WO2018203049A1 - Self-inactivating viral vector - Google Patents

Self-inactivating viral vector Download PDF

Info

Publication number
WO2018203049A1
WO2018203049A1 PCT/GB2018/051166 GB2018051166W WO2018203049A1 WO 2018203049 A1 WO2018203049 A1 WO 2018203049A1 GB 2018051166 W GB2018051166 W GB 2018051166W WO 2018203049 A1 WO2018203049 A1 WO 2018203049A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
vector genome
vector
viral
moiety
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2018/051166
Other languages
English (en)
French (fr)
Inventor
Marco Tripodi
Ernesto CIABATTI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
United Kingdom Research and Innovation
Original Assignee
United Kingdom Research and Innovation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by United Kingdom Research and Innovation filed Critical United Kingdom Research and Innovation
Priority to CA3060675A priority Critical patent/CA3060675A1/en
Priority to JP2019560380A priority patent/JP7420558B2/ja
Priority to CN201880029221.8A priority patent/CN110914439B/zh
Priority to EP18723917.3A priority patent/EP3619314B1/en
Priority to AU2018262281A priority patent/AU2018262281B2/en
Priority to US16/607,980 priority patent/US12203092B2/en
Priority to KR1020197035530A priority patent/KR20200015900A/ko
Priority to BR112019023003A priority patent/BR112019023003A2/pt
Publication of WO2018203049A1 publication Critical patent/WO2018203049A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/08RNA viruses
    • C07K14/145Rhabdoviridae, e.g. rabies virus, Duvenhage virus, Mokola virus or vesicular stomatitis virus
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • A01K2217/052Animals comprising random inserted nucleic acids (transgenic) inducing gain of function
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/20Animal model comprising regulated expression system
    • A01K2217/206Animal model comprising tissue-specific expression system, e.g. tissue specific expression of transgene, of Cre recombinase
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0393Animal model comprising a reporter system for screening tests
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/95Fusion polypeptide containing a motif/fusion for degradation (ubiquitin fusions, PEST sequence)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20111Lyssavirus, e.g. rabies virus
    • C12N2760/20141Use of virus, viral particle or viral elements as a vector
    • C12N2760/20143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/00022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2810/00Vectors comprising a targeting moiety
    • C12N2810/50Vectors comprising as targeting moiety peptide derived from defined protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2810/00Vectors comprising a targeting moiety
    • C12N2810/50Vectors comprising as targeting moiety peptide derived from defined protein
    • C12N2810/60Vectors comprising as targeting moiety peptide derived from defined protein from viruses
    • C12N2810/609Vectors comprising as targeting moiety peptide derived from defined protein from viruses positive strand RNA viruses

Definitions

  • the invention relates to a vector based on a virus from the order Mononegavirales , such as a rhabdovirus, and in
  • a rabies virus vector More specifically, it relates to a vector which, having transfected a target cell, is switchable between replication-competent and replication- incompetent forms.
  • the invention avoids the cytotoxicity associated with current vectors based on Mononegavirales such as rabies virus vectors.
  • Vectors based on viruses of the order Mononegavirales have considerable potential in various therapeutic, diagnostic and research contexts. Although these vectors can be engineered such that they do not propagate from a transfected cell, or are able to propagate only in a tightly controlled manner, they still show significant cytotoxicity to transfected cells which limits their application.
  • neurotropic viruses particularly G-deleted rabies (AG-Rabies) (12, 13), by spreading from neuron to neuron along circuit paths, provide a potential tool to gain genetic access to topologically defined neurons (13-16) .
  • AG-Rabies G-deleted rabies
  • RNA-based viruses such as the rabies virus
  • conditional modulation of viral protein stability might act as a switch for the viral transcription- replication cycle within infected cells, turning the virus on or off when specific conditions are met.
  • the inventors have designed a viral vector which is capable of transfecting (and hence delivering a genetic payload to) a target cell, and which is switchable between an active state in which viral protein expression is possible and an inactive state in which viral protein expression is inhibited. Continued maintenance of the inactive state will typically result in the vector being eliminated from the host cell .
  • the vector encodes a "replication modulator protein" which comprises a mononegaviral protein required for replication of the vector genome, and which is capable of adopting two configurations.
  • the mononegaviral protein which forms part of the replication modulator protein is referred to here as the "viral protein moiety" .
  • the replication modulator protein is targeted for degradation in the target cell.
  • the "targeted" configuration is unstable. While the replication modulator protein maintains this configuration, expression from the vector genome and/or replication of the vector genome is inhibited or completely suppressed.
  • the second configuration of the modulator protein referred to as the "untargeted" configuration, is more stable than the "targeted" configuration. As a result, it supports higher levels of expression from the vector and/or replication of the vector genome, typically because the viral protein moiety accumulates in the host cell cytosol to higher levels than the targeted configuration.
  • references to "stability" in this context relate only to the half life of the relevant proteins in the target cell and their propensity to be degraded by the target cell's protein degradation pathways.
  • the targeted configuration has a shorter half life than the untargeted configuration and is thus regarded as being less stable than the untargeted configuration .
  • replication modulator protein provides a switch which enables strictly regulated expression from the vector genome and/or replication of the vector genome.
  • the "targeted" configuration of the modulator protein displays a degradation targeting signal or "degron”, i.e. a moiety that marks the protein for degradation within the cell.
  • degron i.e. a moiety that marks the protein for degradation within the cell.
  • degron and “degradation targeting signal” are used interchangeably in this specification.
  • the "untargeted" configuration of the modulator protein differs from the targeted configuration in that it either does not comprise or does not display the degron responsible for the lower stability of the targeted configuration. As a result, the untargeted configuration typically has a longer half-life within the cell than the targeted configuration.
  • the default state of the replication modulator protein may be the targeted configuration. That is to say, the targeted configuration may be encoded by the vector genome, such that the replication modulator protein is synthesised in the targeted configuration. Adoption of the untargeted
  • an activating agent or “stabilising agent” since it supports production of sufficient functional protein to activate vector expression and/or replication. As result, may it permit the on-going persistence or survival of the vector within the cell.
  • an "inhibitory" modulator protein is constitutively unstable.
  • the initial level of protein synthesis may be sufficient to support a period of replication and potentially production of infectious progeny virions (depending on the payload of the vector and any other proteins provided in trans by the target cell) . Thereafter, due to the instability of the replication modulator protein, replication is inhibited or completely suppressed in the absence of the activating agent.
  • the default state of the replication modulator protein may be the untargeted configuration. That is to say, the untargeted configuration of the replication modulator may be encoded by the vector genome, such that the replication modulator protein is synthesised in the untargeted
  • Adoption of the targeted configuration is stimulated by contact with an agent which may be referred to as a "inhibitory agent” or “destabilising agent”, since its presence will tend to inhibit or suppress expression from the vector and/or replication of the vector genome.
  • an agent which may be referred to as a “inhibitory agent” or “destabilising agent”, since its presence will tend to inhibit or suppress expression from the vector and/or replication of the vector genome.
  • the replication modulator protein comprises a viral protein moiety and a regulator moiety.
  • the viral protein moiety and the regulator moiety may form distinctly folded domains of the modulator protein, although this may not always be necessary.
  • the viral protein moiety is typically capable of exerting all the biological functions of the native form of the relevant viral protein.
  • the nature and identity of the regulator moiety determines whether the modulator protein is an inhibitory modulator protein (i.e. vector expression or replication is inhibited in the absence of the cognate activating agent) or an inhibitable modulator protein (i.e. vector expression or replication proceeds as normal in the absence of the cognate inhibitory agent) .
  • the regulator moiety comprises or consists of the degron, and in the default state of the modulator protein, the degron is displayed such that the protein is targeted for degradation.
  • activating agent will therefore act to remove, mask or otherwise disable the degron, e.g. by covalent or non-covalent modification.
  • the cognate activating agent may cleave the regulator moiety from the viral protein moiety.
  • the activating agent may be a protease which is capable of acting on the modulator protein to cleave the regulator moiety from the viral protein moiety. This mechanism may be described as "cleavage-induced stabilisation" of the
  • the activating agent may bind to the modulator protein, e.g. to the regulator moiety, to mask or otherwise inactivate the degron.
  • the activating agent may be a ligand for the modulator protein, e.g. for the regulator moiety of the modulator protein. This mechanism may be described as "ligand-induced stabilisation" of the
  • replication modulator protein (or of the viral protein moiety) .
  • the regulator moiety does not comprise or does not display the degron in its default state. Rather, the cognate inhibitory agent will interact with the modulator protein to create or reveal the degron, typically by covalent or non-covalent interaction with the regulator moiety.
  • the cognate inhibitory agent may cleave the regulator moiety from the viral protein moiety in order to reveal or create the degron in the viral protein moiety. This mechanism may be described as "cleavage-induced destabilisation" (or "cleavage-induced degradation") of the replication modulator protein.
  • the inhibitory agent may bind to the replication modulator protein, e.g. to the regulator moiety, so as to create or reveal the degron.
  • the inhibitory agent may be a ligand for the modulator protein, e.g. for the regulator moiety of the modulator protein.
  • This mechanism may be described as "ligand-induced destabilisation" (or “ligand-induced degradation") of the replication modulator protein.
  • the regulator moiety and the inhibitory agent may respectively represent first and second components of an inducible degron system, wherein association of the first and second components generates a degron .
  • the invention provides a mononegaviral vector genome comprising a gene encoding a replication modulator protein, wherein the replication modulator protein comprises a
  • the replication modulator protein being capable of adopting a targeted configuration displaying a degron, and an untargeted configuration which does not display the degron.
  • the vector genome is typically a negative-sense, single stranded RNA molecule.
  • the replication modulator protein encoded by the vector genome may be an inhibitory modulator. It may comprise a viral protein moiety and a regulator moiety, wherein the regulator moiety comprises or consists of the degron.
  • the replication modulator protein may be switchable to an untargeted configuration on contact with a cognate activating agent.
  • the activating agent is capable of cleaving the regulator moiety from the modulator protein.
  • the activating agent is a ligand for the modulator protein, e.g. for the regulator moiety.
  • the ligand may mask or otherwise inactivate the degron, e.g. sterically or via a conformational change.
  • the replication modulator protein encoded by the vector genome may be an inhibitable modulator which is switchable to a targeted configuration displaying a degron on contact with a cognate inhibitory agent. It may comprise a viral protein moiety and a regulator moiety.
  • the inhibitory agent is capable of cleaving the regulator moiety from the modulator protein to create or reveal the degron.
  • the inhibitory agent is a ligand for the regulator moiety and creates or reveals the degron on binding to the regulator moiety.
  • the activating agent or inhibitory agent may act by cleaving the regulator moiety from the viral protein moiety in order to remove or reveal the degron respectively.
  • the activating or inhibitory agent may act by cleaving the regulator moiety from the viral protein moiety in order to remove or reveal the degron respectively.
  • inhibitory agent is typically a protease.
  • the regulator moiety comprises a cleavage site for the protease.
  • the protease may be orthogonal to the target cell. That is to say, the protease recognises a cleavage site which is not found in the proteome of the target cell, i.e. the cleavage site is not found in native proteins encoded by and expressed in the target cell.
  • the particular protease may vary depending on the target cell.
  • suitable proteases include viral proteases, especially proteases from viruses which are not mononegaviruses (e.g. Tobacco Etch Virus protease (TEVp) and human rhinovirus (HRV) 3C protease) , Factor Xa, enterokinase and thrombin. Any of these may be suitable when the target cell is a neural cell.
  • the protease selected does not act on any other proteins encoded by the vector genome, e.g. amongst the proteins encoded by the vector genome, only the replication modulator comprises a cleavage site recognised by the relevant protease .
  • the activating agent or inhibitory agent may itself be encoded by the vector genome. In such cases, expression or function of the agent will be inducible, typically by contacting a cell containing the vector genome with an appropriate inducer.
  • the vector may comprise one or more genes encoding an agent which is expressed in functionally inactive form and wherein function is induced on contact with an inducer.
  • the agent may be expressed as two or more separate protein moieties which require the presence of a functional inducer in order to associate into a functional form.
  • Each of the component agent moieties may be expressed as a fusion with a partner protein, wherein the partner proteins associate on contact with the functional inducer.
  • Any mononegavirus may be used as the basis for a vector as described. Those having non-segmented genomes are
  • the virus is capable of infecting and
  • mononegavirus may be a rhabdovirus (e.g. a lyssavirus, such as a rabies virus) or a vesiculovirus (such as a vesicular stomatitis virus (VSV) ) .
  • a rhabdovirus e.g. a lyssavirus, such as a rabies virus
  • a vesiculovirus such as a vesicular stomatitis virus (VSV)
  • the viral protein moiety of the replication modulator may comprise or consist of any one of the proteins common to the majority of mononegaviruses . These include the large protein (L) , nucleoprotein (N or NP) , phosphoprotein (P) , matrix protein (M) , or glycoprotein (G; also referred to as simply the "envelope" protein) . This terminology is commonly used for rhabdoviruses , and is used in the present specification also to refer to their equivalents by function or sequence homology in other mononegaviruses. However, it is necessary to identify an appropriate viral protein moiety which provides adequate control over viral replication.
  • the viral protein moiety of the replication modulator protein is a protein which is required for expression from the viral genome (e.g. for transcription of mRNA from the viral genome) and/or for replication of the viral genome. Thus, the viral protein moiety is typically not the viral envelope protein (e.g. the glycoprotein or G protein) as, for most
  • phosphoprotein (P) or matrix protein (M) may be preferred, e.g. the large protein (L) , nucleoprotein (N or NP) or phosphoprotein (P) .
  • the nucleoprotein may be particularly preferred, especially in rhabdoviral vectors such as rabies viral vectors. Indeed, the present inventors have found that only the N protein provides adequate control over viral replication in vectors based on the rabies virus.
  • the replication modulator protein represents the only copy of that mononegaviral protein in the vector genome.
  • the vector genome does not contain a gene encoding a version of the same protein which exists only in the untargeted configuration.
  • the vector genome may comprise genes encoding one, two, three or all four of an N protein, a P protein, an M protein and an L protein, wherein one of these proteins is provided as the viral protein moiety of a replication modulator protein.
  • the vector genome may comprise a gene encoding a replication modulator protein comprising an N protein as the viral protein moiety, and may optionally further comprise one, two, or three of a P protein, an M protein and an L protein.
  • the vector genome may comprise genes encoding:
  • a replication modulator protein comprising an N protein as the viral protein moiety
  • the vector genome may also comprise a gene encoding an envelope protein.
  • the envelope protein may be native to the mononegaviral vector.
  • the vector when it is a rabies virus, it may be a rabies virus G protein.
  • envelope protein may be any protein that has a different function as a different envelope protein.
  • the envelope protein may comprise an intracellular domain and optionally also a trans-membrane domain of an envelope protein native to the vector, and a heterologous extracellular domain, i.e. the extracellular domain is not from the same
  • the extracellular domain may be from a different viral envelope protein (e.g. from an envelope protein from a different mononegavirus species, family or genus, or from an envelope protein from a different viral order) , or may be any protein domain capable of binding to a receptor expressed on the surface of a target cell, as long as the envelope protein remains capable of mediating infection of the target cell by the virion.
  • a different viral envelope protein e.g. from an envelope protein from a different mononegavirus species, family or genus, or from an envelope protein from a different viral order
  • any protein domain capable of binding to a receptor expressed on the surface of a target cell as long as the envelope protein remains capable of mediating infection of the target cell by the virion.
  • a rabies virus vector may comprise an envelope protein having at least the extracellular domain from a VSV envelope protein, avian sarcoma leukosis virus (ASLV) type A envelope protein, or ASLV type B envelope protein. It may comprise an entire envelope protein from VSV, ASLV type A, or ASLV type B. Alternatively, it may comprise an intracellular domain and optionally also a trans-membrane domain from a rabies virus G protein.
  • ASLV avian sarcoma leukosis virus
  • the vector genome does not encode an envelope protein.
  • Such virions are particularly useful for so-called “monosynaptic tracing" in neuronal cells.
  • the vector genome may comprise one or more heterologous genes, i.e. a gene encoding an expression product (typically a protein or RNA molecule) which is not native to the vector genome, i.e. is not present encoded by a wild type virus of the same virus type as the vector.
  • the heterologous gene or genes may be regarded as the "payload" which is to be delivered to the target cell by the vector.
  • the heterologous gene(s) may encode any expression product (whether RNA or protein) which it is desired to express in the target cell.
  • the identity and function of the heterologous gene(s) will thus depend on the intended role of the vector.
  • the heterologous gene does not encode a mononegaviral expression product, or a viral expression product.
  • the heterologous gene may be located at any suitable site within the vector genome. In some embodiments, it is located between the genes encoding the M and L proteins, e.g.
  • the heterologous gene(s) may, for example, encode one or more of the following:
  • a marker protein e.g. a fluorescent protein or a protein conferring antibiotic resistance
  • a recombinase e.g. a CRE recombinase, e.g. where the genome of the target cell contains recognition sites for the recombinase ;
  • a nuclease e.g. an RNA-guided endonuclease such as Cas9;
  • gRNA guide RNA
  • RNA-guided endonuclease e.g. for use in conjunction with an RNA-guided endonuclease
  • nucleic acid modulator of gene expression such as a siRNA, RNAi, anti-sense RNA or ribozyme.
  • heterologous gene or genes will be under the control of viral transcription regulatory sequences such as transcription initiator and terminator signals.
  • heterologous genes will typically each have their own associated regulatory sequences.
  • Heterologous gene expression may be affected by factors such as the transcriptional start site employed by the heterologous gene, and its spacing from the end of the gene located immediately upstream in the viral genome, i.e. the length of the intergenic region (IGR) between the end of the gene immediately upstream and the start of the heterologous gene.
  • the N protein has the highest level of transcription in a rabies virus, so it may be desirable that the heterologous gene employs the transcriptional start site from the N protein.
  • the transcriptional start site may, for example, have the sequence AACACCCCT (e.g. as seen in strains B19 and N2C) or AACACCTCT. Finke et al.
  • the length of IGR upstream of a gene affects its expression, and that shorter IGR sequences correlate with increased expression.
  • the IGR sequence upstream of the heterologous gene is 5 nucleotides or fewer in length, e.g. 2 nucleotides. Where the IGR is 2 nucleotides in length, its sequence may be CT .
  • heterologous genes may be desirable to include two or more heterologous genes, especially if they have complementary functions.
  • heterologous genes encoding an RNA-guided endonuclease, a guide RNA for that endonuclease (to direct the endonuclease to the desired site of the target cell chromosome) , and optionally also a repair template RNA to direct the particular modification to be achieved at the target site.
  • the heterologous genes may be adjacent to one another in the viral genome.
  • the IGR sequence between the heterologous genes may, for example, be 5 nucleotides or fewer in length, e.g. 2 nucleotides. It may be desirable that each heterologous gene employs the N protein transcriptional start site from the N protein.
  • the endonuclease may be a Cas9 enzyme, such as Cas9 from Streptococcus aureus (saCas9), Streptococcus pyogenes
  • SpCas9 Neisseria meningitidis (N Cas9) , Streptococcus thermophilus (ST Cas9) , Treponema denticola (TD Cas9) , or variants thereof such as the D1135E, VRER, EQR or VQR variants of SpCas9. Due to its relatively smaller size, saCas9 and its variants may be preferred.
  • Cas9 is used here to include functional variants of Cas9 endonucleases such as Cas9 nickase and nuclease-dead Cas9
  • heterologous genes which can be incorporated into the vector will depend on various factors, such as the specific virus on which the vector is based, the packaging capacity of the virion and which (if any) of the native viral genes have been deleted from the vector.
  • rabies viral vector in which the G gene has been deleted it is possible to include at least 3.7kb of heterologous coding sequence without substantial effect on packaging efficiency, and even up to 4.0 kb, up to 4.5 kb, or up to 5.0 kb. See ref. 32.
  • the heterologous gene may also be heterologous to the target cell, i.e. the target cell does not naturally encode or express the product of the gene.
  • the target cell may encode or express the gene product but under
  • the invention further provides a ribonucleoprotein complex comprising the vector genome in association with one or more viral proteins, e.g. one or more of N, P and L proteins.
  • the vector genome may be in association with all of N, P and L proteins.
  • the ribonucloprotein complex may be a functional viral nucleocapsid, capable of initiating transcription on introduction to the cytoplasm of a target cell. It may additionally comprise an protein.
  • the invention further provides a mononegaviral vector virion comprising a mononegaviral vector genome as described herein.
  • the virion typically comprises an L protein, an N protein, a P protein and an M protein, and also comprises an envelope protein.
  • the envelope protein may be a native mononegaviral envelope protein.
  • the virion may have been pseudotyped with a different envelope protein as described above to modulate its infectivity.
  • the virion typically takes the form of a ribonucleoprotein complex (comprising genome, L, N, M and P proteins) surrounded by a membrane envelope containing the envelope protein.
  • the virion is capable of delivering the genome to the target cell and of initiating transcription of the genome.
  • the virion typically does not contain a replication modulator protein; i.e. the proteins in the virion are not switchable between targeted and untargeted configurations .
  • the invention further provides a positive sense nucleic acid molecule encoding a viral vector genome as described herein.
  • the positive sense nucleic acid may be an RNA or DNA molecule.
  • it may be provided as part of an expression construct, comprising transcriptional regulatory sequences capable of directing synthesis of viral genome molecules.
  • the expression construct may be provided as part of an episome (e.g. a plasmid) or may be integrated into the chromosome of a host cell.
  • the invention further provides a packaging cell comprising a nucleic acid construct encoding a vector genome and capable of producing virions as described herein.
  • the packaging cell expresses L, N, M and P proteins and an envelope protein.
  • the proteins are capable of forming infective virions also comprising the vector genome.
  • these proteins may be encoded by the vector genome or provided in trans by other nucleic acid constructs within the cell.
  • the proteins in the virion particle itself are typically not linked to degrons .
  • the packaging cell will encode (and be capable of expressing) functional versions of all of the virion proteins, without degrons.
  • the packaging cell must also contain (e.g. express) the cognate activating agent so that viral replication can proceed.
  • constructs encoding any proteins to be provided in trans are typically DNA constructs, and may independently be chromosomally integrated or present as episomes such as plasmids .
  • packaging cell will depend on the particular viral vector, but may be a mammalian cell such as a primate or rodent cell. It may be a fibroblast or any other suitable cell type, such as a HEK (Human embryonic kidney) 293 cell or a BHK (baby hamster kidney) cell. Construction of packaging cells for rabies viral vectors, and other aspects of viral vector design, are described in Osakada and Callaway (2013) Design and generation of rabies virus vectors, Nature Protocols 8(8): 1583-1601. See also
  • the invention further provides a method of gene delivery to a target cell, comprising contacting the target cell with a ribonucleoprotein complex or a virion of the invention.
  • a ribonucleoprotein complex When a ribonucleoprotein complex is employed, it may be desirable to deliver it directly into the cell cytosol, e.g. by microinjection, or in conjunction with a carrier, such as a polymer or lipid, to facilitate transit into the cell.
  • a carrier such as a polymer or lipid
  • the target cell does not naturally express the agent responsible for the switch between the targeted and untargeted configurations of the modulator protein.
  • the vector encodes an inhibitory replicator protein
  • the activating agent is required for continued replication and propagation of the vector after initial primary infection.
  • the vector will often be employed alongside a delivery system for the activating agent, or the activating agent itself.
  • the vector encodes an inhibitable modulator protein, it may not be necessary to provide the inhibitory agent.
  • vector expression and replication should not proceed immediately, in which case the vector may be employed alongside a delivery system for the inhibitory agent, or the inhibitory agent itself.
  • the method may comprise the step of contacting the target cell with the cognate activating agent or inhibitory agent, as appropriate.
  • the target cell may be contacted with the cognate activating agent periodically, e.g. at repeated intervals of 1 day to 1 month, e.g. at intervals of 1 day to 14 days, e.g. at intervals of 5 to 10 days, for an indefinite period of time.
  • Such periodic administration may be useful to maintain viable vector within a target cell without permitting sufficient transcription and viral replication to compromise the cell.
  • the agent is a protein
  • the method may further comprise introducing into the target cell a nucleic acid comprising a gene encoding a cognate activating agent or inhibitory agent, such that the agent is expressed in the target cell.
  • the agent may be introduced into the target cell before the vector, at substantially the same time as the vector, or after the vector.
  • the agent When the agent is introduced after the vector, it will typically be introduced within a month, e.g. within 2 weeks, within 1 week, within 1 day, within 12 hours, or within 1 hour of the vector. It may be introduced periodically, e.g. at repeated intervals of 1 day to 1 month, e.g. at intervals of 1 day to 14 days, e.g. at intervals of 5 to 10 days, for an indefinite period of time.
  • Expression of the agent may be inducible.
  • the gene encoding the agent may comprise an inducible promoter so that transcription of the agent requires the cell to be contacted with a transcriptional inducer.
  • the inducer may be an antibiotic for example, such as doxycycline or
  • the agent may be expressed in a functionally inactive form which requires the cell to be contacted with a functional inducer in order to restore function.
  • the agent may be expressed as two or more separate protein moieties which require the presence of a functional inducer in order to associate into a functional form.
  • Each of the component agent moieties may be expressed as a fusion with a partner protein, wherein the partner proteins associate on contact with the functional inducer.
  • TEV protease can be expressed as two separate subunits each fused to heterologous protein moieties (FRB and FKBP) which associate only in the presence of rapamycin (a so-called "SPLIT-TEV” system) (See Gray et al. (2010) Activation of Specific Apoptotic Caspases with an Engineered Small-Molecule- Activated Protease, Cell 142(4) : 637-646.) .
  • FRB and FKBP heterologous protein moieties
  • FKBP heterologous protein moieties
  • Other pairs of fusion partners may also be used, which have different requirements for association.
  • the agent may be encoded by the vector genome itself, or in the genome of the target cell.
  • the vector genome or the target cell may comprise one or more genes encoding the activating agent or inhibitory agent, wherein expression or function of the agent is
  • the method does not require the target cell to be contacted with the activating agent or inhibitory agent, but simply requires the target cell to be contacted with the inducer (of expression or function) .
  • the method may therefore include the step of inducing
  • the target cell may be contacted with the inducer
  • the vector genome does not comprise a gene encoding an envelope protein.
  • the method may (additionally or alternatively) comprise the step of
  • nucleic acid construct comprising a gene encoding an envelope protein, such that the envelope protein is expressed in the target cell
  • the envelope protein may be introduced into the target cell before the vector, at substantially the same time as the vector, or after the vector.
  • the envelope protein When the envelope protein is introduced after the vector, it will typically be introduced within a month, e.g. within 14 days, within 7 days, within 1 day, within 12 hours, or within 1 hour of the vector.
  • Expression of the envelope protein may be inducible.
  • the gene encoding the envelope protein may comprise an inducible promoter so that transcription of the envelope protein requires the cell to be contacted with a
  • each nucleic acid may independently be introduced as DNA or as RNA, as naked nucleic acid, in association with a carrier such as a polymer or lipid (e.g. as a complex with a carrier), in encapsulated form (e.g. encapsulated in a liposome) or via a viral vector.
  • a carrier such as a polymer or lipid (e.g. as a complex with a carrier), in encapsulated form (e.g. encapsulated in a liposome) or via a viral vector.
  • Suitable viral vectors include retroviral vectors (including lentiviral vectors) , adenoviral vectors, and adeno-associated virus (AAV) vectors.
  • AAV vectors may be particularly suitable.
  • genes encoding the agent and the envelope protein may be delivered separately or together, e.g. as part of the same nucleic acid construct.
  • a viral vector having an inhibitory modulator protein may find particular use as an immunostimulatory agent, e.g. as a vaccine, against the native form of the same virus. Delivery of the vector to a recipient will result in replication of the virus only in cells which also receive the activating agent.
  • Progeny virions may be formed and released from such infected cells. However, they will be unable to replicate further in cells which do not receive the activating agent. Thus coadministration of the vector and the activating agent, to particular selected cells, may result in a short controlled cycle of viral replication and release, stimulating the immune system and priming it to recognise the virus.
  • the viral vector may be otherwise attenuated to reduce any risk to the recipient. Thus it may comprise one or more further mutations to reduce or eliminate infectivity or virulence .
  • Release of progeny virions may be useful to simulate an antibody response against the native virus.
  • the viral vector In order to produce and release progeny virions, the viral vector must encode an envelope protein, or an envelope protein must be supplied separately in trans to the infected cells if the vector lacks an envelope protein. Use of a vector lacking an envelope protein may represent a useful safety measure.
  • the vector lacks an envelope protein, and no envelope protein is supplied in trans, there may still be sufficient protein expression in the presence of the activating agent to result in display of viral antigens via the recipient cell's MHC molecules (especially MHC I), and consequent stimulation of a T cell response (especially a CTL response) against the virus .
  • MHC molecules especially MHC I
  • T cell response especially a CTL response
  • the vectors of the invention find particular use in gene delivery to neural cells, especially when based on rabies virus or vesicular stomatitis virus.
  • Use of G-deleted rabies virus is well known for monosynaptic circuit tracing in both the central and peripheral nervous system.
  • current methods of monosynaptic circuit tracing have limited use because the labelled cells typically only remain viable for 1- 2 weeks because of the accumulation of viral protein within the cell.
  • the present vectors provide the capacity to genetically label neural cells without affecting viability.
  • the invention further provides a kit comprising a vector genome of the invention and (a) a cognate activating or inhibitory agent, or a nucleic acid encoding a cognate activating or inhibitory agent, and/or (b) a nucleic acid encoding an envelope protein.
  • the kit may comprise a system for delivery of the nucleic acid, such as a vector as described elsewhere.
  • the same system may be used to deliver both the cognate survival factor and the envelope protein as described above.
  • the invention further provides a composition comprising a vector virion of the invention, optionally admixed with an excipient or carrier.
  • the composition may be a pharmaceutical composition and the carrier may be a pharmaceutically
  • Mononegavirales infect diverse types of cell including plant, insect, fish and mammalian cells.
  • the present invention can be applied to any type of mononegavirus because they conform to a similar pattern of genomic organisation and rely on a similar coupled system of transcription and replication.
  • Rhabdoviruses may be
  • the vectors of the invention may find particular use in the rhabdoviral genera and species which infect mammalian cells, especially lyssaviruses , such as the rabies virus (Rabies lyssavirus; RABV) and vesiculoviruses, such as vesicular stomatitis virus (VSV) .
  • Rabies virus has a particular tropism for neurons, which makes it a valuable candidate for gene delivery to neural tissue.
  • any appropriate strain may be used, including CVS (Challenge virus standard) and variants thereof such as CVS-N2c, PV4 (Pasteur virus) , PM (Pitman-Moore) , Flury-LEP (low egg passage) , Flury-HEP (high egg passage) , ERA and SAD (Street-Alabama Dufferin) .
  • CVS- N2c strain is described in reference 25 and a full genome sequence is available under GenBank accession no. HM535790, version H 535790.1 , 29 December 2010.
  • the target cell type may be from a primate (e.g. Old World monkey, New World monkey, ape or human), rodent (e.g. mouse or rat), canine (e.g. domestic dog), feline (e.g.
  • a primate e.g. Old World monkey, New World monkey, ape or human
  • rodent e.g. mouse or rat
  • canine e.g. domestic dog
  • feline e.g.
  • equine e.g. horse
  • bovine e.g. cow
  • caprine e.g. goat
  • ovine e.g. sheep
  • lagomorph e.g. rabbit
  • the target cell type may be any desired cell type. In some examples, it may be a neural cell, e.g. a neuron or glial cell. The neural cell may be part of the peripheral or central nervous system.
  • a neural cell e.g. a neuron or glial cell.
  • the neural cell may be part of the peripheral or central nervous system.
  • AAV-TVAmCherry- GLY was injected in CAl of Rosa-LoxSTOPLox- YFP mice and the TVA expressing neurons were specifically targeted with an EnVA pseudotyped SiR CRE 2 weeks later.
  • A' In the site of injection
  • YFP 0 /mCherry 0N starting neurons are detected (arrowheads) and (A' ' -A' ' ' ) the transsynaptic jump of SiR virus permanently labeled neurons in CA3 and lateral enthorinal cortex (LEC) with YFP expression.
  • Scale bar 25 ⁇ .
  • C-C ' Retrograde tracing of neurons from CA3 and LEC projecting to CAl by SiR mCherry injection of CAl of the hippocampus.
  • D VI cortical neurons infected by SiR injection in the superficial layers of the Superior Colliculus (SC) . Scale bar: 25 um.
  • SiR infection has no long-term impact on neuronal physiology
  • A-B Membrane potential response to steps of positive and negative current of a CAl pyramidal neuron 1 week postinfection (p.i.) and 8 weeks p.i..
  • C Input resistance
  • D resting membrane potential and action potential
  • E AP amplitude and width
  • A hESCs derived neurons were infected with AG- N PEST Rabies sPLiT-iEv-mcherry anc j i ma g e d longitudinally over 16 days.
  • B-B AG-N PEST Rabies spLiT-TEv-mcnerry and Bl9
  • C- C infected hESCs derived neurons imaged at 4-10 and 16 days post-infection (p. i . ) .
  • A Design of the doxycycline inducible AAV.
  • the rTTA trans-activator is constitutive expressed by the virus and in presence of doxycycline it drives the TEV protease expression.
  • B Diagram of AAV-TRE-TEV injection in the hippocampus of Rosa ⁇ LoxP-STOP- LoxP-YFP mice follow by siR C E ⁇ mCherrY in the same region 1 week after and Doxycycline administration.
  • C-F Hippocampal pyramidal neurons infected with SiR and AAV-TRE-TEV,
  • A-A' ' Confocal images of cortical neurons and (B-B' ' ) CA1 pyramidal neurons infected with AG-Rabies GFP at 1, 2 and 3 weeks p.i.. Scale bar: 50 ⁇ .
  • C Percentage of infected neurons at 1, 2 or 3 weeks p.i. of AG Rabies in cortex (black) or hippocampus (grey) normalized to 1 week time-point (mean ⁇ SE )
  • Fig. 12 Map of plasmid encoding SiR vector having multiple cloning site in place of gene for envelope (G) protein.
  • N-TEV-PEST protein P protein, M protein, L protein.
  • Multiple cloning sites Sbfl - Nhel and Pacl-Ascl shown in italic upper case.
  • N sequence is shown in lower case regular font, TEV cleavage site in upper case italics, PEST sequence in upper case double-underlined, and linker peptide sequences in lower case italics .
  • the order Mononegavirales contains the families Bornaviridae , Filoviridae, Mymonaviridae, Nyamiviridae , Paramyxoviridae , Pneumoviridae, Rhabdoviridae and Sunviridae, as well as five unclassified genera Anphevirus, Arlivirus, Chengtivirus , Crustavirus, and Wastrivirus. Genera and species within those families are shown in the table below. Asterisks "*" in the following table denote type species.
  • LGSV-1 bornavirus garter snake virus 1
  • CnBV-3 bornavirus 3
  • BDBV Ebolavirus Bundibugyo Bundibugyo virus ebolavirus
  • sclerotimonavirus* sclerotiorum negative- stranded RNA virus 1 (SsNSRV- 1)
  • Nyamanini Nyamanini virus nyavirus* (NYMV)
  • Socyvirus Soybean cyst soybean cyst nematode nematode virus 1 socyvirus* (SbCNV-1)
  • paramyxovirus 2 paramyxovirus 2
  • paramyxovirus 3 paramyxovirus 3
  • paramyxovirus 4 paramyxovirus 4
  • paramyxovirus 5 paramyxovirus 5
  • paramyxovirus 6 paramyxovirus 6
  • paramyxovirus 7 paramyxovirus 7
  • paramyxovirus 10 paramyxovirus 10
  • paramyxovirus 11 paramyxovirus 11
  • Moj iang Moj iang virus henipavirus MojV
  • CDV Canine distemper canine distemper virus virus
  • Peste-des -petits - peste-des- ruminants virus disruptive -ruminants virus PPRV
  • Duvenhage Duvenhage virus lyssavirus (DUVV)
  • European bat 1 European bat lyssavirus lyssavirus 1
  • Shimoni bat Shimoni bat lyssavirus virus (SHIBV)
  • VHSV septicemia virus
  • EDV Eggplant mottled eggplant mottled dwarf dwarf virus nucleorhabdovirus
  • VSNJV Jersey virus
  • the viruses within the order (referred to here as
  • “mononegaviruses” are enveloped viruses possessing genomes of non-infectious, linear, single-stranded, negative sense RNA.
  • the majority of mononegaviruses have non-segmented genomes. Without wishing to be bound by theory, it is believed that the methods and compositions described in this specification are more applicable to non-segmented viruses than to segmented viruses .
  • the genome has inverse-complementary 3' and 5' termini and is not covalently linked to any proteins.
  • the genomes generally have a conserved layout of coding and non-coding elements in the order 3'UTR (untranslated region) - core protein-coding genes - envelope protein-coding gene(s) - polymerase-coding gene - 5'UTR.
  • the core proteins encoded by the genome include the
  • nucleoprotein (often designated “N” or “NP”) , a protein which is often phosphorylated and so is referred to as a
  • P phosphoprotein
  • M matrix protein
  • the polymerase is an RNA-dependent RNA polymerase and often the largest protein encoded by the virus and so may be referred to as the large (or "L") protein.
  • the polymerase is relatively highly conserved within the order.
  • the P protein may represent a co-factor for the L protein, i.e. the L and P proteins may be required to be present together for polymerase activity .
  • N or NP
  • P or M and L proteins are used in this specification to refer to any proteins which fulfil the corresponding roles in raononegaviruses, regardless of their normal designations.
  • the envelope protein is a transmembrane protein which may be glycosylated. In some mononegaviruses , it is therefore referred to as the glycoprotein (or "G" protein) .
  • the virion comprises a helical ribonucleoprotein nucleocapsid, in which the genome is associated with the N, P and L
  • This nucleocapsid is surrounded by the matrix and the membrane envelope layer. Infection of a host cell results in release of the viral nucleocapsid into the cytosol, where transcription and replication take place via the RNA-dependent RNA polymerase.
  • All transcription takes place from a single promoter at the 3' end of the genome. After transcription of each gene, the polymerase either terminates or continues to the next gene downstream, yielding a gradient of mRNA production, with those genes closest to the 3' end of the genome being transcribed in the highest copy number, and increasingly fewer transcripts produced for the genes towards the 5' end. Typically each virus produces 5 to 10 different mRN s .
  • the level of the nucleoprotein (often designated “N” or "NP") determines the timing of a switch between mRNA generation and genome
  • Replication involves the production by the polymerase of full-length positive-sense antigenomes which are subsequently transcribed into full-length negative sense genome copies for packaging into virions.
  • RNA in which case expression requires only transcription from the vector genome
  • protein in which case expression requires transcription into mRNA by viral proteins followed by translation into protein .
  • Rhabdoviruses and in particular of the rabies virus, are described in more detail below as illustrative examples of mononegaviral biology.
  • Rhabdoviruses typically have genomes of around ll-15kb in length. They variously infect vertebrates (including mammals and fish), insects and plants.
  • the rabies genome has short non-coding regions at its termini, designated the 3' leader (le) and 5' trailer (tr) , which respectively initiate and terminate genome transcription and replication.
  • the very 3' and 5' ends are inversely
  • termini also contain promoter sequences for transcription and replication, and for encapsidation of genomic RNA.
  • the 5 structural genes are ordered (3' to 5' ) N
  • Each structural gene comprises a coding region flanked by a 3' transcription initiation signal (TIS) (consensus sequence 3 ' -U-U-G-U-R-R-n-G-A-5' and a 5' TIS) (consensus sequence 3 ' -U-U-G-U-R-R-n-G-A-5' and a 5' TIS) (consensus sequence 3 ' -U-U-G-U-R-R-n-G-A-5' and a 5'
  • TIS transcription initiation signal
  • TTP transcription termination polyadenylation
  • Infection is mediated by binding of the G protein to its receptor on the surface of the target cell.
  • the virus is then internalised via the cell's endosomal transport pathway.
  • the low pH in the endosome induces membrane fusion (between the endosomal membrane and the viral envelope) , also mediated by the G protein, releasing the ribonucleoprotein complex into the cytoplasm.
  • Transcription is believed to proceed via a stop- start mechanism, beginning at the 3' end of the genome and progressing towards the 5' end, producing 6 consecutive transcripts, firstly of the leader RNA, and then each of the N, P, M, G and L genes in turn.
  • the polymerase is believed to dissociate from the template at each stop signal and reinitiate poorly at the next start signal. This results in a gradient of mRNA production with the amount of leader
  • transcript being greatest, followed by N, P, M, G and L transcripts . Later in infection, the polymerase switches from mRNA
  • the M protein plays a regulatory role in determining the timing of the switch between
  • rabies N protein An exemplary sequence of a rabies N protein is as follows:
  • rabies P protein An exemplary sequence of a rabies P protein is as follows:
  • An exemplary sequence of a rabies M protein is as follows: MNLLRKIVKNRRDEDTQKSSPASAPLDDDDLWLPPPEYVPLKELTGKKNMRNFCINGRVK VCSPNGYSFRILRHILKSFDEIYSGNHRMIGLVKVVIGLALSGSPVPEGLNWVYKLRRTF IFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVIAKQCHIQGRVWCINMNPRACQL WSDMSLQTQRSEEDKDSSLLLE
  • An exemplary sequence of a rabies L protein is as follows:
  • a rabies N protein when used in the vectors of the present invention, may have the sequence shown above, or may have at least 70% identity thereto, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto .
  • a rabies P protein may have the sequence shown above, or may have at least 70% identity thereto, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto .
  • a rabies M protein may have the sequence shown above, or may have at least 70% identity thereto, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto .
  • a rabies L protein may have the sequence shown above, or may have at least 70% identity thereto, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto .
  • rabies G protein (strain B19G) is as follows:
  • G protein having B19 strain intracellular domain but the extracellular domain from a different strain, has the sequence: VPQALLFVPLLVFPLCFGKFPIY I PDKLGPWSPIDIHHLSCPNNLWEDEGCTNLSGFSY MELKVGYI SAIKMNGFTCTGVVTEAETYT FVGYVTTTFKRKHFRPT DACRAAYNWKMAGD PRYEESLHNPYPDYHWLRTVKTTKESLVI ISPSVADLDPYDRSLHSPVFPGGNCSGVAVSST YCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCG VLGLRLMDGT VAMQTSNETKWCPPGQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIM TTKSVSFRRLSHLRKLVPGFGKAY I FNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHP HVNGVF
  • a rabies G protein may have either of the sequences shown above, or may have at least 70% identity thereto, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least
  • a pseudotyped envelope protein for use with a vector based on a rabies virus may have the intracellular domain and
  • the transmembrane domain from either of the G protein sequences shown above may have at least 70% identity thereto, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto.
  • extracellular domain may have at least 70% identity, e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to one of the extracellular domain sequences shown above or may be selected depending on the cell to which the vector will be targeted.
  • Each gene (or open reading frame) encoded by the vector is typically associated with appropriate regulatory signals to ensure expression (i.e. transcription and translation) .
  • each gene may comprise a transcriptional start signal and a transcriptional stop signal.
  • Transcriptional start signals are typically C-rich sequences of around 8 bases in length, such as ACATCCCT and ACACCCCT. Stop signals are typically stretches of poly (A), such as AAAAAAA.
  • Each gene may also comprise a Kozak sequence to ensure appropriate transcriptional initiation. Additional regulatory sequences, including non-mononegaviral elements, such as internal ribosomal entry sites (IRES) may also be present to ensure desired levels of gene expression,
  • a % amino acid sequence identity value is determined by the number of matching identical residues as determined by WU-BLAST-2, divided by the total number of residues of the reference sequence (gaps introduced by WU-BLAST-2 into the reference sequence to maximize the alignment score being ignored), multiplied by 100.
  • Rabies virus vectors lacking a functional glycoprotein G are well known for mapping synaptic connections between neurons. See, for example, US 8,334,095 B2. Rabies virus spreads selectively between synaptically
  • a vector based on a rabies virus in which the G gene has been deleted or inactivated can only propagate to adjacent cells if a gene encoding a G glycoprotein (or another pseudotyped envelope protein) is supplied in trans, e.g. via a helper virus, such as an adeno-associated viral (AAV) vector. If the AG-Rabies vector and the helper virus are carefully targeted to the same cell, the rabies virus is able to propagate to cells
  • synaptically adjacent but no further (as the adjacent cells do not express the envelope protein required for further propagation) .
  • This therefore enables synaptic connections to be visualised and mapped, e.g. via a fluorescent marker protein carried by the AG-Rabies vector.
  • AG-Rabies is pseudotyped with the envelope protein from avian sarcoma leukosis virus (ASLV) type A or type B (EnvA, EnvB) , which are specific for the receptors TVA and TVB respectively. Since these proteins are not naturally expressed in mammals, transduction by the relevant pseudotyped vector can be limited to cells
  • Some approaches to synaptic mapping use animal models which have been engineered to express a viral recombinase which may target recognition sites in the rabies vector or helper virus genomes. Further levels of control can be achieved by placing the recombinase gene in the recipient animal under the transcriptional control of an inducible promoter.
  • the recipient animal may have been engineered to possess genomic recognition sites for such a recombinase, in order that a cellular genomic recombination event takes place after transduction with a vector encoding the
  • Cre-Lox pairing of recombinase and recognition sites is used, where the Cre recombinase acts on the Lox recognition sites.
  • deletion or inactivation of the G glycoprotein does not interfere with the usual process of viral transcription, protein synthesis and replication of the core within the recipient cell.
  • the accumulation of viral RNA and protein within the cell has the effect that the labelled cells typically remain viable for only 1-2 weeks, as a result of cell viability being directly compromised by viral proteins, an immune response against the infected cell, or other mechanisms .
  • the vectors of the present invention exploit the coupled nature of mononegaviral transcription and replication to provide a switch for the viral transcription-replication cycle within infected cells, turning the virus on or off depending on the presence (and activity) of specific activating agents or inhibitory agents .
  • the vector encodes a replication modulator protein switchable between a configuration
  • configurations of the replication modulator protein are designated “targeted” and “untargeted” to reflect the presence or absence of the degron.
  • the replication modulator protein exists primarily in the targeted configuration, the virus is unable to build up a significant quantity of the relevant protein in a functional form. Although a short period of viral transcription and replication may be possible immediately after primary
  • the length of time for which the virus will persist in the infected cell in the targeted configuration will vary
  • a vector of this sort based on the rabies virus is likely to be cleared from a neural cell within a period of approximately two weeks to one month.
  • the switch between configurations results from interaction between the regulator moiety and the activating agent or inhibitory agent, as appropriate.
  • the interaction may involve covalent or non-covalent modification of the regulator moiety.
  • Covalent modification may be achieved by enzyme action, i.e. the activating agent or inhibitory agent is an enzyme and the regulator moiety is a substrate for that enzyme.
  • An example of covalent modification is proteolytic cleavage.
  • Non-covalent modification may be achieved by binding of the activating agent or inhibitory agent to the regulator moiety, i.e. the activating agent or inhibitory agent may be a ligand for the regulator moiety.
  • an activating agent may stabilise a replication modulator protein by "cleavage-induced stabilisation” or “ligand-induced stabilisation”.
  • an inhibitory agent may
  • the switch between targeted and untargeted configurations may be reversible or irreversible, depending on the nature of the replication modulator protein and the activating or inhibitory agent.
  • the activating agent or inhibitory agent is a ligand for the modulator protein
  • the switch between the two configurations may be reversible.
  • the degron may be any feature which confers a particularly short half-life to a protein, e.g. by marking it for degradation. Many different types of degron are known. Some act by marking a protein for ubiquitinylation (ubiquitin-dependent degrons), while others are ubiquitin-independent .
  • the degron may be a PEST sequence.
  • a PEST sequence is a peptide sequence motif typically at least 12 amino acids in length, hydrophilic, and rich in proline, glutamic acid, serine and threonine. Li at al. (Generation of Destabilized Green Fluorescent Protein as a Transcription Reporter, J.
  • NPDC-1 Neuronal proliferation and differentiation control protein-1
  • PEST motif having the sequence KELDTASSDEENEDGDFTVYECPGLAPTGEMEVR .
  • the replication modulator protein may comprise a PEST sequence.
  • a replication modulator protein comprising a PEST sequence will typically be an inhibitory modulator protein since it will tend to be degraded until the PEST sequence is removed.
  • a PEST sequence will often be located C-terminal of the viral protein moiety, e.g. at the C-terminus of the modulator protein .
  • the replication modulator protein will typically comprise a viral protein moiety and a regulator moiety located C-terminal of the viral protein moiety, wherein the regulator moiety comprises a protease cleavage site and a PEST sequence.
  • replication modulator protein comprising a rabies virus N protein as viral protein moiety, and a regulator moiety comprising a TEV protease cleavage site and a PEST sequence (“N-TEV-PEST”) :
  • the N protein viral protein moiety is shown in regular font, the regulator moiety is shown in italics, with single underlining for the TEV sequence and double underlining for the PEST sequence.
  • the degron may be an N-terminal amino acid or short N-terminal sequence motif. It is well established that proteins having residues other than Met, Gly or Val at their N-terminus tend to be less stable than those having Met, Gly or Val. This is referred to as the N-end rule. See, for example, Varshavsky, A. (2011) "The N-end rule pathway and regulation by
  • Arg/N-end rule pathway which involves N-terminal arginylation of protein substrates
  • Ac/N-end rule pathway which involves co-translational N-terminal acetylation of some proteins having Met, Ala, Val, Ser, Thr or Cys .
  • endogenous cellular enzymes e.g. Met-aminopeptidases
  • the N-terminal residue present after processing may represent the degron.
  • the order of stability in mammalian cells is roughly Gin (Q) , Arg (R) , Glu (E) , Phe (F) , Asp
  • modulator protein may comprise an N-terminal amino acid sequence
  • regulator moiety and a viral protein moiety downstream of the regulator moiety, wherein the regulator moiety comprises a first residue at its N-terminus and a cleavage site for a cognate protease, and wherein, after cleavage by the cognate protease, the viral protein moiety has at its N-terminus a second residue which confers a different half life than the first residue.
  • an inhibitory modulator protein may comprise a first N- terminal residue, and be cleavable (e.g. by a protease) to expose a second N-terminal residue which confers greater stability than the first N-terminal residue.
  • the first N-terminal residue may be Arg or Lys (or the sequence Arg-Lys), and the second N-terminal residue may be Val.
  • an inhibitable modulator protein may be expressed with a first N-terminal residue, and be cleavable (e.g. by a protease) to expose a second N-terminal residue which confers lower stability than the first N-terminal residue.
  • the first N-terminal residue may be Met or Val, or the sequence Met-Val
  • the second N-terminal residue may be Arg or Lys (or the sequence Arg-Lys.
  • the regulator moiety will be located at the N- terminus of the molecule and may comprise a cleavage site for a cognate protease immediately upstream of the chosen second N-terminal residue.
  • the modulator protein will comprise one or more surface-exposed Lys residues to act as sites for
  • auxin- inducible degron An example of ligand-induced destabilisation is the auxin- inducible degron. This utilises an auxin to induce targeting for degradation. Binding of an auxin (such as indole-3-acetic acid (IAA) or 1-naphthaleneacetic acid (NAA) ) to the plant protein TIRl (a component of the ubiquitin ligase designated SCF) allows TIRl to interact with proteins of the AUX/IAA family, resulting in ubiquitinylation of the AUX/IAA protein and its subsequent degradation by the proteasome. Other components of the SCF ubiquitin ligase are well conserved in most eukaryotes.
  • IAA indole-3-acetic acid
  • NAA 1-naphthaleneacetic acid
  • an AUX/IAA protein such as IAA17 may be employed as a regulator moiety in cells which express TIRl (e.g. eukaryotic non-plant cells which have been engineered to express TIRl) . Addition of an auxin to the cell will then result in degradation of any protein comprising an AUX/IAA moiety.
  • an inhibitable regulator moiety may comprise an AUX/IAA protein.
  • the DD-FKBP and LID-FKBP degron systems are based on the F 506 binding protein 12 (FKBP12), and provide examples of ligand- induced stabilisation and ligand-induced destabilistion, respectively .
  • DD-FKBP Destabilisation domains of FKBP12
  • Shield-1 a ligand called “Shield-1”
  • DD-FKBP can be used as an inhibitory regulator moiety, which can be stabilised by introduction of Shield-1.
  • the DD-FKBP moiety can be located either N-terminal or C- terminal of the viral protein moiety in the modulator protein.
  • the LID-FKBP system is a ligand-induced destabilisation (or degradation) system in which a synthetic 19 amino acid degron having the sequence TRGVEEVAEGVVLLRRRGN is fused to the C- terminus of the FKBP12 protein (or a Phe36Val variant thereof designated FKBP12 F36V ) .
  • the peptide binds to the ligand binding pocket of FKBP12 thus sequestering it.
  • Addition of another ligand for the same binding site, such as Shield-1 induces release and exposure of the degron peptide, which consequently marks the entire protein for degradation.
  • a regulator moiety may comprise a LID-FKBP moiety.
  • a regulator moiety comprising a LID-FKBP moiety would typically be located C- terminal of the viral protein moiety in a replication
  • modulator protein and ideally at the C-terminus of the modulator protein.
  • Binding of a hydrophobic ligand to a regulator moiety may also be used to mark a protein for degradation.
  • the so-called "HaloTag” system employs a modified haloalkane dehydrogenase (the HaloTag) and a small molecule hydrophobic ligand (e.g. HyT13) which covalently binds to the active site of the modified haloalkane dehydrogenase. It appears that the binding of the ligand to the protein marks the protein for degradation by the proteasome.
  • an inhibitable regulator moiety may comprise a HaloTag, which and may be located either N-terminal or C-terminal of the viral protein moiety.
  • replication modulator protein (or vice versa) may be any replication modulator protein (or vice versa).
  • the regulator moiety typically comprises a degron and a cleavage site for the protease, wherein the protease cleavage site is located between the viral protein moiety and the degron.
  • the replication modulator protein may comprise a linker peptide located between the viral protein moiety and the regulator moiety.
  • the regulator moiety may comprise a linker peptide between the protease cleavage site and the degron.
  • the moieties of the replication modulator may be in any appropriate orientation.
  • the viral protein may be located N-terminal of the regulator moiety, or the regulator moiety may be located N-terminal of the viral protein, with the linker (where present) between them.
  • some degron sequences do have a requirement for being located at the N- or C-terminus of the protein.
  • a peptide linker is typically between 3 and 30 amino acids in length, with a high proportion of small and hydrophilic amino acid residues (e.g. glycine and serine) to provide the required flexibility without compromising aqueous solubility of the molecule. It may also contain the cleavage site on which the protease acts. The residues other than the cleavage site (and any other sequence required for recognition by the protease) may comprise at least 50% glycine and serine residues, at least 60% glycine and serine residues, at least 70% glycine and serine residues, at least 80% glycine and serine residues, or at least 90% glycine and serine residues.
  • the protease may be orthogonal to the target cell, which is to say that the protease recognises a cleavage site not found in native proteins encoded by and expressed in the target cell (i.e. in the proteome of the target cell) .
  • protease may vary depending on the intended target cell to which the vector is to be delivered.
  • the target cell will typically be a neuron, in which case the protease should not act on any native cellular proteins expressed within that neuron.
  • proteases should not act on other proteins encoded by the vector.
  • suitable proteases include:
  • Viral proteases such as Tobacco Etch Virus protease (TEVp) and human rhinovirus (HRV) 3C protease;
  • Consensus cleavage sites for these proteases are as follows, where " ⁇ " indicates the position of the cleaved peptide bond:
  • compositions and methods of treatment are provided.
  • agents described herein can be formulated in
  • compositions may comprise, in addition to one of the above substances, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • a pharmaceutically acceptable excipient such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • the precise nature of the carrier or other material may depend on the route of administration, which may be by any suitable route, and may be oral or parenteral. Because of the difficulties experienced with oral delivery of peptide agents, parenteral
  • parenteral routes include but are not limited to intravenous, intramuscular, intraperitoneal, cutaneous, subcutaneous, transdermal, and other mucosal routes such as nasal, buccal, rectal and vaginal routes. Examples of suitable compositions and methods of administration are provided in Esseku and Adeyeye (2011) and Van den Mooter G. (2006) .
  • compositions for oral administration may be in tablet, capsule, powder or liquid form.
  • a tablet may include a solid carrier such as gelatin or an adjuvant.
  • Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
  • the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
  • Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
  • administration is preferably in a "prophylactically effective amount” or a “therapeutically effective amount” (as the case may be, although prophylaxis may be considered therapy) , this being sufficient to show benefit to the individual.
  • a "prophylactically effective amount” or a “therapeutically effective amount” as the case may be, although prophylaxis may be considered therapy
  • the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g.
  • TEVs Tobacco Etch Virus cleavage site
  • the binary system composed by TEVp and TEVs can be pharmacologically regulated to modulate on the extent and temporal window of viral protein degradation during viral production and in vivo. Namely, the virus is able to transcribe and replicate only when TEVp is present, giving origin to a system in which viral transcription and replication are constitutively OFF unless TEVp is provided.
  • recombinase driven by the SiR should ensure a permanent recombination of the Rosa locus and YFP expression even after a complete transcriptional shut down of the virus (Fig. 2 ⁇ ) . Indeed, while 3 days post-infection (p.i.) only the virally encoded mCherry can be detected (Fig 8 C-C") , already by 6 days post-infection, the viral encoded CRE recombinase induces recombination of the conditional mouse reporter cassette and expression of YFP in all infected neurons (Fig 8 D-D") .
  • the destabilised mCherryTM 37 marks the presence of active virus with high temporal resolution (half life ⁇ 2hrs) (22) .
  • siR CRE siR CRE""mCherrY infected CAl pyramidal neurons
  • YFP 0N YFP 0N neurons
  • siR CRE ⁇ raCherry begins to switch OFF in a fraction of infected neurons (29 ⁇ 3% mCherry 0 ;r YFP 0N , Fig. 2C-C" , F) .
  • conditional proteasome degradation is sufficient to modulate the viral transcription-replication cycle.
  • an AAV virus to express TEVp under a doxycycline inducible promoter
  • siR CR s-m herry Given the shorter life cycle of the siR CR s-m herry we ag ⁇ g ⁇ whether it retains the ability to spread transsynaptically from the primary infected neurons before the virus switches off. In order to test this, we first injected an AAV
  • Presynaptic neurons were also identified in the Entorhinal cortex (Fig. 3A' ' ' ) . More importantly, SiR-infected starting cells expressing TVA and G remained viable throughout the infection period (Fig. 3B-B' ' ) . Furthermore, when pseudotyped with the recently developed optimized Rabies Glycoprotein (oG) ⁇ 17) SiR also functions as a highly effective retrograde (non- transsynaptic) tracer (fig. 3C,D).
  • siR CRE ⁇ mCherry in the pyramidal layer of CA1 in Rosa-LoxP-STOP-LoxP-ChR2YFP.
  • SiR can be used to monitor network activity in vivo using calcium imaging.
  • the optimal temporal window for optical imaging of neurons is, typically, 5-7 days from the Rabies infection (17) .
  • the use of the recently introduced AG- Rabies strain variant CVS-N2c AG can push the useful temporal window for imaging further up to 17 days post-infection (25) .
  • SiR there are no upper bounds to the temporal window for the optical investigation of network elements.
  • SiR the most valuable solution for the long- term monitoring of neural network activity as well as for the functional and genetic manipulation of neural circuits (26- 29) .
  • the unique transient replicative nature of SiR offers the possibility to follow circuit remodelling after physiological or pathological structural plasticity such as, upon learning, during neurodegenerative conditions or following traumatic brain injuries and it may pave the way to functional interventions at the network level in such cases.
  • SPLIT-TEV cassette (30) was added at the C- terminal of each viral protein (AG-VP PEST Rabies sPLiT-TEv-mcherryj _
  • a tag myc, FLAG or V5
  • the SPLIT-TEV dimeric protease is only active in presence of rapamycin, and could potentially provide a tool for the exogenous regulation of viral protein stability during production and in vivo.
  • Rabies plasmids listed in Table 1, were generated by Gibson cloning using the pSAD-AG-F3 plasmid (21) as starting material. Briefly, the Rabies genome was PCR amplified in 2 fragments starting from the protein to be tagged. These fragments were then mixed with the tag and/or PEST domain obtained by oligonucleotides annealing and assembled using Gibson master mix (NEB) .
  • NEB Gibson master mix
  • the lentiviral vectors used to generate the packaging cells were derived from a 3 rd generation lentivirus transfer vector (gift from Michael Hastings "361 polilinker", originally pCCL- SIN-18PPT.Pgk.EGFP-WPRE) . All the lentiviral vectors were generated by Gibson assembly, opening the backbone by
  • HEK293T cells and BHK were purchased from ATTC.
  • HEK293T packaging cells expressing Rabies glycoprotein (HEK-GG) were generated by lentivirus infection with Lenti- E2B GFP-2A-GlySAD (Table 1) and after 3 passages by fluorescent activated cell sorting (FACS) of GFP expressing cells.
  • HEK293T packaging cells expressing Rabies glycoprotein and TEV protease (HEK- TGG) were generated from HEK-GG by lentivirus infection with Lenti-puro-2A-TEV and selected, after 3 passages, with 1 ⁇ g/mL of puromycin added to the media for 1 week.
  • BHK packaging cells for pseudotyping Rabies virus with optimized G were generated with the same procedure as the HEK-TGG infecting first with pLenti- H2B GFP-2A-oG and subsequently with pLenti-puro-2A-TEV .
  • BHK packaging cells for pseudotyping Rabies virus with EnVA receptor were obtained infecting BHK-EnVA with Lenti-puro-2A-TEV and selecting with puromycin.
  • HEK-GG or HEK- TGG cells were co-transfected with rabies genome vector, pcDNA-T7, pcDNA-SADB19N, pcDNA-SADBl 9P, pcDNA- SADB19L, and pcDNA-SADB19G (22) and maintained at 37 °C with 5% C0 2 humidified atmosphere in DMEM supplemented with 10% FBS
  • HEK-GG or HEK-TGG were infected in 10 cm dishes at 70-80% confluence with 1 ml of viral supernatant obtained as described in the viral screening section. Cells were split the day after infection and
  • the media was replaced with 2% FBS DMEM and maintained for 2 days at 35 °C and 3% CO2. Then, the viral supernatant was collected, cell debris removed by centrifugation at 2500 rpm for 10 minutes followed by filtration with 0.45 um filter and then the virus concentrated by ultracentrifugation with sucrose cushion as described before (22) .
  • Rabies viruses pseudotyped with oG were produced infecting BHK-T-oG cells in 10 cm dishes with 1 mL of viral supernatant. Cells were split the day after infection and maintained for one or two days at 37 °C and 5% checking daily the viral spreading. When 70-80% of cells expressed the viral marker, the media was replaced with 2% FBS DMEM and maintained for 2-3 days at 35°C and 3% CO2. Then, the supernatant was collected and processed as previously described (20) .
  • hESCs Human Embryonic Stem cells derived neurons were kindly provided by Dr. Rick Livesey. Cells were plated in 24-wells glass bottom plates and infected over night with attenuated or control AG-Rabies viruses supernatants at comparable MOI to obtain ⁇ 5% of infected cells. Cells were imaged every 4 days post infection overnight in a 37 °C heated Leica SP8 confocal microscope in Hibernate®-A Medium (Invitrogen) with 5 random fields imaged for each well. Cell survival was calculated normalizing each condition to the mortality of control
  • Lentivirus-GFP infected hESCs derived neurons imaged and processed in the same conditions.
  • mice All procedures using live animals were approved by the Home Office and the LMB Biosafety committee. For all experiments mice aged between 6-12 weeks were used. Mice were anesthetized with isofluorane delivered at a flow of 3% in 2L/min of oxygen for the initial induction and then maintained at 1-2% in 2 L/min of oxygen. The anesthetized animal was placed into a stereotaxic apparatus (David Kopf Instruments) and Rimadyl (2 mg/kg body weight) was administered subcutaneously (s.c.) as anti-inflamatory . A small hole (500 ⁇ diameter) was drilled and viruses were injected using a Hamilton neurosyringe . The syringe was left in the brain for 5 min before being
  • Viruses were injected at the following titers:
  • 3xl0 8 infectious units/ml for Rabies viruses 2xl0 12 genomic copies/ml for AAVs, 3xl0 8 infectious units/ml for Lentiviruses .
  • Up to a max of 400 nl in volume of virus were injected in the following brain areas: CAl (AP: 2.3 mm, ML: 1.65 mm and DV: 1.45mm from bregma), VI (AP: 2.3 mm, ML: 1.65 mm and DV: 1.45 mm from bregma), V2 (AP: 3.6 mm, ML: 1.2 mm, DV:0.6 mm from bregma) .
  • hemispheres At 1-2-3 or 8 weeks p.i. brains were sectioned at the cryostat (35 ⁇ ) . Infected neurons were imaged sampling the entire hippocampus (acquiring one every 4 sections) using a robot assisted Nikon HCA microscope mounting a ⁇ (0.45NA) air objective and fluorescent hippocampal neurons counted using Nikon HCA analysis software. Cell survival for
  • Rosa-LoxP-STOP-LoxP-YFP animals were injected in CAl of hippocampus with an AAV constitutively expressing rTTA and TEV protease under the control of a doxycycline inducible promoter (Table 1) . 1-week p.i. the same area was re-injected with
  • SiR mCherry_CRE was injected in CAl region of hippocampus of Rosa-LoxP-STOP-LoxP-YFP animals. After 1, 2, 3 or 8 weeks- mice were culled and the injected hippocampi manually dissected immediately after. The hippocampi were homogenised using a Tissuelyser II (Qiagen) and processed accordingly to manufactory instruction with RNeasy kit
  • RNA per hippocampus 500 ng of RNA per hippocampus were retrotrascribed using superscript IV kit (Invitrogen) and analysed for GADPH, YFP and mCherry expression by quantitative PCR (rotorgene sybr-green) . The Livak method was applied for quantification. The expression of YFP and mCherry was
  • Coronal hippocampal slices (350 ⁇ ) were prepared using a vibrating microtome (7000smz-2, Campden Instruments LTD,
  • aCSF oxygenated artificial cerebrospinal fluid
  • aCSF oxygenated artificial cerebrospinal fluid
  • mM NaCl 126, KC1 3, NaH 2 P0 4 1.25, MgS0 2, CaCl 2 2, NaHCCh 26.4, glucose
  • osmolarity adjusted to 280-300 mOsm/L and stored thereafter in the same holding chamber at room temperature for at least 1 h.
  • Slices were then individually transferred to the recording chamber and were superfused with oxygenated aCSF at room temperature at a flow-rate of approximately 2 mL/min.
  • the AMPA receptor antagonist DNQX (20 ⁇ ; Sigma-Aldrich, Dorset, UK) was used in a subset of electrophysiological recordings in order to probe synaptic connectivity between neurons infected with SiR virus and neighbouring neurons.
  • the animal was head-fixed and a metal head-post cemented to the skull. A craniotomy of 4 mm in diameter was drilled over the VI cortex. After the removal of the skull, the cortical surface was kept moist with a cortex buffer, containing: 125 mM NaCl, 5 mM KC1, 10 mM Glucose, 10 mM HEPES, 2 mM MgS0 4 and 2 mM CaCl 2 , adjusted to pH 7.3. The cortex was then covered with a custom made plug coverslip (23) and sealed with Super Glue and dental cement.
  • a cortex buffer containing: 125 mM NaCl, 5 mM KC1, 10 mM Glucose, 10 mM HEPES, 2 mM MgS0 4 and 2 mM CaCl 2 , adjusted to pH 7.3.
  • the cortex was then covered with a custom made plug coverslip (23) and sealed with Super Glue and dental cement.
  • Mice were anaesthetized with 2% of isofluorane and mounted under a two-photon laser-scanning microscope (Multiphoton Imaging System, Scientifica Ltd., Uckfield, United Kingdom) equipped with a Ti: sapphire mode-locked laser (Mai Tai-Series, Spectra Physics) tuned at 920 nm. Imaging was performed through a water-immersion lens (Nikon, 16X, 0.8 NA) at a resolution of 256 x 256 pixels with zoom 2 or 4, leading to a field of view of 390 x 390 ⁇ and 195 x 195 ⁇ respectively. Data were acquired at 3.5 Hz.
  • the objective was shielded with a black fabric cone equipped with a plastic o-ring fixed onto the head plate ⁇ 24) .
  • Visual stimulation was controlled using a custom-made GUI in Python (based on PsychoPy toolbox) and was performed with a LED screen positioned 15 cm from the left eye of the mouse.
  • Moving square-wave gratings were presented at 12 directions in 30 degrees steps and a photodiode was used to detect the starting and the ending time of each stimulus. Each grating direction was presented 5 times in random order alternated with a blank condition.
  • the spatial frequency of the grating was 0.04 cycles per degree (cpd) and the temporal frequency was 1 Hz. Imaging and visual stimulation were triggered together using iOS micro-controller board.
  • Imaging session lasted up to 2 hrs and the power at sample was controlled in the range 30-40 mW.
  • Data analysis was performed in ImageJ and Matlab and was restricted to cell bodies.
  • Detection of region of interest was performed with Suite2p.
  • Orientation tuning curves were generated by taking the mean response for each orientation during the entire stimulus period. Response amplitudes are presented as the relative change in fluorescence during the stimulus period compared to the pre-stimulus baseline (dF/F) . All data are presented as mean ⁇ SE .
  • A, B, C, or combinations thereof is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB.
  • compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
  • a mononegaviral vector genome comprising a gene encoding a replication modulator protein, wherein the replication modulator protein comprises a mononegaviral protein moiety which is required for replication of the viral genome, the replication modulator protein being capable of adopting a targeted configuration displaying a degron, and an untargeted configuration which does not display the degron.
  • enterokinase or thrombin enterokinase or thrombin
  • regulator moiety comprises a cleavage site for the protease, located between the viral protein moiety and the degron.
  • enterokinase or thrombin enterokinase or thrombin
  • inhibitory agent is a ligand therefor.
  • RNA recombinase a nuclease, a guide RNA (gRNA) molecule, a repair template RNA, or a nucleic acid modulator of gene expression.
  • gRNA guide RNA
  • nuclease is an RNA-guided endonuclease.
  • heterologous genes encoding an RNA-guided endonuclease plus a guide RNA (gRNA) molecule and/or a repair template RNA.
  • gRNA guide RNA
  • a ribonucleoprotein complex comprising a vector genome according to any one of paras. 1 to 38 in association with one or more viral proteins.
  • a ribonucleoprotein complex according to para. 39 comprising the vector genome in association with N, P and L proteins .
  • a mononegaviral vector virion comprising a mononegaviral vector genome according to any one of paras. 1 to 38.
  • a vector virion according to para. 42 comprising a native mononegaviral envelope protein.
  • a vector virion according to para. 42 comprising a pseudotyped envelope protein.
  • 46. A vector genome according to any one of paras. 1 to 38, a ribonucleoprotein complex according to any one of paras. 39 to 41, or a vector virion according to any one of paras. 42 to 44, for use as an immunostimulatory agent.
  • 47. A positive sense nucleic acid molecule encoding a viral vector genome according to any one of paras. 1 to 38.
  • a packaging cell comprising a nucleic acid construct encoding a vector genome according to any one of paras. 1 to 38 and capable of producing a virion according to any one of paras. 42 to 44.
  • a method of gene delivery to a target cell comprising contacting the target cell with a ribonucleoprotein complex according to any one of paras. 39 to 41 or a virion according to any one of paras. 42 to 44.
  • the activating agent is a protein, and the method comprises introducing into the target cell a nucleic acid comprising a gene encoding the activating agent, such that the activating agent is expressed in the target cell.
  • the vector encodes an inhibitory modulator protein and the activating agent, wherein expression or function of the activating agent is inducible, and wherein the method
  • the vector encodes an inhibitable modulator protein and the inhibitory agent, wherein expression or function of the inhibitory agent is inducible, and wherein the method
  • a method according to para. 55 comprising contacting the target cell with the cognate inducer.
  • 57 A method according to any one of paras. 49 to 56 wherein the vector genome does not comprise a gene encoding an envelope protein and the method comprises the step of
  • nucleic acid construct comprising a gene encoding an envelope protein
  • a kit comprising a vector genome according to any one of paras. 1 to 38, a ribonucleoprotein complex according to any one of paras. 39 to 41 or a virion according to any one of paras. 42 to 44 and (a) a cognate activating or inhibitory agent, or a nucleic acid encoding a cognate activating or inhibitory agent, and/or (b) a nucleic acid encoding an envelope protein.
  • composition comprising ribonucleoprotein complex according to any one of paras. 39 to 41 or a virion according to any one of paras. 42 to 44, optionally admixed with an excipient or carrier.
  • composition is a pharmaceutical composition and the carrier is a pharmaceutically acceptable carrier.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/GB2018/051166 2017-05-02 2018-05-02 Self-inactivating viral vector Ceased WO2018203049A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CA3060675A CA3060675A1 (en) 2017-05-02 2018-05-02 Self-inactivating viral vector
JP2019560380A JP7420558B2 (ja) 2017-05-02 2018-05-02 自己不活性化ウイルスベクター
CN201880029221.8A CN110914439B (zh) 2017-05-02 2018-05-02 自灭活病毒载体
EP18723917.3A EP3619314B1 (en) 2017-05-02 2018-05-02 Self-inactivating viral vector
AU2018262281A AU2018262281B2 (en) 2017-05-02 2018-05-02 Self-inactivating viral vector
US16/607,980 US12203092B2 (en) 2017-05-02 2018-05-02 Self-inactivating rabies virus vector encoding a nucleoprotein and degron
KR1020197035530A KR20200015900A (ko) 2017-05-02 2018-05-02 자가-비활성화 바이러스 벡터
BR112019023003A BR112019023003A2 (pt) 2017-05-02 2018-05-02 vetor viral auto-inativante

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB1706945.1A GB201706945D0 (en) 2017-05-02 2017-05-02 Self-inactivating viral vector
GB1706945.1 2017-05-02

Publications (1)

Publication Number Publication Date
WO2018203049A1 true WO2018203049A1 (en) 2018-11-08

Family

ID=59011153

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2018/051166 Ceased WO2018203049A1 (en) 2017-05-02 2018-05-02 Self-inactivating viral vector

Country Status (10)

Country Link
US (1) US12203092B2 (cg-RX-API-DMAC7.html)
EP (1) EP3619314B1 (cg-RX-API-DMAC7.html)
JP (1) JP7420558B2 (cg-RX-API-DMAC7.html)
KR (1) KR20200015900A (cg-RX-API-DMAC7.html)
CN (1) CN110914439B (cg-RX-API-DMAC7.html)
AU (1) AU2018262281B2 (cg-RX-API-DMAC7.html)
BR (1) BR112019023003A2 (cg-RX-API-DMAC7.html)
CA (1) CA3060675A1 (cg-RX-API-DMAC7.html)
GB (1) GB201706945D0 (cg-RX-API-DMAC7.html)
WO (1) WO2018203049A1 (cg-RX-API-DMAC7.html)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112175914A (zh) * 2019-07-05 2021-01-05 司龙龙 蛋白水解靶向病毒、其活疫苗及其制备方法和用途
WO2022178307A1 (en) * 2021-02-19 2022-08-25 Beam Therapeutics Inc. Recombinant rabies viruses for gene therapy
WO2023039468A1 (en) * 2021-09-08 2023-03-16 Beam Therapeutics Inc. Viral guide rna delivery
EP4375368A4 (en) * 2021-08-12 2025-07-30 Shenzhen Inst Of Adv Tech Cas RECOMBINANT VIRUS CONTAINING DEGRON, ITS PREPARATION METHOD AND APPLICATION

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2022264328A1 (en) * 2021-04-27 2023-11-16 The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. Recombinant cedar virus chimeras
CN116262911B (zh) * 2021-12-14 2026-02-17 中国科学院深圳先进技术研究院 一种减毒、复制可控的顺向hsv示踪系统及其构建方法和应用
CN114058641B (zh) * 2022-01-17 2022-04-01 苏州大学 一种载体系统和应用及通过其降解目的蛋白的方法
CN116676273A (zh) * 2022-02-22 2023-09-01 中国科学院深圳先进技术研究院 一种蛋白水解靶向流感病毒及其制备方法和应用
CN120366391A (zh) * 2023-04-18 2025-07-25 上海本导基因技术有限公司 一种用于治疗亨廷顿疾病的慢病毒样颗粒
CN117867029B (zh) * 2023-12-29 2024-12-20 复百澳(苏州)生物医药科技有限公司 一种狂犬亚型假病毒的制备方法及应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016125364A1 (ja) * 2015-02-02 2016-08-11 株式会社Idファーマ 改良されたマイナス鎖rnaウイルスベクター
WO2017004022A2 (en) * 2015-06-29 2017-01-05 The Board Of Trustees Of The Leland Stanford Junior University Degron fusion constructs and methods for controlling protein production

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
HUP0500722A2 (hu) * 2001-07-20 2005-11-28 The University of Georgia Research Foundation, Inc@Á Attenuált veszettség vírus, a veszettség elleni vakcináláshoz és a központi idegrendszer génterápiájához egy nukleoprotein mutációval a foszforilezés helyén
US7608682B2 (en) 2002-10-30 2009-10-27 Meso Scale Technologies Llc Substrates of N-end rule ubiquitylation and methods for measuring the ubiquitylation of these substrates
US9212359B2 (en) 2011-06-23 2015-12-15 Sanford Jay Silverman Systems for induction of gene expression and protein depletion in yeast

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016125364A1 (ja) * 2015-02-02 2016-08-11 株式会社Idファーマ 改良されたマイナス鎖rnaウイルスベクター
WO2017004022A2 (en) * 2015-06-29 2017-01-05 The Board Of Trustees Of The Leland Stanford Junior University Degron fusion constructs and methods for controlling protein production

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CIABATTI ERNESTO ET AL: "Life-Long Genetic and Functional Access to Neural Circuits Using Self-Inactivating Rabies Virus", CELL, CELL PRESS, AMSTERDAM, NL, vol. 170, no. 2, 6 July 2017 (2017-07-06), pages 382, XP085125805, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2017.06.014 *
D. ATASOY ET AL: "A FLEX Switch Targets Channelrhodopsin-2 to Multiple Cell Types for Imaging and Long-Range Circuit Mapping", THE JOURNAL OF NEUROSCIENCE, vol. 28, no. 28, 9 July 2008 (2008-07-09), US, pages 7025 - 7030, XP055482038, ISSN: 0270-6474, DOI: 10.1523/JNEUROSCI.1954-08.2008 *
FINKE S ET AL: "Replication strategies of rabies virus", VIRUS RESEARCH, AMSTERDAM, NL, vol. 111, no. 2, 1 August 2005 (2005-08-01), pages 120 - 131, XP027663757, ISSN: 0168-1702, [retrieved on 20050801] *
GRAY DANIEL C ET AL: "Activation of Specific Apoptotic Caspases with an Engineered Small-Molecule-Activated Protease", CELL, vol. 142, no. 4, 20 August 2010 (2010-08-20), pages 637 - 646, XP028931171, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2010.07.014 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112175914A (zh) * 2019-07-05 2021-01-05 司龙龙 蛋白水解靶向病毒、其活疫苗及其制备方法和用途
WO2022178307A1 (en) * 2021-02-19 2022-08-25 Beam Therapeutics Inc. Recombinant rabies viruses for gene therapy
US20220290164A1 (en) * 2021-02-19 2022-09-15 Beam Therapeutics Inc, Recombinant rabies viruses for gene therapy
EP4375368A4 (en) * 2021-08-12 2025-07-30 Shenzhen Inst Of Adv Tech Cas RECOMBINANT VIRUS CONTAINING DEGRON, ITS PREPARATION METHOD AND APPLICATION
WO2023039468A1 (en) * 2021-09-08 2023-03-16 Beam Therapeutics Inc. Viral guide rna delivery

Also Published As

Publication number Publication date
US12203092B2 (en) 2025-01-21
CN110914439A (zh) 2020-03-24
KR20200015900A (ko) 2020-02-13
CA3060675A1 (en) 2018-11-08
EP3619314A1 (en) 2020-03-11
GB201706945D0 (en) 2017-06-14
EP3619314B1 (en) 2021-11-10
CN110914439B (zh) 2024-05-17
AU2018262281A1 (en) 2019-11-14
AU2018262281B2 (en) 2024-05-09
JP2020518265A (ja) 2020-06-25
JP7420558B2 (ja) 2024-01-23
US20210115472A1 (en) 2021-04-22
BR112019023003A2 (pt) 2020-05-19

Similar Documents

Publication Publication Date Title
EP3619314B1 (en) Self-inactivating viral vector
US11802273B2 (en) Mutations that confer genetic stability to additional genes in influenza viruses
JP7793675B2 (ja) 抑制性ニューロンにおける電位開口型ナトリウムチャネルのレスキュー
US20220241396A1 (en) Mutations that confer genetic stability to genes in influenza viruses
Nassi et al. Neuroanatomy goes viral!
CA2775151C (fr) Nouveaux polynucleotides et polypeptides chimeriques permettant la secretion d'un polypeptide d'interet en association avec des exosomes et leurs utilisations
EP3684786A1 (en) Mutated glycoprotein of vesicular stomatitis virus
JP7794421B2 (ja) 腫瘍を標的にする合成アデノウイルスおよびその使用
CA3236182A1 (en) Compositions and systems for rna-programable cell editing and methods of making and using same
KR102609571B1 (ko) 개선된 광 민감성을 갖는 채널옵신 변이체에서의 돌연변이의 확인 및 이의 용도
JP2023153320A (ja) Clrn1に関連する聴力喪失及び/または視力喪失を治療する方法
WO2024009280A1 (en) Integrated stress response inhibitors and methods of using the same
US12365898B2 (en) Calcium channel 3.2 inhibitory peptides and uses thereof
Stieglitz The control of neuronal activity and behavior by members of the HCN and TPC family
Schindewolf et al. Optimizing Lentiviral Vector-Based Delivery of SCN1A transgenes to Mammalian Cells
Cattaneo Combinatorial gene therapy for epilepsy
CN118922541A (zh) 用于rna可编程细胞编辑的组合物和系统及其制备和使用方法
WO2025082899A1 (en) Oncolytic viruses and their uses
Levin Muscle Lim Protein in naïve and injured neurons
Liang Ion channels and electrical excitability in native murine anterior pituitary corticotrophs
Jardetzky Oral 1 STRUCTURE AND ACTIVATION OF PARAMYXOVIRUS FUSION GLYCOPROTEINS

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18723917

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 3060675

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019560380

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019023003

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2018262281

Country of ref document: AU

Date of ref document: 20180502

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197035530

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018723917

Country of ref document: EP

Effective date: 20191202

ENP Entry into the national phase

Ref document number: 112019023003

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20191101