 immunotherapy |
| CA3081719A CA3081719A1 (en) | 2017-11-03 | 2018-11-02 | Compositions and methods for treating cancer with anti-ror1 immunotherapy |
| EP18871951.2A EP3703711A4 (en) | 2017-11-03 | 2018-11-02 | COMPOSITIONS AND METHODS FOR THE TREATMENT OF CANCER WITH ANTI-MMR1 IMMUNOTHERAPY |
| CN202311592044.3A CN117756946A (zh) | 2017-11-03 | 2018-11-02 | 用于用抗ror1免疫治疗来治疗癌症的组合物和方法 |
| CN201880078376.0A CN111741757B (zh) | 2017-11-03 | 2018-11-02 | 用于用抗ror1免疫治疗来治疗癌症的组合物和方法 |
| JP2020524450A JP7448903B2 (ja) | 2017-11-03 | 2018-11-02 | 抗ror1免疫療法によってがんを処置するための組成物および方法 |
| JP2023179537A JP7695319B2 (ja) | 2017-11-03 | 2023-10-18 | 抗ror1免疫療法によってがんを処置するための組成物および方法 |
| JP2025094057A JP2025131746A (ja) | 2017-11-03 | 2025-06-05 | 抗ror1免疫療法によってがんを処置するための組成物および方法 |
| AU2025271065A AU2025271065A1 (en) | 2017-11-03 | 2025-11-20 | Compositions and methods for treating cancer with anti-ROR1 immunotherapy |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762581284P | 2017-11-03 | 2017-11-03 | |
| US62/581,284 | 2017-11-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019090110A1 true WO2019090110A1 (en) | 2019-05-09 |
Family
ID=65361022
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/059003 Ceased WO2019090110A1 (en) | 2017-11-03 | 2018-11-02 | Compositions and methods for treating cancer with anti-ror1 immunotherapy |
Country Status (7)
| Country | Link |
|---|---|
| US (3) | US10428141B2 (https=) |
| EP (1) | EP3703711A4 (https=) |
| JP (3) | JP7448903B2 (https=) |
| CN (2) | CN117756946A (https=) |
| AU (2) | AU2018360031B2 (https=) |
| CA (1) | CA3081719A1 (https=) |
| WO (1) | WO2019090110A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111286512A (zh) * | 2019-06-05 | 2020-06-16 | 南京艾德免疫治疗研究院有限公司 | 靶向人源化酪氨酸激酶孤儿受体1的嵌合抗原受体及其用途 |
| US11306142B2 (en) | 2017-07-05 | 2022-04-19 | Ucl Business Ltd | Bispecific antibodies to ROR1 and CD3 |
| US11466083B2 (en) | 2017-07-05 | 2022-10-11 | Ucl Business Ltd | ROR1 antibodies |
| US11723925B2 (en) | 2017-07-05 | 2023-08-15 | Ucl Business Ltd | ROR1 CAR T-cells |
| WO2024026107A3 (en) * | 2022-07-28 | 2024-04-11 | Lentigen Technology, Inc. | Chimeric antigen receptor therapies for treating solid tumors |
| WO2025026204A1 (en) * | 2023-07-28 | 2025-02-06 | Cstone Pharmaceuticals (Suzhou) Co., Ltd. | Antibodies against ror1 and uses thereof |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2018360031B2 (en) | 2017-11-03 | 2025-08-21 | Lentigen Technology, Inc. | Compositions and methods for treating cancer with anti-ROR1 immunotherapy |
| CN108441505B (zh) * | 2018-05-28 | 2023-07-07 | 上海恒润达生生物科技股份有限公司 | 一种靶向ror1的嵌合抗原受体及其用途 |
| AU2022227686A1 (en) | 2021-02-25 | 2023-07-27 | Lyell Immunopharma, Inc. | Ror1 targeting chimeric antigen receptor |
| KR20230159851A (ko) * | 2021-03-22 | 2023-11-22 | 주노 쎄러퓨티크스 인코퍼레이티드 | 치료 세포 조성물의 효력을 결정하는 방법 |
| CN114014938B (zh) * | 2021-11-19 | 2022-09-13 | 陈天睿 | 一种嵌合抗原受体(car)及其应用 |
| WO2023186100A1 (zh) * | 2022-04-02 | 2023-10-05 | 山东先声生物制药有限公司 | 抗ror1的抗体及其用途 |
| WO2024040194A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| US12311033B2 (en) | 2023-05-31 | 2025-05-27 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| WO2025006799A1 (en) | 2023-06-27 | 2025-01-02 | Capstan Therapeutics, Inc. | Extracorporeal and ex vivo engineering of select cell populations from peripheral blood |
| WO2025076127A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| WO2025096878A1 (en) | 2023-11-02 | 2025-05-08 | Capstan Therapeutics, Inc. | Rna for in vivo transfection with increased expression |
| WO2025129201A1 (en) | 2023-12-15 | 2025-06-19 | Capstan Therapeutics, Inc. | Humanized anti-cd8 antibodies and uses thereof |
| WO2025179294A2 (en) | 2024-02-22 | 2025-08-28 | Capstan Therapeutics, Inc. | Immune engineering amplification |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| CN120485285A (zh) * | 2025-07-18 | 2025-08-15 | 天津医科大学总医院 | 一种质粒载体、嵌合mog抗体受体t细胞及其应用 |
Citations (84)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3060165A (en) | 1962-10-23 | Preparation of toxic ricin | ||
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4308269A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4486414A (en) | 1983-03-21 | 1984-12-04 | Arizona Board Of Reagents | Dolastatins A and B cell growth inhibitory substances |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4689401A (en) | 1986-03-06 | 1987-08-25 | Cetus Corporation | Method of recovering microbially produced recombinant ricin toxin a chain |
| US4816444A (en) | 1987-07-10 | 1989-03-28 | Arizona Board Of Regents, Arizona State University | Cell growth inhibitory substance |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US4879278A (en) | 1989-05-16 | 1989-11-07 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptide dolastatin 15 |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
| US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
| US4978744A (en) | 1989-01-27 | 1990-12-18 | Arizona Board Of Regents | Synthesis of dolastatin 10 |
| US4986988A (en) | 1989-05-18 | 1991-01-22 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptides dolastatin 13 and dehydrodolastatin 13 |
| US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US5055303A (en) | 1989-01-31 | 1991-10-08 | Kv Pharmaceutical Company | Solid controlled release bioadherent emulsions |
| US5076973A (en) | 1988-10-24 | 1991-12-31 | Arizona Board Of Regents | Synthesis of dolastatin 3 |
| US5079163A (en) | 1985-03-29 | 1992-01-07 | Cetus Corporation | Recombinant ricin toxin fragments |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| US5138036A (en) | 1989-11-13 | 1992-08-11 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Isolation and structural elucidation of the cytostatic cyclodepsipeptide dolastatin 14 |
| US5188837A (en) | 1989-11-13 | 1993-02-23 | Nova Pharmaceutical Corporation | Lipsopheres for controlled delivery of substances |
| US5208021A (en) | 1987-10-05 | 1993-05-04 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Method of preparing diphtheria immunotoxins |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5254342A (en) | 1991-09-30 | 1993-10-19 | University Of Southern California | Compositions and methods for enhanced transepithelial and transendothelial transport or active agents |
| US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5271961A (en) | 1989-11-06 | 1993-12-21 | Alkermes Controlled Therapeutics, Inc. | Method for producing protein microspheres |
| US5410024A (en) | 1993-01-21 | 1995-04-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides |
| US5413797A (en) | 1992-03-12 | 1995-05-09 | Alkermes Controlled Therapeutics, Inc. | Controlled release ACTH containing microspheres |
| US5449752A (en) | 1991-05-02 | 1995-09-12 | Seikagaku Kogyo K.K. | Polypeptides with affinity to lipopolysaccharides and their uses |
| US5504191A (en) | 1994-08-01 | 1996-04-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide methyl esters |
| US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
| US5521284A (en) | 1994-08-01 | 1996-05-28 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides and esters |
| US5530097A (en) | 1994-08-01 | 1996-06-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory peptide amides |
| US5534496A (en) | 1992-07-07 | 1996-07-09 | University Of Southern California | Methods and compositions to enhance epithelial drug transport |
| US5554725A (en) | 1994-09-14 | 1996-09-10 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Synthesis of dolastatin 15 |
| EP0425235B1 (en) | 1989-10-25 | 1996-09-25 | Immunogen Inc | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5599902A (en) | 1994-11-10 | 1997-02-04 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Cancer inhibitory peptides |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5792458A (en) | 1987-10-05 | 1998-08-11 | The United States Of America As Represented By The Department Of Health And Human Services | Mutant diphtheria toxin conjugates |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| US6034065A (en) | 1992-12-03 | 2000-03-07 | Arizona Board Of Regents | Elucidation and synthesis of antineoplastic tetrapeptide phenethylamides of dolastatin 10 |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US6239104B1 (en) | 1997-02-25 | 2001-05-29 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear and cyclo-depsipeptides dolastatin 16, dolastatin 17, and dolastatin 18 |
| US6323315B1 (en) | 1999-09-10 | 2001-11-27 | Basf Aktiengesellschaft | Dolastatin peptides |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| US20020197266A1 (en) | 2000-02-08 | 2002-12-26 | Waldemar Debinski | Immunotherapy using interleukin 13 receptor subunit alpha 2 |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US6884869B2 (en) | 2001-04-30 | 2005-04-26 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| US20110070248A1 (en) | 2009-09-24 | 2011-03-24 | Seattle Genetics, Inc. | Dr5 ligand drug conjugates |
| US20110212088A1 (en) | 2010-02-26 | 2011-09-01 | Sabbadini Roger A | Anti-paf antibodies |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| WO2014031687A1 (en) * | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| WO2016016343A1 (en) * | 2014-07-31 | 2016-02-04 | Cellectis | Ror1 specific multi-chain chimeric antigen receptor |
| WO2016016344A1 (en) | 2014-07-29 | 2016-02-04 | Cellectis | Ror1(ntrkr1)specific chimeric antigen receptors for cancer immunotherapy |
| CN105924533A (zh) | 2016-07-13 | 2016-09-07 | 北京康爱瑞浩生物科技股份有限公司 | Ror1特异性嵌合抗原受体及其应用 |
| US20170183407A1 (en) | 2014-02-14 | 2017-06-29 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors and methods of making |
| WO2017127664A1 (en) | 2016-01-20 | 2017-07-27 | The Scripps Research Institute | Ror1 antibody compositions and related methods |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP5816170B2 (ja) * | 2009-06-26 | 2015-11-18 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | 天然の免疫グロブリン形式を有する容易に単離される二重特異性抗体 |
| AU2011299233B2 (en) | 2010-09-07 | 2016-09-15 | Integrated Dna Technologies, Inc. | Modifications for antisense compounds |
| WO2013051718A1 (ja) * | 2011-10-07 | 2013-04-11 | 国立大学法人三重大学 | キメラ抗原受容体 |
| MX2017012939A (es) * | 2015-04-08 | 2018-05-22 | Novartis Ag | Terapias cd20, terapias cd22 y terapias de combinacion con una celula que expresa un receptor quimerico de antigeno (car) de cd19. |
| US10639329B2 (en) * | 2015-06-12 | 2020-05-05 | Lentigen Technology, Inc. | Method to treat cancer with engineered T-cells |
| CN114181960B (zh) * | 2015-10-09 | 2024-08-23 | 美天施生物科技有限公司 | 嵌合抗原受体和使用方法 |
| TW201730212A (zh) * | 2016-02-17 | 2017-09-01 | 宏觀基因股份有限公司 | Ror1-結合分子及其使用方法 |
| CA3096798C (en) * | 2017-01-09 | 2026-02-24 | The U.S.A., As Represented By The Secretary, Department Of Health And Human Services | Compositions and methods for treating cancer with anti-mesothelin immunotherapy |
| AU2018360031B2 (en) | 2017-11-03 | 2025-08-21 | Lentigen Technology, Inc. | Compositions and methods for treating cancer with anti-ROR1 immunotherapy |
-
2018
- 2018-11-02 AU AU2018360031A patent/AU2018360031B2/en active Active
- 2018-11-02 CN CN202311592044.3A patent/CN117756946A/zh active Pending
- 2018-11-02 EP EP18871951.2A patent/EP3703711A4/en active Pending
- 2018-11-02 WO PCT/US2018/059003 patent/WO2019090110A1/en not_active Ceased
- 2018-11-02 US US16/179,364 patent/US10428141B2/en active Active
- 2018-11-02 JP JP2020524450A patent/JP7448903B2/ja active Active
- 2018-11-02 CA CA3081719A patent/CA3081719A1/en active Pending
- 2018-11-02 CN CN201880078376.0A patent/CN111741757B/zh active Active
-
2019
- 2019-09-30 US US16/588,591 patent/US11453719B2/en active Active
-
2022
- 2022-08-18 US US17/820,785 patent/US12540179B2/en active Active
-
2023
- 2023-10-18 JP JP2023179537A patent/JP7695319B2/ja active Active
-
2025
- 2025-06-05 JP JP2025094057A patent/JP2025131746A/ja active Pending
- 2025-11-20 AU AU2025271065A patent/AU2025271065A1/en active Pending
Patent Citations (93)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3060165A (en) | 1962-10-23 | Preparation of toxic ricin | ||
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4361650A (en) | 1978-03-24 | 1982-11-30 | Takeda Chemical Industries, Ltd. | Fermentation process of preparing demethyl maytansinoids |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4308269A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4486414A (en) | 1983-03-21 | 1984-12-04 | Arizona Board Of Reagents | Dolastatins A and B cell growth inhibitory substances |
| US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US5079163A (en) | 1985-03-29 | 1992-01-07 | Cetus Corporation | Recombinant ricin toxin fragments |
| US4689401A (en) | 1986-03-06 | 1987-08-25 | Cetus Corporation | Method of recovering microbially produced recombinant ricin toxin a chain |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US4816444A (en) | 1987-07-10 | 1989-03-28 | Arizona Board Of Regents, Arizona State University | Cell growth inhibitory substance |
| US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
| US5208021A (en) | 1987-10-05 | 1993-05-04 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Method of preparing diphtheria immunotoxins |
| US5792458A (en) | 1987-10-05 | 1998-08-11 | The United States Of America As Represented By The Department Of Health And Human Services | Mutant diphtheria toxin conjugates |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| US5076973A (en) | 1988-10-24 | 1991-12-31 | Arizona Board Of Regents | Synthesis of dolastatin 3 |
| US4978744A (en) | 1989-01-27 | 1990-12-18 | Arizona Board Of Regents | Synthesis of dolastatin 10 |
| US5055303A (en) | 1989-01-31 | 1991-10-08 | Kv Pharmaceutical Company | Solid controlled release bioadherent emulsions |
| US4879278A (en) | 1989-05-16 | 1989-11-07 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptide dolastatin 15 |
| US4986988A (en) | 1989-05-18 | 1991-01-22 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptides dolastatin 13 and dehydrodolastatin 13 |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5416064A (en) | 1989-10-25 | 1995-05-16 | Immunogen, Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| EP0425235B1 (en) | 1989-10-25 | 1996-09-25 | Immunogen Inc | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5271961A (en) | 1989-11-06 | 1993-12-21 | Alkermes Controlled Therapeutics, Inc. | Method for producing protein microspheres |
| US5188837A (en) | 1989-11-13 | 1993-02-23 | Nova Pharmaceutical Corporation | Lipsopheres for controlled delivery of substances |
| US5138036A (en) | 1989-11-13 | 1992-08-11 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Isolation and structural elucidation of the cytostatic cyclodepsipeptide dolastatin 14 |
| US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5506206A (en) | 1990-04-23 | 1996-04-09 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5449752A (en) | 1991-05-02 | 1995-09-12 | Seikagaku Kogyo K.K. | Polypeptides with affinity to lipopolysaccharides and their uses |
| US5254342A (en) | 1991-09-30 | 1993-10-19 | University Of Southern California | Compositions and methods for enhanced transepithelial and transendothelial transport or active agents |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5413797A (en) | 1992-03-12 | 1995-05-09 | Alkermes Controlled Therapeutics, Inc. | Controlled release ACTH containing microspheres |
| US5534496A (en) | 1992-07-07 | 1996-07-09 | University Of Southern California | Methods and compositions to enhance epithelial drug transport |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US6034065A (en) | 1992-12-03 | 2000-03-07 | Arizona Board Of Regents | Elucidation and synthesis of antineoplastic tetrapeptide phenethylamides of dolastatin 10 |
| US5410024A (en) | 1993-01-21 | 1995-04-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
| US5521284A (en) | 1994-08-01 | 1996-05-28 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides and esters |
| US5665860A (en) | 1994-08-01 | 1997-09-09 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory peptide amides |
| US5530097A (en) | 1994-08-01 | 1996-06-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory peptide amides |
| US5504191A (en) | 1994-08-01 | 1996-04-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide methyl esters |
| US5554725A (en) | 1994-09-14 | 1996-09-10 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Synthesis of dolastatin 15 |
| US5599902A (en) | 1994-11-10 | 1997-02-04 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Cancer inhibitory peptides |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| US6239104B1 (en) | 1997-02-25 | 2001-05-29 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear and cyclo-depsipeptides dolastatin 16, dolastatin 17, and dolastatin 18 |
| US6323315B1 (en) | 1999-09-10 | 2001-11-27 | Basf Aktiengesellschaft | Dolastatin peptides |
| US20020197266A1 (en) | 2000-02-08 | 2002-12-26 | Waldemar Debinski | Immunotherapy using interleukin 13 receptor subunit alpha 2 |
| US7338929B2 (en) | 2000-02-08 | 2008-03-04 | The Penn State Research Foundation | Cancer immunotherapy |
| US6884869B2 (en) | 2001-04-30 | 2005-04-26 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US20060074008A1 (en) | 2002-07-31 | 2006-04-06 | Senter Peter D | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7964566B2 (en) | 2003-11-06 | 2011-06-21 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| US20110070248A1 (en) | 2009-09-24 | 2011-03-24 | Seattle Genetics, Inc. | Dr5 ligand drug conjugates |
| US20110212088A1 (en) | 2010-02-26 | 2011-09-01 | Sabbadini Roger A | Anti-paf antibodies |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| WO2014031687A1 (en) * | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| US20150306141A1 (en) | 2012-08-20 | 2015-10-29 | Fred Hutchinson Cancer Resesarch Center | Method and compositions for cellular immunotherapy |
| US20170183407A1 (en) | 2014-02-14 | 2017-06-29 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors and methods of making |
| WO2016016344A1 (en) | 2014-07-29 | 2016-02-04 | Cellectis | Ror1(ntrkr1)specific chimeric antigen receptors for cancer immunotherapy |
| WO2016016343A1 (en) * | 2014-07-31 | 2016-02-04 | Cellectis | Ror1 specific multi-chain chimeric antigen receptor |
| WO2017127664A1 (en) | 2016-01-20 | 2017-07-27 | The Scripps Research Institute | Ror1 antibody compositions and related methods |
| CN105924533A (zh) | 2016-07-13 | 2016-09-07 | 北京康爱瑞浩生物科技股份有限公司 | Ror1特异性嵌合抗原受体及其应用 |
Non-Patent Citations (96)
| Title |
|---|
| "GenBank", Database accession no. AAA35664.1 |
| "GeneBank", Database accession no. NP_005003 |
| "Genetically Modified T-Cell Therapy in Treating Patients with Advanced ROR1+ Malignancies, NCT02706392", FRED HUTCHINSON CANCER RESEARCH CENTER, 20 September 2017 (2017-09-20), Retrieved from the Internet <URL:ClinicalTrials.gov> |
| "Study of Circumtuzumab and Paclitaxel for Metastatic or Locally Advanced, Unresectable Breast Cancer, NCT02776917", 20 September 2017, UNIVERSITY OF CALIFORNIA |
| "UniProt", Database accession no. ID Q07011 |
| AHMAD ET AL., CLIN. DEV. IMMUNOL., 2012 |
| AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ASHWINI BALAKRISHNAN ET AL.: "Analysis of ROR1 Protein Expression in Human Cancer and Normal Tissues.", CLIN CANCER RES, vol. 23, 2017, pages 3061 - 3071, XP055634726, DOI: 10.1158/1078-0432.CCR-16-2083 |
| BALAKRISHNAN, A. ET AL., CLIN CANCER RES, vol. 23, 2016, pages 3061 - 3071 |
| BANGA, A.J.: "Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems", 1995, TECHNOMIC PUBLISHING COMPANY, INC. |
| BARBAS ET AL.: "Cancer Research UK Centre for Cancer Therapeutics at the Institute of Cancer Research", 2004, COLD SPRING HARBOR LABORATORY PRESS |
| BASKAR, S. ET AL., CLIN CANCER RES, vol. 14, 2008, pages 396 - 404 |
| BASKAR, SIVASUBRAMANIAN ET AL.: "Targeting malignant B cells with an immunotoxin against ROR1", MABS, vol. 4, 2012, pages 3,349 - 361 |
| BERGER ET AL., CANCER IMMUNOL RES, vol. 3, no. 2, 2015, pages 206 - 216 |
| BERGER, C. ET AL.: "Safety of targeting ROR1 in primates with chimeric antigen receptor-modified T cells", CANCER IMMUNOL RES, vol. 3, 2015, pages 2016 - 216 |
| BETAGERI ET AL.: "Liposome Drug Delivery Systems", 1993, TECHNOMIC PUBLISHING CO., INC. |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 426 |
| BORCHERDING, N.KUSNER, D. ET AL.: "ROR1, an embryonic protein with an emerging role in cancer biology", PROTEIN & CELL, vol. 5, 2014, pages 496 - 502, XP035734484, DOI: 10.1007/s13238-014-0059-7 |
| BORCHERDING, NICHOLAS ET AL.: "ROR1, an Embryonic Protein with an Emerging Role in Cancer Biology", PROTEIN & CELL, vol. 5.7, no. 2014, 2017, pages 496 - 502 |
| BROWN CE ET AL., CLIN CANCER RES., vol. 18, no. 8, 2012, pages 2199 - 209 |
| CAPECCHI, CELL, vol. 22, 1980, pages 479 - 488 |
| CHU ET AL., GENE, vol. 13, 1981, pages 97 |
| CLAY ET AL., J. IMMUNOL, vol. 163, 1999, pages 507 - 513 |
| DAVIS ET AL.: "Basic Methods in Molecular Biology", 1986, ELSEVIER |
| DAVIS KLMACKALL CL, BLOOD ADVANCES, vol. 1, 2016, pages 265 - 268 |
| DENIGER ET AL., PLOS ONE, vol. 10, no. 6, 2015, pages 0128151 |
| DI STASI A ET AL., N ENGL J MED., vol. 365, no. 18, 2011, pages 1673 - 83 |
| DUBOWCHIKWALKER, PHARM. THERAPEUTICS, vol. VII, 1999, pages 67 - 123 |
| FEIGNER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 7413 - 7417 |
| FOSTER AE ET AL., J IMMUNOTHER., vol. 31, no. 5, 2008, pages 500 - 5 |
| FUNATSU ET AL., AGR. BIOL. CHEM., vol. 52, 1988, pages 1095 |
| GILLESPIE ET AL., ANN. ONCOL., vol. 11, 2000, pages 735 - 41 |
| GOYALBATRA, BIOCHEM., vol. 345, no. 2, 2000, pages 247 - 54 |
| GRAHAM ET AL., VIROLOGY, vol. 52, 1973, pages 456 - 467 |
| HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448 |
| HASO WLEE DWSHAH NNSTETLER-STEVENSON MYUAN CMPASTAN IHDIMITROV DSMORGAN RAFITZGERALD DJBARRETT DM: "Anti-CD22-chimeric antigen receptors targeting B cell precursor acute lymphoblastic leukemia", BLOOD., vol. 121, no. 7, 2013, pages 1165 - 74 |
| HEGDE M ET AL., MOL THER., vol. 21, no. 11, 2013, pages 2087 - 101 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 6444 6448 |
| HUANG XPARK HGREENE JPAO JMULVEY EZHOU SX ET AL.: "IGF1R- and ROR1-Specific CAR T Cells as a Potential Therapy for High Risk Sarcomas", PLOS ONE, vol. 10, no. 7, 2015, pages 0133152 |
| HUDECEK ET AL., BLOOD, vol. 116, no. 22, 2010, pages 4532 - 4541 |
| HUDECEK ET AL., CLIN CANCER RES, vol. 19, 2013, pages 3153 - 3164 |
| HUDECEK ET AL., CLINICAL CANCER RESEARCH, vol. 19, no. 12, 2013, pages 3153 - 3153 |
| HUDECEK MSCHMITT TMBASKAR SLUPO- STANGHELLINI MTNISHIDA TYAMAMOTO TNBLEAKLEY MTURTLE CJCHANG WCGREISMAN HA: "The B-cell tumor-associated antigen ROR1 can be targeted with T cells modified to express a ROR1-specific chimeric antigen receptor", BLOOD, vol. 116, 2010, pages 4532 - 41, XP086694870, DOI: 10.1182/blood-2010-05-283309 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 5883 |
| IJNTEMA ET AL., INT. J. PHARM., vol. 112, 1994, pages 215 - 224 |
| JOHNSON ET AL., ANTICANCER RES., vol. 15, 1995, pages 1387 - 93 |
| JOHNSTON ET AL., PHARM. RES., vol. 9, 1992, pages 425 - 434 |
| JUNG, E.H. ET AL., CELL BIOCHEM FUNCT, vol. 34, pages 149 - 157 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KAISER AD ET AL., CANCER GENE THER., vol. 22, no. 2, 2015, pages 72 - 78 |
| KINDT ET AL.: "Kuby Immunology", 2007, W.H. FREEMAN AND CO., pages: 91 |
| KLEIN ET AL., NATURE, vol. 327, 1987, pages 70 - 73 |
| KLOSS CC ET AL., NAT BIOTECHNOL., vol. 31, no. 1, 2013, pages 71 - 5 |
| KOCHENDERFER JN ET AL., BLOOD., vol. 119, no. 12, 2012, pages 2709 - 20 |
| LAIRDGROMAN, J. VIROL., vol. 19, 1976, pages 220 |
| LANGER, ACCOUNTS CHEM. RES., vol. 26, 1993, pages 537 - 542 |
| LANITIS E ET AL., CANCER IMMUNOL RES., vol. 1, no. 1, 2013, pages 43 - 53 |
| LAU ET AL., BIOORG-MED-CHEM., vol. 3, no. 10, 1995, pages 1305 - 1304 |
| LEE DW ET AL., AMERICAN SOCIETY OF HEMATOLOGY ANNUAL MEETING, 10 July 2013 (2013-07-10) |
| LEE ET AL., J. ANTIBIOT., vol. 42, 1989, pages 1070 - 87 |
| LEFRANC ET AL.: "IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains", DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77, XP055585227, DOI: 10.1016/S0145-305X(02)00039-3 |
| LEHNER M ET AL., PLOS ONE., vol. 7, no. 2, 2012, pages 31210 |
| LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125 |
| LONENBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459 |
| LONG, A.H. ET AL., NATURE MED, vol. 20, 2015, pages 581 - 590 |
| MARBRY, IDRUGS, vol. 1-2, 2010, pages 543 - 549 |
| MASIAKOWSKI, P.CARROLL, R.D.: "A Novel Family of Cell Surface Receptors with Tyrosine Kinase-like Domain", J BIOL CHEM, vol. 36, 1992, pages 26181 - 26190, XP002267720 |
| MAUDE SLTEACHEY DTRHEINGOLD SRSHAW PAAPLENC RBARRETT DMBARKER CSCALLAHAN CFREY NVFARZANA N, J CLIN ONCOL, vol. 34, no. 15, May 2016 (2016-05-01), pages 3011 - 3011 |
| MAUS MVHAAS ARBEATTY GLALBEDA SMLEVINE BLLIU XZHAO YKALOS MJUNE CH, CANCER IMMUNOLOGY RESEARCH, vol. 1, 2013, pages 26 - 31 |
| MILONE ET AL., MOL. THER., vol. 17, no. 8, 2009, pages 1453 - 1464 |
| NEVILLE ET AL., BIOL. CHEM., vol. 264, 1989, pages 14653 - 14661 |
| NICHOLSONBLAUSTEIN, J. BIOCHIM. BIOPHYS. ACTA, vol. 266, 1972, pages 543 |
| OLSNES ET AL., NATURE, vol. 249, 1974, pages 627 - 631 |
| OLSNES, METHODS ENZYMOL., vol. 50, 1978, pages 330 - 335 |
| PEC ET AL., J. PARENT. SCI. TECH., vol. 44, no. 2, 1990, pages 58 - 65 |
| PHILLIPS ET AL., CANCER RES., vol. 68, 2008, pages 92809290 |
| POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 1123 |
| RATHORE ET AL., GENE, vol. 190, 1997, pages 31 - 5 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR PRESS |
| SCHNEIDER ET AL.: "A tandem CD 19/ CD 20 CAR lentiviral vector drives on-target and off-target antigen modulation in leukemia cell lines", JOURNAL FOR IMMUNOTHERAPY OF CANCER, vol. 5, no. 42, 16 May 2017 (2017-05-16), pages 1 - 17, XP021245145, DOI: doi:10.1186/s40425-017-0246-1 * |
| SHERIFF ET AL., NAT. STRUCT. BIOL., vol. 3, 1996, pages 733 - 736 |
| SHIGEKAWA ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682 - 690 |
| STIRPE ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 405 - 412 |
| SUPING ZHANG ET AL.: "The OncoEmbryonic Antigen ROR1 Is Expressed by a Variety of Human Cancers", AM J PATHOL, vol. 181, 2012, pages 1903 - 1910 |
| SUZUKI ET AL., NAT. BIOTECH., vol. 17, 1999, pages 265 - 70 |
| THORPE ET AL., CANCER RES., vol. 47, 1987, pages 5924 - 5931 |
| WALKER, A. ET AL., MOL THER, vol. 25, 2017, pages 2189 - 2201 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WINTERHARRIS, IMMUNOL. TODAY, vol. 14, 1993, pages 243 - 246 |
| YAMAGUCHI, TOMOYA ET AL.: "NKX2-1/TITF1/TTF-1-Induced ROR1 is required to sustain EGFR survival signaling in lung adenocarcinoma.", CANCER CELL, vol. 21.3, 2012, pages 348 - 361, XP028473637, DOI: 10.1016/j.ccr.2012.02.008 |
| YANG, JIAHUI ET AL.: "Therapeutic potential and challenges of targeting receptor tyrosine kinase ROR1 with monoclonal antibodies in B-cell malignancies.", PLOS ONE, vol. 6.6, 2011, pages 21018 |
| YU ET AL., PNAS, vol. 99, 2002, pages 7968 - 7973 |
| YVON E ET AL., CLIN CANCER RES., vol. 15, no. 18, 2009, pages 5852 - 60 |
| ZHAO ET AL., J. IMMUNOL, vol. 174, 2005, pages 4415 - 4423 |
| ZHAO YET, J IMMUNOL., vol. 183, no. 9, 2009, pages 5563 - 74 |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11306142B2 (en) | 2017-07-05 | 2022-04-19 | Ucl Business Ltd | Bispecific antibodies to ROR1 and CD3 |
| US11466083B2 (en) | 2017-07-05 | 2022-10-11 | Ucl Business Ltd | ROR1 antibodies |
| US11723925B2 (en) | 2017-07-05 | 2023-08-15 | Ucl Business Ltd | ROR1 CAR T-cells |
| CN111286512A (zh) * | 2019-06-05 | 2020-06-16 | 南京艾德免疫治疗研究院有限公司 | 靶向人源化酪氨酸激酶孤儿受体1的嵌合抗原受体及其用途 |
| WO2024026107A3 (en) * | 2022-07-28 | 2024-04-11 | Lentigen Technology, Inc. | Chimeric antigen receptor therapies for treating solid tumors |
| US12465641B2 (en) | 2022-07-28 | 2025-11-11 | Lentigen Technology, Inc. | Chimeric antigen receptor therapies for treating solid tumors |
| WO2025026204A1 (en) * | 2023-07-28 | 2025-02-06 | Cstone Pharmaceuticals (Suzhou) Co., Ltd. | Antibodies against ror1 and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7448903B2 (ja) | 2024-03-13 |
| AU2018360031B2 (en) | 2025-08-21 |
| US10428141B2 (en) | 2019-10-01 |
| EP3703711A1 (en) | 2020-09-09 |
| US20200102385A1 (en) | 2020-04-02 |
| US11453719B2 (en) | 2022-09-27 |
| AU2018360031A1 (en) | 2020-05-21 |
| US12540179B2 (en) | 2026-02-03 |
| JP2025131746A (ja) | 2025-09-09 |
| CN117756946A (zh) | 2024-03-26 |
| JP2021502070A (ja) | 2021-01-28 |
| CN111741757B (zh) | 2023-12-19 |
| CA3081719A1 (en) | 2019-05-09 |
| AU2025271065A1 (en) | 2025-12-18 |
| US20220389094A1 (en) | 2022-12-08 |
| CN111741757A (zh) | 2020-10-02 |
| JP2024010009A (ja) | 2024-01-23 |
| US20190055309A1 (en) | 2019-02-21 |
| JP7695319B2 (ja) | 2025-06-18 |
| EP3703711A4 (en) | 2021-01-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12540179B2 (en) | Compositions and methods for treating cancer with anti-ROR1 immunotherapy | |
| US20230241103A1 (en) | Compositions and Methods for Treating Cancer with Anti-CD33 Immunotherapy | |
| US12037403B2 (en) | Compositions and methods for treating cancer with anti-CD123 immunotherapy | |
| AU2022204182B2 (en) | Compositions and methods for treating cancer with anti-mesothelin immunotherapy | |
| US11878052B2 (en) | Compositions and methods for treating cancer with anti-CD22 immunotherapy | |
| US20240067724A1 (en) | Compositions and Methods for Treating Cancer with Anti-CD19 Immunotherapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18871951 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3081719 Country of ref document: CA Ref document number: 2020524450 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018360031 Country of ref document: AU Date of ref document: 20181102 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018871951 Country of ref document: EP Effective date: 20200603 |