WO2019075200A1 - Transgenic selection methods and compositions - Google Patents
Transgenic selection methods and compositions Download PDFInfo
- Publication number
- WO2019075200A1 WO2019075200A1 PCT/US2018/055412 US2018055412W WO2019075200A1 WO 2019075200 A1 WO2019075200 A1 WO 2019075200A1 US 2018055412 W US2018055412 W US 2018055412W WO 2019075200 A1 WO2019075200 A1 WO 2019075200A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- terminal fragment
- intein
- protein
- nucleotide sequence
- sequence encoding
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1025—Acyltransferases (2.3)
- C12N9/1029—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/61—Fusion polypeptide containing an enzyme fusion for detection (lacZ, luciferase)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/90—Fusion polypeptide containing a motif for post-translational modification
- C07K2319/92—Fusion polypeptide containing a motif for post-translational modification containing an intein ("protein splicing")domain
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3517—Marker; Tag
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3519—Fusion with another nucleic acid
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- Antibiotic resistance genes encoding antibiotic resistance proteins
- Antibiotic resistance genes/antibiotics available for use in eukaryotic cells include /zygfi/Hygromycin, neol Geneticin ® /G418, /?ac/Puromycin, Sh Wa/Phleomycin Dl (Zeocin TM ), and fed/Blasticidin.
- Fluorescent proteins, such as green fluorescent protein (GFP) provide another means of cell selection, for example, via fluorescent- activated cell sorting (FACS) techniques or fluorescent microscopy.
- compositions and kits useful for the production and/or identification of, for example, cells and/or organisms harboring two or more transgenes (e.g., double-transgenics, triple-transgenics, etc.).
- the compositions and kits may be used for the production and/or identification of cells and/or organisms harboring two, three, or four transgenes.
- This technology is based, at least in part, on a protein splicing mechanism initiated by an intein auto-processing domain, which facilitates the joining (conjugation) specifically in multi- transgenic cells of multiple (e.g., two, three, or four) separate selectable marker protein fragments (double-transgenic cells, triple-transgenic eels, or quadruple-transgenic cells).
- Joining of the two, three, four, or more separate selectable marker protein fragments in the multi-transgenic cells produces a full-length selectable marker protein that confers, for example, antibiotic resistance (an antibiotic resistance protein) or is capable of fluorescence under an appropriate wavelength of light (fluorescent protein).
- Cells expressing a full-length antibiotic resistance gene survive in the presence of the corresponding antibiotic and thus are selected as multi-transgenic (e.g., double- transgenic, triple-transgenic, or quadruple-transgenic) cells.
- multi-transgenic e.g., double- transgenic, triple-transgenic, or quadruple-transgenic
- cells expressing a full-length functioning fluorescent protein fluoresce under the appropriate wavelength of light and thus are selected as multi-transgenic (e.g., double-transgenic, triple-transgenic, or quadruple-transgenic) cells.
- the present disclosure provides, in some embodiments, methods comprising delivering to a composition comprising eukaryotic cells two or more vectors, wherein each vector comprises (i) a nucleotide sequence encoding a selectable marker protein fragment linked to an N-terminal intein protein fragment and/or a C-terminal intein protein fragment and (ii) a nucleotide sequence encoding a molecule of interest, wherein the intein protein fragments, when joined in frame to form full-length function proteins, catalyze joining of the selectable marker protein fragments to produce a full-length selectable marker protein.
- methods herein comprising delivering to a composition comprising eukaryotic cells (a) a first vector comprising (i) a nucleotide sequence encoding a first selectable marker protein fragment (e.g., antibiotic resistance protein fragment or fluorescent protein fragment) upstream from a nucleotide sequence encoding an N-terminal intein protein fragment and (ii) a nucleotide sequence encoding a first molecule, and (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal intein protein fragment upstream from a second selectable marker protein fragment (e.g., antibiotic resistance protein fragment or fluorescent protein fragment) and (ii) a nucleotide sequence encoding a second molecule, wherein the N- terminal intein protein fragment and the C -terminal intein protein fragment catalyze joining of the first selectable marker protein fragment to the second selectable marker protein fragment to produce a full-length selectable marker protein.
- the two vectors When the two vectors are delivered to a population of cells (e.g., under transfection conditions), some cells will take up the first vector (the vector is introduced in the cells), some cells will take up the second vector, and some cells will take up both vectors. Only those cells that take up both vectors are capable of expressing a full-length functioning selectable marker protein, thus only those cells are selected as double-transgenic cells.
- methods comprise delivering to eukaryotic cells (a) a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a selectable marker protein (e.g., antibiotic resistance protein or fluorescent protein), which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest, (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the selectable marker protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and (c) a third vector comprising (i) a nucleotide
- the three vectors When the three vectors are delivered to a population of cells (e.g., under transfection conditions), some cells will take up the first vector (the vector is introduced in the cells), some cells will take up the second vector, some cells will take up the third vector, some cells will take up two different vectors, and some cells will take up all three vectors. Only those cells that take up all three vectors are capable of expressing a full-length functional selectable marker protein, thus only those cells are selected as triple-transgenic cells.
- methods comprise delivering to eukaryotic cells (a) a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a selectable marker protein (e.g., antibiotic resistance protein or fluorescent protein), which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest, (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a first central fragment of the selectable marker protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, (c) a third vector comprising (i) a nucleot
- the four vectors When the four vectors are delivered to a population of cells (e.g., under transfection conditions), some cells will take up the first vector (the vector is introduced in the cells), some cells will take up the second vector, some cells will take up the third vector, some will take up the fourth vector, some cells will take up two different vectors, some cells will take up three different vectors, and some will take up all four vectors. Only those cells that take up all four vectors are capable of expressing a full-length functional selectable marker protein, thus only those cells are selected as quadruple-transgenic cells.
- FIGS. 1A-1B Split selectable marker for antibiotic co-selection of two separate transgenic vectors.
- FIG. 1A The coding sequence of a selectable marker is split into an N-terminal fragment (MarN) and a C-terminal fragment (kerC) and separately cloned upstream of an N-terminal fragment of a split intein (IntN) and downstream of a C-terminal fragment of the split intein (IntC), respectively, on two different vectors each carrying a different transgene. These vectors are delivered to cells yielding sub-populations of cells containing either one of the vectors or both of the vectors.
- FIGS. 2A-2F Details of the split points of Intein- split resistance (Intres) genes (also referred to as selectable marker genes) and plasmids.
- FIG. 2A Split points for hygromycin resistance protein (SEQ ID NO: 1). Amino acid sequence of hygromycin resistance protein is presented with clouds labeling the split points characterized in this study. Within the label, the top row indicates the plasmid numbers corresponding to Table 1. The bottom row indicates the residue number of the last amino acid in the N-terminal fragment, the species of the intein used, and the residue number of the first amino acid in the C-terminal fragment. " A C” indicates an insertion of a Cysteine.
- FIG. 2B Split points for puromycin resistance protein (SEQ ID NO: 2). Amino acid sequence of puromycin resistance protein is presented with clouds labeling the split points characterized in this study. Within the label, the top row indicates the plasmid numbers
- FIG. 2C Split points for neomycin resistance protein (SEQ ID NO: 3). Amino acid sequence of neomycin resistance gene is presented with clouds labeling the split points characterized in this study. Within the label, the top row indicates the plasmid numbers corresponding to Table 1. The bottom row indicates the residue number of the last amino acid in the N-terminal fragment, the species of the intein used, and the residue number of the first amino acid in the C-terminal fragment. (FIG.
- FIG. 3 2-markertron hygromycin (Hygro) intein- split resistance (Intres) genes.
- Top schematic shows the split points tested for hygromycin resistance gene. The last residue of the N- terminal fragment is indicated on top of the lollipops.
- Circle lollipops represent split points using NpuDnaE intein while square lollipops represent those using SspDnaB intein.
- Crossed-out and shaded lollipops indicate split pairs that failed to endow cells with hygromycin resistance.
- the column plot below shows the percentage of double-transgenic cells (BFP+ mCherry+) in the non- selected (white columns) and the selected cultures (blue columns) analyzed by flow cytometry.
- FIG. 4. 2-markertron puromycin (Puro) Intres genes. Top schematic shows split points tested for puromycin resistance genes while bottom column plots show percentage of double transgenic cells in the non-selected (white columns) and the selected cultures (brown columns).
- FIG. 5 2-markertron neomycin (Neo) resistance genes. Top schematic shows split points tested for neomycin resistance genes while bottom column plots show percentage of double transgenic cells in the non-selected (white columns) and the selected cultures (orange columns).
- FIG. 6 2-markertron blasticidin (Blast) Intres genes. Top schematic shows split points tested for blasticidin resistance gene while bottom column plot shows percentages of double transgnic cells in the non-selected (white columns) and the selected (cyan colums) cultures.
- FIGS. 7A-7C Gateway-compatible lentiviral destination vectors with 2-markertron Intres markers.
- FIG. 7A Gateway-compatiable lentiviral destination vector kits for each split Intres marker consists of an N- vector and C- vector.
- N- vector contains viral LTRs, CAGGS promoter, gateway destination cassette AttL, ccdB gene, chloramphenicol resistance gene that allows LR clonase-mediated recombination of Gateway donor vector carrying transgenes, followed by internal ribosomal entry site (IRES) that allows polycistronic expression of the N-markertron.
- C- vector contains the C-markertron and allows recombination of another transgene.
- FIG. 7B Gateway-compatible lentiviral destination vectors with 2-markertron Intres markers.
- TagBFP2 (as transgene 1) and mCherry (as transgene 2) were cloned into the 2-markertron Intres plasmids by Gateway recombination and delivered to cells by lentiviral transduction, followed by antibiotic selection and flow cytometry analysis.
- Column plot shows the percentage of
- Hygro 2-markertron hygromycin
- Puro Puro, brown column
- neomycin Neo, orange column
- NLS- GFP (as transgene 1) that labels nucleus with GFP fluorescence and lifeAct-mScarlet (as transgene 2) that labels F-actin with mScarlet fluorescence were recombined into lentiviral vectors expressing full non-split hygromycin resistance gene or lentiviral vectors with 2-markertron hygromycin Intres genes and used to transduce U20S cells to make dual-label cells.
- Representative fluorescence microscopic images show GFP, mScarlet and merged channels of cells after hygromycin selection for two weeks.
- FIGS. 8A-8C Split mScarlet for fluorescence-mediated co-selection of two separate transgenic vectors.
- FIG. 8A 2-markertron mScarlet proteins. Top schematics shows the split points tested for mScarlet. The last residue of the N-terminal fragment is indicated on top of the lollipops.
- FIG. 8C The column plot below shows the percentage of mScarlet-positive cells of each of the indicated split points. The column plot above shows the percentage of TagBFP+ EGFP+ cells among the PI cells (white columns) and the mScarlet-positive subset of PI cells (red columns).
- FIGS. 9A-9D Multi-split selectable markers for co-selection of three or more transgenic vectors.
- a selectable marker is partitioned into three fragments (Mi, M 2 and M 3 ).
- the first marker fragment (Mi) is fused upstream of the N-terminal fragment of the first split intein (INI).
- the second marker fragment (M 2 ) is fused downstream of the C-terminal fragment of the first split intein (Ici) and upstream of the N-terminal fragment of the second split intein (IN2).
- the third marker fragment (M 3 ) is fused downstream of the C-terminal fragment of the second split intein (Id).
- the first split intein catalyzes the joining of Mi to M 2 while the second split intein catalyzes the joining of M 2 to M 3 , effectively reconstituting the full selectable marker.
- FIG. 9B A design of a £-split selectable marker via an "intein chain" mechanism. Similar to the 3-split scenario, the selectable marker is partitioned into k fragments, and are reconstituted through protein trans- splicing mediated by intervening split inteins.
- FIG. 9C Split points identified from 2-split selectable markers were used in combination to produce 3-split selectable markers.
- FIG. 9D 3-markertron hygromycin (Hygro) Intres. Top schematics shows the split points tested for hygromycin resistance gene, with residue numbers of the last amino acid of the N-terminal fragments indicated above circle or square lollipops, representing NpaDnaE and SspOna inteins, respectively.
- FIGS. lOA-lOC Gateway-compatible lentiviral destination vectors with 3-markertron hygromycin Intres genes.
- FIG. 10A Gateway-compatiable lentiviral destination vector with viral LTRs, CAGGS promoter, gateway destination cassette AttL, ccdB gene, chloramphenicol resistance gene that allows LR clonase-mediated recombination of Gateway donor vector carrying transgenes, followed by internal ribosomal entry site (IRES) that allows polycistronic expression of the each of the three 3-split hygromycin markertrons.
- IRS internal ribosomal entry site
- TagBFP2 (as transgene 1) and EGFP (as transgene 2) and mCherry (as transgene 3) were cloned into the 3-split Intres plasmids by Gateway recombination and delivered to cells by lentiviral transduction, followed by antibiotic selection and flow cytometry analysis.
- FIG. IOC Column plot shows the percentage of BFP+GFP+mCherry+ triple-positive cells in the hygromycin selected (blue columns) versus their corresponding nonselective cultures (white columns).
- FIG. 11 Four-split Hygro intres.
- Plasmid 115 expresses a markertron created by fusing amino acid 1-89 of Hygromycin resistance gene [Hygro(l-89)] to NpuDnaE(N) and a leuzine Zipper A motif (LZA).
- Plasmid 116 expresses a markertron created by fusing, from N- to C-termini, Leucine Zipper B motif (LZB)-NpuDnaGEP(C), Hygro(90-200) and SspDnaB(N).
- Plasmid 117 expresses a markertron created by fusing, from N- to C-termini, SspDnaB(C), Hygro(201-240), NpuDnaE(N)- LZA. Plasmid 118 expresses a markertron created by fusing LZB-NpuDnaGEP(C) to Hygro(241- 341).
- FIGS. 12A-12E Intres markers allow enrichment of biallelic targeted cells from
- Targeting construct pairs containing homology arms for AAVS 1 safe harbor locus were designed to contain full length (FL) non-split or split Intres markers and tested for ability to enrich for biallelic targeted cells via antibiotic selection. (FIG.
- Plasmids 107 and 108 contains FL Neomycin (Neo) resistance gene driven by endogenous PPP1R12C promoter at the AAVS l locus, FL Hygromycin (Hygro) gene and rtTA Dox-respsonsive transactivator driven by an EFla promoter, as well as FL Blasticidin (Blast) expressed as well as EGFP (plasmid 107) and mScarlet (plasmid 108) from a dox-inducible TetO promoter.
- Plasmid 106 contains Cas9 and an sgRNA targeting the AAVS locus. 2A: self-cleaving 2A peptides.
- Plasmids 106, 107 and 108 were co-transfected into HEK293T cells, split, and passaged in dox-containing hygromycin, blasticidin or non- selective media for two weeks, and analyzed by flow cytometry to assay efficiency of biallelic targeting.
- Plasmids 109 and 110 contain similar structure as Plasmids 107 and 108, but having split Blast Intres in place of the FL Blast.
- Plasmids 111 and 112 contain an EFla-driven FL Blast and TetO-driven FL Hygro, nitroreductase (NTR), fluorescent protein (EGFP or mCherry) separated by 2A peptides.
- NTR nitroreductase
- Plasmids 113 and 114 are similar to Plasmids 111 and 112 but with Hygro Intres in place of FL Hygro.
- FIG. 12E Flow cytometry analysis of cells transfected with Plasmid 106 (Cas9+AAVS-sgRNA) and the indicated targeting construct pairs, two weeks after culturing in dox-containing non-selective media (Selection: None), blasticidin selection media (Blast) and hygromycin selection media (Hygro).
- an exemplary method of the present disclosure comprises delivering to a population of cells (a) a vector encoding a first selectable marker protein fragment upstream from an N-terminal intein protein fragment and a first transgene of interest, and (b) another vector encoding a C-terminal intein protein fragment upstream from a second selectable marker protein fragment and a second (e.g., a different) transgene of interest.
- Some cells of the population will take up a single vector (carrying only a fragment of the intein, a fragment of the selectable marker protein, and a single transgene), while other cells of the population will take up both vectors (and thus both intein fragments, both selectable marker protein fragments, and both transgenes of interest).
- the intein protein fragments spontaneously and non-covalently assemble (cooperatively fold) into an intein structure to catalyze joining of the first selectable marker protein fragment to the second selectable marker protein fragment to produce a full-length selectable marker protein, which enables specific selection of those double transgenic cells.
- the selectable marker protein is an antibiotic resistance protein
- only double-transgenic cells expressing the full-length (functional) antibiotic resistance protein will survive selection in the present of the particular antibiotic.
- the selectable marker protein is a fluorescent protein
- only double-transgenic cells expressing the full-length (functional) fluorescent protein will emit a detectable signal such that only those signal-emitting cells are selected.
- Another exemplary method of the present disclosure comprises delivering to a population of cells (a) a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest, (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and (c) a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the
- Some cells of the population will take up a single vector (carrying only a fragment of the intein, a fragment of the selectable marker protein, and a single transgene), while other cells of the population will take up two vectors or all three vectors (and thus all intein fragments, all selectable marker protein fragments, and all transgenes of interest).
- the intein protein fragments spontaneously and non-covalently assemble (cooperatively fold) into an intein structure to catalyze joining of the N-terminal fragment of the selectable marker protein to the central fragment, and the central fragment to the C-terminal fragment of the selectable marker protein to produce a full-length selectable marker protein, which enables specific selection of those triple-transgenic cells.
- the selectable marker protein is an antibiotic resistance protein
- only triple-transgenic cells expressing the full-length (functional) antibiotic resistance protein will survive selection in the present of the particular antibiotic.
- the selectable marker protein is a fluorescent protein, as another example, only triple- transgenic cells expressing the full-length (functional) fluorescent protein will emit a detectable signal such that only those signal-emitting cells are selected.
- intein intervening protein
- protein splicing a unique auto-processing event known as protein splicing in which it excises itself out from a larger precursor polypeptide through the cleavage of two peptide bonds and, in the process, ligates the flanking extein (external protein) sequences through the formation of a new peptide bond.
- This rearrangement occurs post-translationally (or possibly co-translationally), as intein genes are found embedded in frame within other protein- coding genes.
- intein-mediated protein splicing is spontaneous; it requires no external factor or energy source, only the folding of the intein domain.
- the precursor protein contains three segments— an N-extein (N-terminal portion of the protein) followed by the intein followed by a C-extein (C-terminal portion of the protein). Following splicing, the resulting protein contains the N-extein linked to the C-extein.
- inteins There are two types of inteins: czs-splicing inteins are single polypeptides that are embedded in a host protein, whereas trans-splicing inteins (referred to as split inteins) are separate
- this acyl unit is transferred to the first residue of the C-extein (which is either serine, threonine, or cysteine) to form a branched intermediate.
- this branched intermediate is cleaved from the intein by a transamidation reaction involving the C-terminal asparagine residue of the intein.
- This sets up the final step of the process involving an S-N acyl transfer to create a normal peptide bond between the two exteins (Lockless, SW, Muir, TW PNAS 106(27): 10999-11004 (2009)).
- intein alleles there are at least 70 different intein alleles, distinguished not only by the type of host gene in which the inteins are embedded, but also the integration point within that host gene (Perler, FB Nucleic Acids Res. 30: 383-384 (2002); Pietrokovski, S Trends Genet. 17: 465-472 (2001)).
- a small fraction (less than 5%) of the identified intein genes encode split inteins.
- split inteins are transcribed and translated as two separate polypeptides, the N-intein and C-intein, each fused to one extein.
- intein fragments spontaneously and non-covalently assemble (cooperatively fold) into the canonical intein structure to carry out protein splicing in trans.
- split inteins are used to catalyze the joining of two fragments (e.g., an N-terminal fragment and a C-terminal fragment) of a selectable marker protein, such as an antibiotic resistance protein or a fluorescent protein to produce a functional, full-length protein (e.g., FIGS. 1A and IB).
- a selectable marker protein such as an antibiotic resistance protein or a fluorescent protein
- a split intein may be a natural split intein or an engineered split intein. Natural split inteins naturally occur in a variety of different organisms. The largest known family of split inteins is found within the DnaE genes of at least 20 cyanobacterial species (Caspi J, et al. Mol. Microbiol. 50: 1569-1577 (2003)). Thus, in some embodiments of the present disclosure, a natural split intein is selected from DnaE inteins.
- DnaE inteins include Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- a split intein is an engineered split intein.
- Engineered split inteins may be produced from contiguous inteins (where a contiguous intein is artificially split) or may be modified natural split inteins that, for example, promote efficient protein purification, ligation, modification and cyclization (e.g., NpuGEP and CfaGEP, as described by Stevens, AJ PNAS 114(32): 8538-8543 (2017)).
- Methods for engineering split inteins are described, for example, by Aranko, AS et al. Protein Eng Des Sel. 27(8): 263-271 (2014), incorporated herein by reference.
- the engineered split intein is engineered from DnaB inteins (Wu, H, et al. Biochim Biophys Acta 1387(1-2): 422-432 (1998)).
- the engineered split intein may be a S ⁇ p DnaB S 1 intein.
- the engineered split intein is engineered from GyrB inteins.
- the engineered split intein may be a SspGyrB S l l intein.
- the first intein may be the same as the second intein (e.g., both DnaE inteins). In other embodiments, two different inteins may be used (e.g., a DnaE intein and a DnaB intein). In some embodiments, the first intein is a NpaDnaE intein and the second intein is a NpaDnaE intein.
- Transgenic (e.g., double and/or triple transgenic) cells of the present disclosure are selected based on their expression of a full-length selectable marker protein.
- a selectable marker protein generally, confers a trait suitable for artificial selection. Examples of selectable marker proteins include antibiotic resistance proteins and fluorescent proteins.
- An antibiotic resistance gene is a gene encoding a protein that confers resistance to a particular antibiotic or class of antibiotics.
- antibiotic resistance genes for use in eukaryotic cells include those encoding proteins that confer resistance to hygromycin, G418, puromycin, phleomycin Dl or blasticidin.
- antibiotic resistance genes for use in prokaryotic cells include those encoding proteins that confer resistance to hygromycin, G418, puromycin, phleomycin Dl, blasticidin, kanamycin, spectinomycin, streptomycin, ampicillin, carbenicillin, bleomycin, erythromycin, polymyxin D, tetracycline and chloramphenicol.
- Hygromycin B is an antibiotic produced by the bacterium Streptomyces hygroscopicus. It is an aminoglycoside that kills bacteria, fungi and higher eukaryotic cells by inhibiting protein synthesis.
- Hygromycin phosphotransferase (HPT) encoded by the hpt gene (also referred to as the hph or aphlV gene) originally derived from Escherichia coli, detoxifies the aminocyclitol antibiotic hygromycin B.
- HPT Hygromycin phosphotransferase
- the selectable marker gene of the present disclosure is the hpt gene.
- G418 (GENETICIN ® ) is an aminoglycoside antibiotic similar in structure to gentamicin B l. It is produced by Micromonospora rhodorangea. G418 blocks polypeptide synthesis by inhibiting the elongation step in both prokaryotic and eukaryotic cells. Resistance to G418 is conferred by the neo gene from Tn5 encoding an aminoglycoside 3'-phosphotransferase, APT 3' II. G418 is an analog of neomycin sulfate, and has similar mechanism as neomycin. Thus, in some embodiments, the selectable marker gene of the present disclosure is the neo gene.
- Puromycin is an aminonucleoside antibiotic, derived from Streptomyces alboniger, that causes premature chain termination during translation taking place in the ribosome. Puromycin is selective for either prokaryotes or eukaryotes. Resistance to puromycin is conferred through expression of the puromycin N-acetyl-transferase (pac) gene.
- pac puromycin N-acetyl-transferase
- the selectable marker gene of the present disclosure is the pac gene.
- Phleomycin Dl is a glycopeptide antibiotic and one of the phleomycins from Streptomyces verticillus belonging to the bleomycin family of antibiotics. It is a broad- spectrum antibiotic that is effective against most bacteria, filamentous fungi, yeast, plant, and animal cells. It causes cell death by intercalating into DNA and induces double strand breaks of the DNA. Resistance to phleomycin Dl is conferred by the product of the Sh ble gene first isolated from Streptoalloteichus hindustanus. Thus, in some embodiments, the selectable marker gene of the present disclosure is the Sh ble gene.
- Blasticidin S is an antibiotic that is produced by Streptomyces griseochromogenes .
- Blasticidin prevents the growth of both eukaryotic and prokaryotic cells by inhibiting termination step of translation and peptide bond formation (to lesser extent) by the ribosome. Resistance to blasticidin is conferred by at least three different genes: bis (an acetyltransferase) from
- the selectable marker gene of the present disclosure is the bis gene, the bsr gene, or the bsd gene.
- Non-limiting examples of fluorescent proteins that may be used as provided herein include TagCFP, mTagCFP2, Czurite, ECFP2, mKalamal, Sirius, Sapphire, T-Sapphire, ECFP, Cerulean, SCFP3C, mTurquoise, mTurquoise2, monomeric Midoriishi-Cyan, TagCFP, mTFPl, EGFP, Emerald, Superfolder GFP, Monomeric Czami Green, TagGFP2, mUKG, mWasabi, Clover, mNeonGreen, EYFP, Citrine, Venus, SYFP2, TagYFP, Monomeric Kusabira-Orange, ⁇ , mK02, mOrange, mOrange2, mRaspberry, mCherry, mStrawberry, mScarlet, mTangerine, tdTomato, TagRFP, TagRFP-T, mCpple, mRuby,
- Full-length selectable marker genes are produced by joining in the same cell two selectable marker gene fragments.
- one of the fragments is an N-terminal fragment (N-extein), while the other fragment is a C-terminal fragment (C-extein).
- N-extein N-terminal fragment
- C-extein C-terminal fragment
- a first antibiotic resistance protein fragment is an N-terminal antibiotic resistance protein fragment
- a second antibiotic resistance protein fragment is a C-terminal antibiotic resistance protein fragment
- a first fluorescent protein fragment is an N-terminal fluorescent protein fragment
- a second fluorescent protein fragment is a C-terminal fluorescent protein fragment.
- full-length selectable marker genes are produced by joining in the same cell three or more selectable marker gene fragments.
- one of the fragments is an N-terminal fragment, one or more (e.g., 1, 2, or 3) of the fragments is a central fragment, and one of the fragments is a C-terminal fragment.
- An N-terminal fragment may be any protein fragment that includes the free amine group (- NH2) of the full-length protein.
- a C-terminal fragment may be any protein fragment that includes the free carboxyl group (-COOH).
- a central fragment may be any protein fragment that is located between the N-terminal fragment and the C-terminal fragment of the full-length protein.
- amino acids 1-89 of the gene encoding hygromycin (a 341 -amino acid protein) may be referred to as the N-terminal protein fragment, while amino acids 90-341 may be referred to as the C-terminal fragment.
- amino acids 1-200 of the gene encoding hygromycin may be referred to as the N-terminal protein fragment, while amino acids 201-341 may be referred to as the C-terminal fragment.
- FIG. 6 shows additional examples where amino acids 1-53, 1-240, or 1-292 are considered the N-terminal protein fragments of full length hygromycin containing amino acids 54-341, 241-341, or 293-341 as the respective C-terminal fragments.
- amino acids 1-52 of the gene encoding hygromycin (a 341 -amino acid protein) may be referred to as the N-terminal protein fragment
- amino acids 53-89 may be referred to as the central protein fragment
- amino acids 90-341 may be referred to as the C-terminal fragment.
- amino acids 1-89 of the gene encoding hygromycin may be referred to as the N-terminal protein fragment
- amino acids 90-240 may be referred to as the central fragment
- amino acids 241-341 may be referred to as the C-terminal fragment.
- the methods and compositions of the present disclosure are used, in some embodiments, to produce multi-transgenic (e.g., double and/or triple transgenic) cells and/or organisms.
- the methods use one vector that encodes a first molecule (a first molecule of interest) and another vector that encodes a second molecule (a second molecule of interest).
- the methods use yet another vector that encodes a third molecules of interest.
- Additional vectors may encode additional molecules of interest.
- Molecules of interest may be, for example, polypeptides (e.g., proteins and peptides) or polynucleotides (e.g., nucleic acids, such as DNA or RNA).
- the first molecule (e.g., located on the first vector) is a protein.
- the second molecule (e.g., located on the second vector) is a protein.
- the third molecule (e.g., located on the third vector) is a protein. Examples of proteins of interest include, but are not limited to, enzymes, cytokines, transcription factors, hormones, growth factors, blood factors, antigens and antibodies.
- the first molecule is a peptide.
- the second molecule is a peptide.
- the third molecule is a peptide.
- the first molecule is a messenger RNA (mRNA).
- mRNA messenger RNA
- the second molecule is a mRNA.
- the third molecule is a mRNA.
- the mRNA in some embodiments, encodes a vaccine or other antigenic molecule.
- the first molecule is a non-coding RNA (a RNA that does not encode a protein).
- the second molecule is a non-coding RNA.
- the third molecule is a non-coding RNA.
- non-coding RNA include, but are not limited to, RNA interference molecules, such as microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a vector is any nucleic acid that may be used as a vehicle to carry exogenous (foreign) genetic material into a cell.
- a vector in some embodiments, is a DNA sequence that includes an insert (e.g., transgene) and a larger sequence that serves as the backbone of the vector.
- Non-limiting examples of vectors include plasmids, viruses/viral vectors, cosmids, and artificial chromosomes, any of which may be used as provided herein.
- the vector is a viral vector, such as a viral particle.
- the vector is an RNA-based vector, such as a self- replicating RNA vector.
- the first vector is a plasmid
- the second vector is a plasmid
- the third vector is a plasmid.
- a vector includes a promoter operably linked to a nucleic acid encoding a fragment of an intein and a fragment of selectable marker protein.
- a vector also comprises a promoter operably linked to a nucleic acid, such as a transgene, encoding a molecule of interest.
- one vector (e.g., a first vector) comprises a nucleotide sequence encoding a first selectable marker protein fragment upstream from a nucleotide sequence encoding an N-terminal intein protein fragment
- the other vector e.g., a second vector
- This configuration is equivalent to one vector (e.g., a first vector) comprising a nucleotide sequence encoding an N-terminal intein protein fragment downstream from a nucleotide sequence encoding a first selectable marker protein fragment, and the other vector (e.g., a second vector) comprising a second antibiotic resistance protein fragment downstream from a nucleotide sequence encoding a C-terminal intein protein fragment.
- upstream and downstream refer to relative positions in a nucleic acid. Each nucleic acid has a 5' end and a 3' end, so named for the carbon position on the deoxyribose (or ribose) ring.
- upstream is toward the 5' end of the coding strand and downstream is toward the 3' end.
- a first vector comprises a nucleotide sequence encoding an N- terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein
- a second vector comprises a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein
- a third vector comprises a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a nucleotide sequence encoding a C-terminal fragment of the antibiotic resistance protein.
- This configuration is equivalent to a (a) a first vector comprising a nucleotide sequence encoding an N-terminal fragment of a first intein, which is downstream from a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, (b) a second vector comprising a nucleotide sequence encoding an N-terminal fragment of a second intein, which is downstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is downstream from a nucleotide sequence encoding a C-terminal fragment of the first intein, and (c) a third vector comprising a C-terminal fragment of the antibiotic resistance protein, which is downstream from a nucleotide sequence encoding a C-terminal fragment of the second intein.
- Methods of the present disclosure may be used for the production of transgenic cells and organisms by introducing into host cells the vectors (e.g., first and second vectors) described herein.
- the cells into which the vectors are introduced may be eukaryotic or prokaryotic.
- the cells are eukaryotic.
- Examples of eukaryotic cells for use as provided herein include mammalian cells, plant cells (e.g., crop cells), inset cells (e.g., Drosophila) and fungal cells (e.g., Saccharomyces).
- Mammalian cells may be, for example, human cells (stem cells or cells from an established cell line), primate cells, equine cells, bovine cells, porcine cells, canine cells, feline cells, or rodent cells (e.g., mouse or rat).
- mammalian cells for use as provided herein include, but are not limited to, Chinese hamster ovary (CHO) cells, human embryonic kidney (HEK) 293 cells, HeLa cells, and NSO cells.
- the cells are prokaryotic.
- prokaryotic cells for use as provided herein include bacterial cells.
- Bacterial cells may be, for example, Escherichia spp. (e.g., Escherichia coli), Streptococcus spp. (e.g., Streptococcus pyogenes, Streptococcus viridans, Streptococcus pneumoniae), Neisseria spp. (e.g., Neisseria gibirrhoea, Neisseria meningitidis), Corynebacterium spp. (e.g., Corynebacterium diphtheriae), Bacillis spp.
- Escherichia spp. e.g., Escherichia coli
- Streptococcus spp. e.g., Streptococcus pyogenes, Streptococcus viridans, Streptococcus pneumoniae
- Clostridium spp. e.g., Clostridium tetani, Clostridium perfringens, Clostridium novyii
- Mycobacterium spp. e.g., Mycobacterium tuberculosis
- Shigella spp. e.g., Shigella flexneri, Shigella dysenteriae
- Salmonella spp. e.g., Salmonella typhi, Salmonella enteritidis
- Klebsiella spp. e.g., Klebsiella pneumoniae
- Yersinia spp. e.g., Yersinia pestis
- Serratia spp. e.g., Serratia marcescens
- Pseudomonas spp. e.g., Pseudomonas aeruginosa, Pseudomonas mallei
- Eikenella spp. e.g., Eikenella corrodens
- Vibrio spp. e.g., Vibrio cholera, Vibrio natriegens
- Legionella spp. e.g., Legionella micdadei, Legionella bozemani
- Brucella spp. e.g., Brucella abortus
- Mycoplasma spp. e.g., Mycoplasma pneumoniae
- Streptomyces spp. e.g. Streptomyces coelicolor
- Methods of the present disclosure include delivering vectors to a composition comprising cells and maintaining the composition under conditions that permit introduction of nucleic acid (e.g., first, second, and third vector) into the cells and permit nucleic acid expression in the cells to produce eukaryotic cells.
- Conditions required for the introduction of nucleic acid (e.g., vectors) into cells are well known. These conditions include, for example, transformation (of prokaryotic cells) conditions, transfection (of eukaryotic cells) conditions, transduction (via virus/viral vector) conditions, and electroporation conditions, any of which may be used as provided herein.
- methods of the present disclosure include transfecting eukaryotic (e.g. mammalian) cells, while in other embodiments, the methods include transforming prokaryotic (e.g., bacterial) cells.
- transgenic e.g., multi-transgenic cells, such as double, triple, and/or quarduple transgenic cells depends on the type of selectable marker used.
- the selectable marker protein is an antibiotic resistance protein
- the selection step may include exposing the cells to a specific antibiotic and selecting only those cells that survive.
- the selectable marker protein is a fluorescent protein
- the selection step may include simply viewing the cells under a microscope and selecting cells that fluoresce, or the selection step may include other fluorescent selection methods, such as fluorescence-activated cell sorting (FACS) sorting.
- FACS fluorescence-activated cell sorting
- cells are transduced with viral vectors (e.g., viruses) carrying the nucleic acids as described herein.
- viral vectors e.g., viruses
- cells prior to transduction (or other transfection methed), cells are seeded, for example, on well plates (e.g., 12-well plates) at a density of lxlO 4 to lxlO 6 per well.
- well plates e.g., 12-well plates
- 100 ⁇ . to 500 ⁇ e.g., 100, 150, 200, 250, 300, 350, 400, 450, or 500 ⁇ ⁇ of each viral vector is added to each well.
- kits that may be used, for example, to produce and screen for transgenic cells and/or organisms.
- the kits may include any two or more components as described herein.
- a kit may comprise (a) a first vector comprising a nucleotide sequence encoding a first selectable marker protein fragment upstream from a nucleotide sequence encoding an N-terminal intein protein fragment; and (b) a second vector comprising a nucleotide sequence encoding a C-terminal intein protein fragment upstream from a second selectable marker protein fragment, wherein the N-terminal intein protein fragment and the C-terminal intein protein fragment catalyze joining of the first selectable marker protein fragment to the second selectable marker protein fragment to produce a full-length antibiotic resistance protein.
- kits include any two or more components as described herein.
- a kit may comprise (a) a first vector comprising a nucleotide sequence encoding an N- terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein, (b) a second vector comprising a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein, and (c) a third vector comprising a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a nucleotide sequence encoding a C-terminal fragment of the antibiotic resistance protein, wherein the N-terminal fragment and
- kits further comprise any one or more of the following components: buffers, salts, cloning enzymes (e.g., LR clonase), competent cells (e.g., competent bacterial cells), transfection reagents, antibiotics, and/or instructions for performing the methods described herein.
- cloning enzymes e.g., LR clonase
- competent cells e.g., competent bacterial cells
- transfection reagents e.g., antibiotics, and/or instructions for performing the methods described herein.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N- terminal fragment of an intein and (ii) a nucleotide sequence encoding a first molecule of interest;
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the antibiotic resistance protein and (ii) a nucleotide sequence encoding a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of the N-terminal fragment and the C-terminal fragment of the antibiotic resistance protein to produce a full-length antibiotic resistance protein.
- paragraph 1 further comprising maintaining the eukaryotic cells under conditions that permit introduction of the first and second vectors into the eukaryotic cells to produce transgenic eukaryotic cells.
- DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- split intein is an engineered split intein.
- non-coding RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- first and/or second vector is a plasmid vector or a viral vector.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) an N-terminal fragment of a hygB gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the hygB gene and (ii) a second molecule of interest,
- N-terminal fragment and C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the hygB gene to a protein fragment encoded by the C-terminal fragment of the hygB gene to produce full-length hygromycin B pho spho transferase .
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-89 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 90-341 of SEQ ID NO: 1 ;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-200 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 201-341 of SEQ ID NO: 1 ;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-53 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 54-341 of SEQ ID NO: 1;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-240 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 241-341 of SEQ ID NO: 1;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-292 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 293-341 of SEQ ID NO: 1.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) a N-terminal fragment of a bsr gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the bsr gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the bsr gene to a protein fragment encoded by the C-terminal fragment of the bsr gene to produce full-length blasticidin-S deaminase.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) a N-terminal fragment of a pac gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the pac gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the pac gene to a protein fragment encoded by the C-terminal fragment of the pac gene to produce full-length puromycin N-acetyl-transferase.
- the protein fragment encoded by the N-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 1-63 of SEQ ID NO: 2
- the protein fragment encoded by the C-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 64-199 of SEQ ID NO: 2;
- the protein fragment encoded by the N-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 1-119 of SEQ ID NO: 2
- the protein fragment encoded by the C-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 120-199 of SEQ ID NO: 2;
- the protein fragment encoded by the N-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 1-100 of SEQ ID NO: 2
- the protein fragment encoded by the C-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 101-199 of SEQ ID NO: 2.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) a N-terminal fragment of a neo gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the neo gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the neo gene to a protein fragment encoded by the C-terminal fragment of the neo gene to produce full-length aminoglycoside 3'- pho spho transferase .
- the protein fragment encoded by the N-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 1-133 of SEQ ID NO: 3 and the protein fragment encoded by the C-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 134-267 of SEQ ID NO: 3; or
- the protein fragment encoded by the N-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 1-194 of SEQ ID NO: 3 and the protein fragment encoded by the C-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 195-267 of SEQ ID NO: 3.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a method comprising delivering to a composition comprising eukaryotic cells
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a nucleotide sequence encoding a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the fluorescent protein and (ii) a nucleotide sequence encoding a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of the N-terminal fragment of the fluorescent protein to the C-terminal fragment of the fluorescent protein to produce a full-length fluorescent protein. 33.
- the method of paragraph 51 further comprising maintaining the eukaryotic cells under conditions that permit introduction of the first and second vectors into the eukaryotic cells to produce transgenic eukaryotic cells.
- the fluorescent protein is selected from TagCFP, mTagCFP2, Czurite, ECFP2, mKalamal, Sirius, Sapphire, T-Sapphire, ECFP, Cerulean, SCFP3C, mTurquoise, mTurquoise2, monomeric Midoriishi-Cyan, TagCFP, mTFPl, EGFP, Emerald, Superfolder GFP, Monomeric Czami Green, TagGFP2, mUKG, mWasabi, Clover, mNeonGreen, EYFP, Citrine, Venus, SYFP2, TagYFP, Monomeric Kusabira-Orange, ⁇ , mK02, mOrange, mOrange2, mRaspberry, mCherry, mStrawberry, mTangerine, tdTomato, TagRFP, TagPvFP-T, mCpple, mRuby,
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- split intein is an engineered split intein.
- non-coding RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a first vector comprising (i) an N-terminal fragment of an egfp gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of an intein, which is upstream from a C-terminal fragment of an egfp gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the egfp gene to a protein fragment encoded by the C-terminal fragment of the egfp gene to produce full-length EGFP protein.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) an N-terminal fragment of an mScarlet gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of an intein, which is upstream from a C-terminal fragment of an mScarlet gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the mScarlet gene to a protein fragment encoded by the C-terminal fragment of the mScarlet gene to produce full-length mScarlet protein.
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-46 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 47-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-48 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 49-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-51 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 52-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-75 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 76-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-122 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 123-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-140 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 141-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-163 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 164-232 of SEQ ID NO: 6.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a eukaryotic cell comprising
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N- terminal fragment of an intein and (ii) a nucleotide sequence encoding a first molecule of interest;
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the antibiotic resistance protein and (ii) a nucleotide sequence encoding a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of the N-terminal fragment and the C-terminal fragment of the antibiotic resistance protein to produce a full-length antibiotic resistance protein.
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- split intein is an engineered split intein.
- RNA non- coding ribonucleic acid
- non-coding RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a first vector comprising (i) an N-terminal fragment of a hygB gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the hygB gene and (ii) a second molecule of interest,
- N-terminal fragment and C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the hygB gene to a protein fragment encoded by the C-terminal fragment of the hygB gene to produce full-length hygromycin B pho spho transferase .
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-89 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 90-341 of SEQ ID NO: 1 ;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-200 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 201-341 of SEQ ID NO: 1 ;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-53 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 54-341 of SEQ ID NO: 1 ;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-240 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 241-341 of SEQ ID NO: 1 ;
- the protein fragment encoded by the N-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 1-292 of SEQ ID NO: 1
- the protein fragment encoded by the C-terminal fragment of the hygB gene comprises an amino acid sequence identified by amino acids 293-341 of SEQ ID NO: 1.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a eukaryotic cell comprising
- a first vector comprising (i) a N-terminal fragment of a bsr gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the bsr gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the bsr gene to a protein fragment encoded by the C-terminal fragment of the bsr gene to produce full-length blasticidin-S deaminase.
- the protein fragment encoded by the C-terminal fragment of the bsr gene comprises an amino acid sequence identified by amino acids 103-140 of SEQ ID NO: 4.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a eukaryotic cell comprising
- a first vector comprising (i) a N-terminal fragment of a pac gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the pac gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the pac gene to a protein fragment encoded by the C-terminal fragment of the pac gene to produce full-length puromycin N-acetyl-transferase.
- the protein fragment encoded by the N-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 1-63 of SEQ ID NO: 2
- the protein fragment encoded by the C-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 64-199 of SEQ ID NO: 2;
- the protein fragment encoded by the N-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 1-119 of SEQ ID NO: 2
- the protein fragment encoded by the C-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 120-199 of SEQ ID NO: 2;
- the protein fragment encoded by the N-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 1-100 of SEQ ID NO: 2
- the protein fragment encoded by the C-terminal fragment of the pac gene comprises an amino acid sequence identified by amino acids 101-199 of SEQ ID NO: 2.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a eukaryotic cell comprising
- a first vector comprising (i) a N-terminal fragment of a neo gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the neo gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the neo gene to a protein fragment encoded by the C-terminal fragment of the neo gene to produce full-length aminoglycoside 3'- phosphotransferase.
- the protein fragment encoded by the N-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 1-133 of SEQ ID NO: 3 and the protein fragment encoded by the C-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 134-267 of SEQ ID NO: 3; or the protein fragment encoded by the N-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 1-194 of SEQ ID NO: 3 and the protein fragment encoded by the C-terminal fragment of the neo gene comprises an amino acid sequence identified by amino acids 195-267 of SEQ ID NO: 3.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a eukaryotic cell comprising
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a nucleotide sequence encoding a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the fluorescent protein and (ii) a nucleotide sequence encoding a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of the N-terminal fragment of the fluorescent protein to the C-terminal fragment of the fluorescent protein to produce a full-length fluorescent protein.
- the cell of paragraph 85 further comprising maintaining the eukaryotic cells under conditions that permit introduction of the first and second vectors into the eukaryotic cells to produce transgenic eukaryotic cells.
- the cell of paragraph 86 further comprising selecting the transgenic eukaryotic cells that comprise the full-length fluorescent protein.
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpaDnaE) inteins.
- split intein is an engineered split intein.
- RNA non- coding ribonucleic acid
- non-coding RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a eukaryotic cell comprising
- a first vector comprising (i) an N-terminal fragment of an egfp gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of an intein, which is upstream from a C-terminal fragment of an egfp gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the egfp gene to a protein fragment encoded by the C-terminal fragment of the egfp gene to produce full-length EGFP protein.
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- a eukaryotic cell comprising
- a first vector comprising (i) an N-terminal fragment of an mScarlet gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of an intein and (ii) a first molecule of interest;
- a second vector comprising (ii) a nucleotide sequence encoding a C-terminal fragment of an intein, which is upstream from a C-terminal fragment of an mScarlet gene and (ii) a second molecule of interest,
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of a protein fragment encoded by the N-terminal fragment of the mScarlet gene to a protein fragment encoded by the C-terminal fragment of the mScarlet gene to produce full-length mScarlet protein.
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-46 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 47-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-48 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 49-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-51 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 52-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-75 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 76-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-122 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 123-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-140 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 141-232 of SEQ ID NO: 6;
- the protein fragment encoded by the N-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 1-163 of SEQ ID NO: 6, and the protein fragment encoded by the C-terminal fragment of the mScarlet gene comprises an amino acid sequence identified by amino acids 164-232 of SEQ ID NO: 6.
- the N-terminal fragment of the intein is identified by SEQ ID NO: 16
- the C-terminal fragment of the intein is identified by SEQ ID NO: 17;
- the N-terminal fragment of the intein is identified by SEQ ID NO:7, and the C-terminal fragment of the intein is identified by SEQ ID NO:8; or
- the N-terminal fragment of the intein is identified by SEQ ID NO: 18 or SEQ ID NO:9
- the C-terminal fragment of the intein is identified by SEQ ID NO: 19 or SEQ ID NO: 10.
- composition comprising the cell of any one of paragraph 85-108.
- a kit comprising
- N-terminal fragment and the C-terminal fragment of the intein catalyze joining of the N-terminal fragment and the C-terminal fragment of the antibiotic resistance protein to produce a full-length antibiotic resistance protein.
- kits of paragraph 110 wherein the antibiotic resistance protein confers resistance to hygromycin, G418, puromycin, phleomycin Dl or blasticidin.
- a kit comprising
- a second vector comprising a nucleotide sequence encoding a C-terminal fragment of the intein, which is upstream from a C-terminal fragment of the fluorescent protein, wherein the N-terminal fragment and the C-terminal fragment of the intein catalyze joining of the N-terminal fragment of the fluorescent protein to the C-terminal fragment of the fluorescent protein to produce a full-length fluorescent protein.
- the fluorescent protein is selected from TagCFP, mTagCFP2, Czurite, ECFP2, mKalamal, Sirius, Sapphire, T-Sapphire, ECFP, Cerulean, SCFP3C, mTurquoise, mTurquoise2, monomeric Midoriishi-Cyan, TagCFP, mTFPl, EGFP, Emerald, Superfolder GFP, Monomeric Czami Green, TagGFP2, mUKG, mWasabi, Clover, mNeonGreen, EYFP, Citrine, Venus, SYFP2, TagYFP, Monomeric Kusabira-Orange, ⁇ , mK02, mOrange, mOrange2, mRaspberry, mCherry, mStrawberry, mTangerine, tdTomato, TagRFP, TagRFP-T, mCpple, mRuby, mRuby2, mRuby2, mRuby2,
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- kit of any one of paragraphs 112- 120 further comprising any one or more of the following components: buffers, salts, cloning enzymes, competent cells, transfection reagents, antibiotics, and/or instructions for performing the methods described herein.
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N- terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest,
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and (c) a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a nucleotide sequence encoding a C-terminal fragment of the antibiotic resistance protein and (ii) a nucleotide sequence encoding a third molecule of interest, wherein the N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of N-terminal fragment of the antibiotic resistance protein to the central fragment of the antibiotic resistance protein, and the
- the method of paragraph 112 further comprising maintaining the eukaryotic cells under conditions that permit introduction of the first, second, and third vectors into the eukaryotic cells to produce transgenic eukaryotic cells.
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- non-coding RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) an N-terminal fragment of a hygB gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest,
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a central fragment of the hygB gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and
- a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a C-terminal fragment of the hygB gene and (ii) a nucleotide sequence encoding a third molecule of interest,
- N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of the protein fragment encoded by N-terminal fragment of the hygB gene to a protein fragment encoded by the central fragment of the hygB gene
- the N-terminal fragment and the C- terminal fragment of the second intein catalyze joining of the protein fragment encoded by the central fragment of the hygB gene to the protein fragment encoded by the C-terminal fragment of the hygB gene, to produce a full-length hygromycin B phosphotransferase.
- a eukaryotic cell comprising:
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N- terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest,
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and
- a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a nucleotide sequence encoding a C-terminal fragment of the antibiotic resistance protein and (ii) a nucleotide sequence encoding a third molecule of interest, wherein the N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of N-terminal fragment of the antibiotic resistance protein to the central fragment of the antibiotic resistance protein, and the N-terminal fragment and the C-terminal fragment of the second intein catalyze joining of central fragment of the antibiotic resistance protein to the C-terminal fragment of the antibiotic resistance protein, to produce a full-length antibiotic resistance protein.
- RNA ribonucleic acid
- miRNA short-interfering RNA
- shRNA short-hairpin RNA
- composition comprising the eukaryotic cell of any one of paragraph 142- 154.
- a kit comprising:
- a first vector comprising a nucleotide sequence encoding an N-terminal fragment of an antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein
- a second vector comprising a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the antibiotic resistance protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein, and
- N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of N-terminal fragment of the antibiotic resistance protein to the central fragment of the antibiotic resistance protein
- the N-terminal fragment and the C-terminal fragment of the second intein catalyze joining of central fragment of the antibiotic resistance protein to the C-terminal fragment of the antibiotic resistance protein, to produce a full-length antibiotic resistance protein.
- the antibiotic resistance protein confers resistance to hygromycin, G418, puromycin, phleomycin Dl or blasticidin.
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpuDnaE) inteins.
- kit of any one of paragraphs 156- 164, wherein the first molecule of interest, second molecule of interest, third molecule of interest, or any combination thereof is a protein.
- kit of any one of paragraphs 156- 164, wherein the first molecule of interest, second molecule of interest, third molecule of interest, or any combination thereof is a non-coding ribonucleic acid (RNA).
- RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest,
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and
- a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a nucleotide sequence encoding a C-terminal fragment of the fluorescent protein and (ii) a nucleotide sequence encoding a third molecule of interest,
- N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of N-terminal fragment of the fluorescent protein to the central fragment of the fluorescent protein
- the N-terminal fragment and the C-terminal fragment of the second intein catalyze joining of central fragment of the fluorescent protein to the C-terminal fragment of the fluorescent protein, to produce a full-length fluorescent protein
- the method of paragraph 169 further comprising maintaining the eukaryotic cells under conditions that permit introduction of the first, second, and third vectors into the eukaryotic cells to produce transgenic eukaryotic cells.
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpaDnaE) inteins.
- RNA ribonucleic acid
- non-coding RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- a method comprising delivering to eukaryotic cells
- a first vector comprising (i) an N-terminal fragment of a mScarlet gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest,
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a central fragment of the mScarlet gene, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and
- a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a C-terminal fragment of the mScarlet gene and (ii) a nucleotide sequence encoding a third molecule of interest,
- N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of the protein fragment encoded by N-terminal fragment of the mScarlet gene to a protein fragment encoded by the central fragment of the mScarlet gene
- the N-terminal fragment and the C-terminal fragment of the second intein catalyze joining of the protein fragment encoded by the central fragment of the mScarlet gene to the protein fragment encoded by the C-terminal fragment of the mScarlet gene, to produce a full-length mScarlet protein.
- a eukaryotic cell comprising: (a) a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest,
- a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and
- a third vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the second intein, which is upstream from a nucleotide sequence encoding a C-terminal fragment of the fluorescent protein and (ii) a nucleotide sequence encoding a third molecule of interest,
- N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of N-terminal fragment of the fluorescent protein to the central fragment of the fluorescent protein
- the N-terminal fragment and the C-terminal fragment of the second intein catalyze joining of central fragment of the fluorescent protein to the C-terminal fragment of the fluorescent protein, to produce a full-length fluorescent protein
- RNA ribonucleic acid
- miRNA short-interfering RNA
- shRNA short-hairpin RNA
- composition comprising the eukaryotic cell of any one of paragraph 185-200.
- a kit comprising:
- a first vector comprising a nucleotide sequence encoding an N-terminal fragment of a fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein
- a second vector comprising a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the fluorescent protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein, and
- N-terminal fragment and the C-terminal fragment of the first intein catalyze joining of N-terminal fragment of the fluorescent protein to the central fragment of the fluorescent protein
- the N-terminal fragment and the C-terminal fragment of the second intein catalyze joining of central fragment of the fluorescent protein to the C-terminal fragment of the fluorescent protein, to produce a full-length fluorescent protein
- the fluorescent protein is selected from TagCFP, mTagCFP2, Czurite, ECFP2, mKalamal, Sirius, Sapphire, T-Sapphire, ECFP, Cerulean, SCFP3C, mTurquoise, mTurquoise2, monomeric Midoriishi-Cyan, TagCFP, mTFPl, EGFP, Emerald,
- DnaE inteins are selected from Synechocystis sp. DnaE (SspOnaE) inteins and Nostoc punctiforme (NpaDnaE) inteins.
- kit of any one of paragraphs 202-210, wherein the first molecule of interest, second molecule of interest, third molecule of interest, or any combination thereof is a protein.
- kit of any one of paragraphs 202-210, wherein the first molecule of interest, second molecule of interest, third molecule of interest, or any combination thereof is a non-coding ribonucleic acid (RNA).
- RNA is a microRNA (miRNA), antisense RNA, short-interfering RNA (siRNA) or short-hairpin RNA (shRNA).
- miRNA microRNA
- siRNA short-interfering RNA
- shRNA short-hairpin RNA
- kit of any one of paragraphs 202-214 further comprising any one or more of the following components: buffers, salts, cloning enzymes, competent cells, transfection reagents, antibiotics, and/or instructions for performing the methods described herein.
- a transgenic selection method comprising delivering to a composition comprising eukaryotic cells (a) a first vector comprising (i) a nucleotide sequence encoding a first selectable marker protein fragment (e.g., antibiotic resistance protein fragment or fluorescent protein fragment) upstream from a nucleotide sequence encoding an N-terminal intein protein fragment and (ii) a nucleotide sequence encoding a first molecule, and (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal intein protein fragment upstream from a second selectable marker protein fragment (e.g., antibiotic resistance protein fragment or fluorescent protein fragment) and (ii) a nucleotide sequence encoding a second molecule, wherein the N- terminal intein protein fragment and the C-terminal intein protein fragment catalyze joining of the first selectable marker protein fragment to the second selectable marker protein fragment to produce a full-length selectable marker protein.
- a transgenic selection method comprising delivering to eukaryotic cells (a) a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a selectable marker protein (e.g., antibiotic resistance protein or fluorescent protein), which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest, (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a central fragment of the selectable marker protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, and (c) a third vector comprising (i) a nucleot
- a transgenic selection method comprising delivering to eukaryotic cells (a) a first vector comprising (i) a nucleotide sequence encoding an N-terminal fragment of a selectable marker protein (e.g., antibiotic resistance protein or fluorescent protein), which is upstream from a nucleotide sequence encoding an N-terminal fragment of a first intein and (ii) a nucleotide sequence encoding a first molecule of interest, (b) a second vector comprising (i) a nucleotide sequence encoding a C-terminal fragment of the first intein, which is upstream from a nucleotide sequence encoding a first central fragment of the selectable marker protein, which is upstream from a nucleotide sequence encoding an N-terminal fragment of a second intein and (ii) a nucleotide sequence encoding a second molecule of interest, (c) a third vector comprising (i) a nucleot
- RNAs non-coding ribonucleic acids
- non-coding RNAs are selected from microRNAs (miRNAs), antisense RNAs, short-interfering RNAs (siRNAs), and short-hairpin RNAs (shRNAs).
- miRNAs microRNAs
- siRNAs antisense RNAs
- shRNAs short-hairpin RNAs
- Selectable markers are often used in genetic engineering to isolate cells with desired genotypes [1].
- antibiotic resistance genes for use in eukaryotic cells and a limited number of fluorescent proteins whose spectra can be unambiguously differentiated by equipment in ordinary laboratories.
- researchers often run into the problem of not having enough choices of selectable markers if they are to incorporate multiple transgenes into a cell.
- selection with multiple antibiotics at the same time is often harsh to cells.
- Selectable marker recycling may provide a work-around, however, requiring multiple rounds of transgenesis, selection and removal of selection markers [2].
- each markertron is inserted onto a transgenic vector carrying a specific transgene. Delivery of transgenic vectors containing a set of markertrons yield cells harboring a subset or a complete set of the marketrons. Only cells containing a complete set of markertrons produce a fully reconstituted marker protein via protein splicing and thus passes through selection while cells with partial sets of markertrons are eliminated, achieving co-selection of cells containing all intended transgenes.
- Intres markers To facilitate adoption of Intres markers, we created Gateway-compatible lentiviral vectors for convenient restriction-ligation-independent LR clonase recombination of transgenes 8 (FIG. 7A). We tested the functionality of these vectors by recombining TagBPF2 and mCherry, respectively to the N- and C-Intres vectors and found robust selection of double transgenic cells (FIG. 7B).
- One potential utility of Intres vectors is to install different fluorescent markers in cells to label different cellular compartments. To explore such utility, we cloned in NLS-GFP and LifeAct- mScarlet 9, which label nucleus and F-actin, respectively, by Gateway recombination to
- split fluorescent markers can be used for transgene selection.
- FIG. 8A NpuDnaE split points for mScarlet fluorescent protein
- FIG. 8B To test whether split fluorescent markers can be used for transgene selection, we screened for NpuDnaE split points for mScarlet fluorescent protein (FIG. 8A) and identified four split points allowing for >96% enrichment of double transgenic cells and three other split points enabling >60% enrichment of double transgenic cells in mScarlet-gated population, compared to ⁇ 20% double transgenic cells in non-gated population.
- split points identified for 2-markertron Intres genes we set out to engineer higher degree split markers.
- We tested combinations of splits points to partition a marker gene into three or more markertrons to allow for co-selection of more than two "unlinked" transgenes with one antibiotics (FIGS. 9A-9B).
- FIG. 10A Gateway compatible lentiviral vectors with these markers.
- Three sets of these vectors were each tested by recombining TagBFP (as transgene 1), EGFP (as transgene 2) and mCherry (as transgene 3) into the N-, M-, and C-Intres Gateway destination vectors and used to transduce U20S cells, which were then split and cultured in hygromycin selection or non-selective media (FIG. 10B). Two weeks after selection, cells were analyzed by flow cytometry. All three sets of 3-markertron hygromycin Intres plasmids support triple transgenic cell selection of >99% compared to ⁇ 25% in the non-selected cultures (FIG. IOC).
- NpuDnaE intein an enhanced variant of NpuDnaE intein known as NpuDnaGEP 10 fused with leucine zipper motifs 11 in combination with the SspDnaB intein. While transduction of all four plasmids containing constituent markertrons produced cells that survived hygromycin selection, leave-one- out transduction did not yield any survival (Table 2).
- CRISPPv/Cas has recently emerged as a powerful technology for genome engineering and editing.
- gene knockout based on NHEJ-mediated insertions/deletions occur at high frequency, precise editing and knock-in based on homology directed repair (HDR) using exogenous repair templates (a.k.a targeting constructs) are inefficient.
- HDR homology directed repair
- split selectable markers can be incorporated into lentiviral vectors or gene targeting constructs in CRISPR/Cas9 genome editing experiments to enable enrichment of cells with double transgenesis or biallelic knock-ins.
- 3- and 4-split markers can be generated to allow higher degree transgenic selection. Future development of even higher-degree split selectable markers may enable "hyper-engineering" of cells containing tens of transgenes or targeted knock- ins.
- the markertron-ORF Gateway donor plasmids were generated either by a nested fusion PCR procedure to combine intein with the coding sequence of fragments of the selectable marker followed by insertion into the pCR8-GW-TOPO plasmid by sequence- and ligation-independent cloning (SLIC) (Li, M.Z. & Elledge, S.J. SLIC: a method for sequence-and ligation-independent cloning.
- DMEM Dulbecco's modified Eagle's medium
- FBS fetal bovine serum
- Gibco Glutamax
- Sodium Pyruvate Gibco
- penicillin-streptomycin Gibco
- a viral packaging mix of pLPl, pLP2, and VSV-G were co-transfected with each lentiviral vector into Lenti-X 293T cells (ClonTech), seeded the day before in 6-well plates at a concentration of 1.2xl0 6 cells per well, using Lipofectamine 3000. Media was changed 6h after transfection then incubated overnight. 28 hour post transfection, the media supernatant containing virus was filtered using 45uM PES filters then stored at -80°C until use.
- target cells HEK293T, MCF7, U2-OS
- media Prior to transduction, media was changed to media containing 10 ⁇ g/mL polybrene, 1 mL per well. 250 ⁇ ⁇ of each respective virus (500 ⁇ ⁇ total for experimental samples with two viruses added) was added to each well and incubated overnight. Media was changed 24 hour post infection. 4 day post infection cells were split into duplicate plates. 5 day post infection media with antibiotic (hygromycin) was added to each respective well of one replicate plate (the other remained under no selection). Antibiotic selection continued for 2 weeks before analysis on FACS.
- antibiotic hygromycin
- IKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN (SEQ ID NO: 8)
- VKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAAN SEQ ID NO: 17
- Plasmid 3 pLX-Hygro(l-89)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 4 pLX-NpuDnaE(C)-Hygro(90-341)-IRES-mCherry
- Plasmid 5 pLX-Hygro(l-200)-SspDnaB(N)-IRES-TagBFP2
- Plasmid 6 pLX-SspDnaB(C)-Hygro(201-341)-IRES-mCherry
- Plasmid 7 pLX-Hygro(l-52)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 21 pLX-Neo(l-133)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 22 pLX-NpuDnaE(C)-Neo(134-267)-IRES-mCherry
- Plasmid 23 pLX-Neo( 1 - 194)-NpuDnaE(N)-IRES -TagBFP2
- Plasmid 24 pLX-NpuDnaE(C)-Neo( 195-267)-IRES-mCherry
- Plasmid 27 pCR8-BsaI->ccdbCam ⁇ -BsaI-NpuDnaE(N)-MDl-68-15 (SEQ ID NO:64)
- Plasmid 28 pCR8-NpuDnaE(C)_BsaI->ccdbCam ⁇ -BsaI-MDl-68-18 (SEQ ID NO:65)
- Plasmid 29 pCR8-BsaI->ccdbCam ⁇ -BsaI-SspDnaE(N)-MDl-68-12 (SEQ ID NO:66)
- Plasmid 30 pCR8-SspDnaE(C)_BsaI->ccdbCam ⁇ -BsaI-MDl-68-13 (SEQ ID NO:67)
- Plasmid 31 pCR8-BsaI->ccdbCam ⁇ -BsaI-SspDnaB(N-S0)-25-135-18 (SEQ ID NO:68)
- Plasmid 32 pCR8-SspDnaB(C-S0)_BsaI->ccdbCam ⁇ -BsaI-25-
- Plasmid 33 pLX-mScarlet(l-46)-NpuDnaE(N)_LZA-IRES-TagBFP2
- Protein mScarlet(l-46)-NpuDnaE(N)_LZA
- Plasmid 35 pLX-mScarlet(l-48)-NpuDnaE(N)_LZA-IRES-TagBFP2
- Protein mScarlet(l-48)-NpuDnaE(N)_LZA
- Plasmid 36 pLX-LZB_NpuDnaE(C)-mScarlet(insCys;49-232)-IRES-GFP
- Plasmid 37 pLX-mScarlet(l-51)-NpuDnaE(N)_LZA -IRES-TagBFP2
- Protein mScarlet(l-51)-NpuDnaE(N)_LZA
- Plasmid 47 pCR8-TagBFP2
- Plasmid 48 pCR8-mCherry
- Plasmid 51 pLX-[TagBFP2]-IRES-Hygro(l-89)-NpuDnaE(N) Vector sequence (SEQ ID NO: 106)
- Plasmid 52 pLX-[mCherry]-IRES-NpuDnaE(C)-Hygro(90-341) Vector sequence (SEQ ID NO: 107)
- Plasmid 57 pLX-DEST-IRES-Neo(l-194)-NpuDnaE(N)
- Plasmid 58 pLX-DEST-IRES-NpuDnaE(C)-Neo(195-267)
- Plasmid 59 pLX-[TagBFP2]-IRES-Neo(l-194)-NpuDnaE(N)
- Plasmid 60 pLX-[mCherry]-IRES-NpuDnaE(C)-Neo(195-267)
- Plasmid 61 pLX-mScarlet(l-51)-NpuDnaE(N)-LZA-IRES-TagBFP2
- Protein mScarlet(l-51)-NpuDnaE(N)-LZA
- Plasmid 63 pLX-LZB-NpuDnaE(C)-mScarlet( A C; 164-232)-IRES-EGFP
- Plasmid 64 pLX-Hygro(l-69)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 65 pLX-NpuDnaE(C)-Hygro( A C;70-341)-IRES-mCherry
- Plasmid 76 pLX-Puro(l-32)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 77 pLX-NpuDnaE(C)-Piiro( A C;33-199)-IRES-mCherry
- Plasmid 78 pLX-Puro( l -84)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 79 pLX-NpuDnaE(C)-Puro( A C;85-199)-IRES-mCherry
- Plasmid 80 pLX-Puro(l-137)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 81 pLX-NpuDnaE(C)-Puro( A C; 138-199)-IRES-mCherry
- Plasmid 82 pLX-Puro(l- 158)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 84 pLX-Puro(l -180)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 86 pLX-Blast( l-58)-NpuDnaE(N)-IRES-TagBFP2
- Plasmid 91 pLX-Hygro(l-200)-SspDnaB(N-S0)-IRES-TagBFP2
- Plasmid 94 pLX-DEST-IRES-TagBFP2 (SEQ ID NO: 186)
- Plasmid 95 pLX-DEST-IRES-EGFP (SEQ ID NO: 187)
- Plasmid 96 pLX-DEST-IRES-mCherry (SEQ ID NO: 188)
- Plasmid 97 pLX-Hygro-IRES-TagBFP2
- Plasmid 98 Plasmid 98: pLX-Hygro-IRES-mCherry
- Plasmid 99 pLX-Puro-IRES-TagBFP2
- Plasmid 100 pLX-Puro-IRES-mCherry
- Plasmid 101 pLX-Hygro-IRES-EGFP
- Plasmid 102 pLX-NLS_GFP-IRES-Hygro Vector sequence (SEQ ID NO: 194)
- Plasmid 103 pLX-LifeAct_mCherry-IRES-Hygro
- Plasmid 104 pLX-NLS_GFP-IRES-Hygro(l-89)-NpuDnaE(N)
- Plasmid 105 pLX-LifeAct_mScarlet-IRES- NpuDnaE(C)-Hygro(90-341)
- Plasmid 106 pX330-AAVS l
- sgRNA spacer sequence gACCCCACAGTGGGGCCACTA (First g does not match genome) (SEQ ID NO: 198)
- Vector sequence SEQ ID NO: 199
- Plasmid 107 pAAVS l -Nst-EFl aHygro2ArtTA3(-)_TetO-Blast-P2A-EGFP
- Plasmid 108 pAAVS l -Nst-EFl aHygro2ArtTA3(-)_TetO-Blast-P2A-mScarlet
- Plasmid 109 pAAVS l -Nst-EFlaHygro2ArtTA3(-)_TetO-Blast(l-102)_NpuDnaE(N)-P2A-EGFP
- Plasmid 110 Plasmid 110: pAAVS l -Nst-EFlaHygro2ArtTA3(-)_TetO-NpuDnaE(C)_Blast(103-140)-P2A-mScarlet Vector sequence (SEQ ID NO:203)
- Plasmid 111 pAAVS l -Nst-EFl aBlast2ArtTA3(-)_TetO-Hygro-P2A-NTR-E2A-EGFP
- Plasmid 112 pAAVS l -Nst-EFl aBlast2ArtTA3(-)_TetO-Hygro-P2A-NTR-E2A-mCherry
- Plasmid 113 pAAVS l -Nst-EFl aBlast2ArtTA3(-)_TetO- Hygro(l-89)-NpuDnaE(N)-P2A-NTR-E2A-EGFP Vector sequence (SEQ ID NO:206)
- Plasmid 114 pAAVS l -Nst-EFl aBlast2ArtTA3(-)_TetO- NpuDnaE(C)-Hygro(90-341)-P2A-NTR-E2A-mCherry Vector sequence (SEQ ID NO:207)
- Plasmid 115 pLX-Hygro(l-89)_NpuDnaE(N)_LZA-IRES-TagBFP2
- Plasmid 116 pLX-LZB_NpuDnaGEP(C)_Hygro(90-200)_SspDnaB(N-S0)-IRES-GFP
- Plasmid 117 pLX-SspDnaB(C-S0)_Hygro(201-240)_NpuDnaE(N)_LZA-IRES-GFP
- Plasmid 118 pLX-LZB_NpuDnaGEP(C)_Hygro(241-341)-IRES-mCherry
Abstract
Description
Claims
Priority Applications (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA3079017A CA3079017A1 (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
US16/755,065 US20200263197A1 (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
CN201880078542.7A CN111511759A (en) | 2017-10-12 | 2018-10-11 | Transgene selection methods and compositions |
JP2020520468A JP7394752B2 (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
AU2018347421A AU2018347421A1 (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
EP18867279.4A EP3694869A4 (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
KR1020207013411A KR20200064129A (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
JP2023200808A JP2024015079A (en) | 2017-10-12 | 2023-11-28 | Transgenic selection methods and compositions |
Applications Claiming Priority (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762571672P | 2017-10-12 | 2017-10-12 | |
US62/571,672 | 2017-10-12 | ||
US201762608478P | 2017-12-20 | 2017-12-20 | |
US62/608,478 | 2017-12-20 | ||
US201862616281P | 2018-01-11 | 2018-01-11 | |
US62/616,281 | 2018-01-11 | ||
US201862624629P | 2018-01-31 | 2018-01-31 | |
US62/624,629 | 2018-01-31 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2019075200A1 true WO2019075200A1 (en) | 2019-04-18 |
Family
ID=66101179
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2018/055412 WO2019075200A1 (en) | 2017-10-12 | 2018-10-11 | Transgenic selection methods and compositions |
Country Status (8)
Country | Link |
---|---|
US (1) | US20200263197A1 (en) |
EP (1) | EP3694869A4 (en) |
JP (2) | JP7394752B2 (en) |
KR (1) | KR20200064129A (en) |
CN (1) | CN111511759A (en) |
AU (1) | AU2018347421A1 (en) |
CA (1) | CA3079017A1 (en) |
WO (1) | WO2019075200A1 (en) |
Families Citing this family (26)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11293021B1 (en) | 2016-06-23 | 2022-04-05 | Inscripta, Inc. | Automated cell processing methods, modules, instruments, and systems |
US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
JP2020530979A (en) | 2017-06-30 | 2020-11-05 | インスクリプタ, インコーポレイテッド | Automatic cell processing methods, modules, equipment and systems |
US10557216B2 (en) | 2018-04-24 | 2020-02-11 | Inscripta, Inc. | Automated instrumentation for production of T-cell receptor peptide libraries |
US10858761B2 (en) | 2018-04-24 | 2020-12-08 | Inscripta, Inc. | Nucleic acid-guided editing of exogenous polynucleotides in heterologous cells |
AU2019292919A1 (en) | 2018-06-30 | 2021-03-11 | Inscripta, Inc. | Instruments, modules, and methods for improved detection of edited sequences in live cells |
US11142740B2 (en) | 2018-08-14 | 2021-10-12 | Inscripta, Inc. | Detection of nuclease edited sequences in automated modules and instruments |
US11214781B2 (en) | 2018-10-22 | 2022-01-04 | Inscripta, Inc. | Engineered enzyme |
CN113631713A (en) | 2019-03-25 | 2021-11-09 | 因思科瑞普特公司 | Simultaneous multiplex genome editing in yeast |
US11001831B2 (en) | 2019-03-25 | 2021-05-11 | Inscripta, Inc. | Simultaneous multiplex genome editing in yeast |
CN113939593A (en) | 2019-06-06 | 2022-01-14 | 因思科瑞普特公司 | Treatment for recursive nucleic acid-guided cell editing |
WO2021102059A1 (en) | 2019-11-19 | 2021-05-27 | Inscripta, Inc. | Methods for increasing observed editing in bacteria |
AU2020407048A1 (en) | 2019-12-18 | 2022-06-09 | Inscripta, Inc. | Cascade/dCas3 complementation assays for in vivo detection of nucleic acid-guided nuclease edited cells |
CN115135370A (en) | 2020-01-27 | 2022-09-30 | 因思科瑞普特公司 | Electroporation module and instrument |
US20210332388A1 (en) | 2020-04-24 | 2021-10-28 | Inscripta, Inc. | Compositions, methods, modules and instruments for automated nucleic acid-guided nuclease editing in mammalian cells |
US11787841B2 (en) | 2020-05-19 | 2023-10-17 | Inscripta, Inc. | Rationally-designed mutations to the thrA gene for enhanced lysine production in E. coli |
WO2022060749A1 (en) | 2020-09-15 | 2022-03-24 | Inscripta, Inc. | Crispr editing to embed nucleic acid landing pads into genomes of live cells |
US11512297B2 (en) | 2020-11-09 | 2022-11-29 | Inscripta, Inc. | Affinity tag for recombination protein recruitment |
WO2022146497A1 (en) | 2021-01-04 | 2022-07-07 | Inscripta, Inc. | Mad nucleases |
WO2022150269A1 (en) | 2021-01-07 | 2022-07-14 | Inscripta, Inc. | Mad nucleases |
US11884924B2 (en) | 2021-02-16 | 2024-01-30 | Inscripta, Inc. | Dual strand nucleic acid-guided nickase editing |
EP4301861A1 (en) | 2021-03-03 | 2024-01-10 | Shape Therapeutics Inc. | Auxotrophic cells for virus production and compositions and methods of making |
WO2023027169A1 (en) * | 2021-08-27 | 2023-03-02 | 国立大学法人 東京医科歯科大学 | Sorting system for live cells |
WO2023027170A1 (en) * | 2021-08-27 | 2023-03-02 | 国立大学法人 東京医科歯科大学 | System for regulating protein translation |
CN115896147B (en) * | 2022-10-11 | 2023-10-03 | 态创生物科技(广州)有限公司 | Intein evolution systems and methods, corresponding mutant plasmids and reporter plasmids |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6858775B1 (en) * | 1999-05-24 | 2005-02-22 | New England Biolabs, Inc. | Method for generating split, non-transferable genes that are able to express an active protein product |
US20050221343A1 (en) * | 2003-10-24 | 2005-10-06 | Waldo Geoffrey S | Self-assembling split-fluorescent protein systems |
US20070065912A1 (en) * | 2005-07-21 | 2007-03-22 | Abbott Laboratories | Multiple Gene Expression including sORF Constructs and Methods with Polyproteins, Pro-Proteins, and Proteolysis |
US20150232507A1 (en) * | 2011-09-28 | 2015-08-20 | Era Biotech, S.A. | Split inteins and uses thereof |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPH10113174A (en) * | 1996-10-08 | 1998-05-06 | Amashiyamu Kk | Simultaneous production of human cytochrome p-450 and human cytochrome p450 reductase |
DE60036942T2 (en) * | 1999-05-24 | 2008-08-07 | New England Biolabs, Inc., Beverly | METHOD OF GENERATING SEPARATE, NON-TRANSFERABLE GENES WHICH ARE ABLE TO EXPRESS AN ACTIVE PROTEIN PRODUCT |
CN101993907B (en) * | 2002-01-08 | 2018-12-28 | 迈克尔·R·拉尔布 | Expressing CIVPS or the genetically modified plants of intein modified proteins and preparation method thereof |
-
2018
- 2018-10-11 WO PCT/US2018/055412 patent/WO2019075200A1/en unknown
- 2018-10-11 AU AU2018347421A patent/AU2018347421A1/en active Pending
- 2018-10-11 JP JP2020520468A patent/JP7394752B2/en active Active
- 2018-10-11 EP EP18867279.4A patent/EP3694869A4/en active Pending
- 2018-10-11 US US16/755,065 patent/US20200263197A1/en active Pending
- 2018-10-11 CA CA3079017A patent/CA3079017A1/en active Pending
- 2018-10-11 CN CN201880078542.7A patent/CN111511759A/en active Pending
- 2018-10-11 KR KR1020207013411A patent/KR20200064129A/en not_active Application Discontinuation
-
2023
- 2023-11-28 JP JP2023200808A patent/JP2024015079A/en active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6858775B1 (en) * | 1999-05-24 | 2005-02-22 | New England Biolabs, Inc. | Method for generating split, non-transferable genes that are able to express an active protein product |
US20050221343A1 (en) * | 2003-10-24 | 2005-10-06 | Waldo Geoffrey S | Self-assembling split-fluorescent protein systems |
US20070065912A1 (en) * | 2005-07-21 | 2007-03-22 | Abbott Laboratories | Multiple Gene Expression including sORF Constructs and Methods with Polyproteins, Pro-Proteins, and Proteolysis |
US20150232507A1 (en) * | 2011-09-28 | 2015-08-20 | Era Biotech, S.A. | Split inteins and uses thereof |
Non-Patent Citations (3)
Title |
---|
JILLETTE ET AL.: "Split Selectable Markers", BIORXIV, 25 October 2018 (2018-10-25), pages 1 - 27, XP055592242 * |
See also references of EP3694869A4 * |
VOLKMANN ET AL.: "Protein trans-splicing and its use in structural biology: opportunities and limitations", MOLECULAR BIOSYSTEMS, vol. 6, no. 11, 31 August 2010 (2010-08-31), pages 2110 - 2121, XP055592232 * |
Also Published As
Publication number | Publication date |
---|---|
JP7394752B2 (en) | 2023-12-08 |
JP2024015079A (en) | 2024-02-01 |
KR20200064129A (en) | 2020-06-05 |
CA3079017A1 (en) | 2019-04-18 |
AU2018347421A1 (en) | 2020-05-14 |
US20200263197A1 (en) | 2020-08-20 |
EP3694869A4 (en) | 2021-11-24 |
EP3694869A1 (en) | 2020-08-19 |
CN111511759A (en) | 2020-08-07 |
JP2020537646A (en) | 2020-12-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP7394752B2 (en) | Transgenic selection methods and compositions | |
US10344285B2 (en) | DNA vectors, transposons and transposases for eukaryotic genome modification | |
US10435696B2 (en) | DNA vectors, transposons and transposases for eukaryotic genome modification | |
Jillette et al. | Split selectable markers | |
WO2019016175A9 (en) | A two-component vector library system for rapid assembly and diversification of full-length t-cell receptor open reading frames | |
US20200087679A1 (en) | Expression cassette | |
TW200930815A (en) | Novel recombination sequences | |
US20220195465A1 (en) | Stable targeted integration | |
JP5246904B2 (en) | Vector for introducing foreign gene and method for producing vector into which foreign gene has been introduced | |
JP7472167B2 (en) | Stable targeted integration | |
EP4311858A1 (en) | Intein-based controllers | |
WO2023064871A1 (en) | Integrases, landing pad architectures, and engineered cells comprising the same | |
WO2024068995A1 (en) | Novel transposase system | |
WO2023232961A1 (en) | Improved production cells | |
CN117355607A (en) | Non-viral homology mediated end ligation | |
CA3143506A1 (en) | Enhanced platforms for unnatural amino acid incorporation in mammalian cells | |
Toktay | Engineering and systematic comparison of constitutive promoters in various lines of chinese hamster ovary cells | |
NZ626252B2 (en) | Expression cassette |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18867279 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 3079017 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2020520468 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 20207013411 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2018347421 Country of ref document: AU Date of ref document: 20181011 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2018867279 Country of ref document: EP Effective date: 20200512 |