WO2018178377A1 - Universal anti-cd22 chimeric antigen receptor engineered immune cells - Google Patents

Universal anti-cd22 chimeric antigen receptor engineered immune cells Download PDF

Info

Publication number
WO2018178377A1
WO2018178377A1 PCT/EP2018/058367 EP2018058367W WO2018178377A1 WO 2018178377 A1 WO2018178377 A1 WO 2018178377A1 EP 2018058367 W EP2018058367 W EP 2018058367W WO 2018178377 A1 WO2018178377 A1 WO 2018178377A1
Authority
WO
WIPO (PCT)
Prior art keywords
car
cells
cell
gene
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2018/058367
Other languages
English (en)
French (fr)
Inventor
Julianne Smith
Philippe Duchateau
Murielle DERRIEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cellectis SA
Original Assignee
Cellectis SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/EP2017/076800 external-priority patent/WO2018073393A2/en
Priority to BR112019020203-0A priority Critical patent/BR112019020203A2/pt
Priority to CN201880036267.2A priority patent/CN110869046B/zh
Priority to MX2019011475A priority patent/MX2019011475A/es
Priority to AU2018246377A priority patent/AU2018246377B2/en
Priority to KR1020197032371A priority patent/KR102726269B1/ko
Priority to ES18715024T priority patent/ES2979232T3/es
Priority to CA3058268A priority patent/CA3058268A1/en
Priority to EP24166930.8A priority patent/EP4414380A3/en
Priority to DK18715024.8T priority patent/DK3592379T3/da
Application filed by Cellectis SA filed Critical Cellectis SA
Priority to RU2019133365A priority patent/RU2775453C2/ru
Priority to EP18715024.8A priority patent/EP3592379B1/en
Priority to US16/498,899 priority patent/US11944643B2/en
Priority to JP2020503358A priority patent/JP7314115B2/ja
Publication of WO2018178377A1 publication Critical patent/WO2018178377A1/en
Priority to IL269538A priority patent/IL269538B2/en
Anticipated expiration legal-status Critical
Priority to JP2023114120A priority patent/JP7634045B2/ja
Priority to US18/393,322 priority patent/US12133867B2/en
Priority to US18/898,069 priority patent/US20250026808A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/365Lactones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001111Immunoglobulin superfamily
    • A61K39/001113CD22, BL-CAM, siglec-2 or sialic acid- binding Ig-related lectin 2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4212CD22, BL-CAM, siglec-2 or sialic acid binding Ig-related lectin 2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • C12N5/0638Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/804Blood cells [leukemia, lymphoma]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor

Definitions

  • the present invention generally relates to the field of immunotherapy, and more specifically to Universal chimeric antigen receptor T cells specific for CD22 (UCART22) that are engineered human primary immune cells comprising at least one edited gene, preferably a gene coding a TCR subunit or a CD52 gene, and a Chimeric Antigen Receptors (CAR) specific for the cluster of differentiation 22 (CD22), (CAR CD22), and to methods for engineering said cells.
  • the invention further relates to UCART 22 for their use in patients who may or may not be the initial donor of cells ("allogenic" or "autologous" CD22 CAR engineered primary human immune cells) as a treatment for relapse refractory hematological cancers.
  • the cells expressing a CD22 according to the invention are particularly efficient and safe for immunotherapy in particular against aggressive or relapsed cancer.
  • CARs are synthetic receptors consisting of a targeting moiety that is associated with one or more signaling intracellular domains in a single molecule or in multiple transmembrane domains forming a multimer.
  • the binding moiety consists of an antigen-binding domain from a single-chain antibody (scFv), comprising the variable fragments of a monoclonal antibody joined by a linker. Binding moieties based on receptor or ligand domains have also been used successfully to prepare a CAR.
  • TCR T cell receptor
  • transmembrane and hinge domains have been added to form CARs of second and third generations, leading to successful therapeutic trials in humans.
  • T-cells from a patient suffering a hematological ("liquid") cancer were redirected against malignant cells expressing for example CD19 or CD22 (June et al., 2011, Haso et al., 2013) and reinjected into the same patient.
  • UCART22 a new efficient treatment
  • engineered primary human T cell with at least a deletion of the TRAC gene, endowed with a chimeric antigen receptor targeting CD22 and a safety marker allowing the number of said cells to be controlled in vivo and consequently the activity of said cells.
  • UCART22 comprising engineered primary human T cell with at least a deletion of the TRAC gene, at least one additional deletion in CD52, dCK, beta2microglobulin are gene is contemplated.
  • These new UCART22 are particularly efficient for adoptive transfer in a patient suffering a CD22 mediated pathology, whether or not said patient is the initial donor of immune cells and whether or not said patient is already under therapy that affects immunity.
  • UCART 22 cells of the invention are resistant to at least one chemical or antibody drug usually used to treat CD22-mediated pathology, such as Campath and/or Purine nucleotide analogs (PNAs).
  • UCART 22 cells of the invention can survive and be active in the presence of said drug used at a dose that kills more than 80% of the cells.
  • TCR KO T Cell Receptor Knock Out
  • CD22 CAR Chimeric Antigen Receptor
  • an antigen binding domain specific for CD22 optionally a leader sequence
  • said safety switch comprising :
  • rituximab mAb-specific epitopes preferably located between the VH and the Hinge domain, or 3 rituximab mAb-specific epitopes or 3 rituximab mAb-specific epitopes and a QBEN-10 mAb-specific epitopes linked to the CD22 CAR.
  • UCART 22 of embodiment 1 wherein a polynucleotide sequence having at least 80% identity with SEQ. ID N°ll is inserted into the genome, and further comprising an inactivated TRAC gene with an insertion, a deletion or a mutation within SEQ. ID N°18, with undetectable level of T Cell Receptor (TCR) at the cell surface as measured by flow cytometry, and undetectable level of off site events as measured by guide sequence technique.
  • TCR T Cell Receptor
  • the UCART22 according to any one of embodiment 1 to 2 comprising another inactivated gene selected from dCK gene, B2M gene, CD52 gene, preferably CD52 gene.
  • the UCART22 according to any one of embodiment 1 to 3 wherein and at least one additional gene is inactivated, said gene is selected from a gene encoding aryl hydrocarbon receptor (AHR), Transforming growth factor beta receptor) (TGF beta receptor), Interleukin 10 receptor (IL-10 R), Program cell death protein 1, a combination thereof. 5. The UCART22 according to any one of embodiment 1 to 4 wherein a gene encoding beta2Microglobulin (B2M), is inactivated.
  • AHR aryl hydrocarbon receptor
  • TGF beta receptor Transforming growth factor beta receptor
  • IL-10 R Interleukin 10 receptor
  • B2M beta2Microglobulin
  • UCART22 according to any one of embodiment 1 to 5 wherein a gene encoding aryl hydrocarbon receptor (AHR), is inactivated. 7. The UCART22 according to any one of embodiment 1 to 6 wherein a gene encoding Transforming growth factor beta receptor) (TGF beta receptor), is inactivated.
  • AHR aryl hydrocarbon receptor
  • TGF beta receptor Transforming growth factor beta receptor
  • UCART22 according to any one of embodiment 1 to 7 wherein a gene encoding Interleukin 10 receptor (IL-10 R), is inactivated.
  • IL-10 R Interleukin 10 receptor
  • UCART22 according to any one of embodiment 1 to 8 wherein a gene encoding Program cell death protein 1 (PD1), is inactivated.
  • PD1 Program cell death protein 1
  • the UCART22 according to any one of embodiment 1 to 4 comprising an additional scfv specific for any one of the following tumor-associated surface antigens selected from CD19, CD20, CD30, a major histocompatibility complex (MHC) molecule, an Immunoglobulin (Ig), CD3, CD5, CD34, CD79, preferably CD79b, CD138, B7-1 (CD80), BCMA (CD269, TNFRSF 17), FLT-3, or PAX5, preferably CD19.
  • MHC major histocompatibility complex
  • CD22CAR further comprises an antigen binding domain specific for CD19 or wherein said UCART 22 further comprises a CD19CAR, preferably a CD19 CAR having at least 80% identity with SEQ. ID N°25 or a SEQ. ID N°26.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD30.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for a major histocompatibility complex (MHC) molecule.
  • MHC major histocompatibility complex
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for an Immunoglobulin (Ig).
  • Ig Immunoglobulin
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD3.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD5.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD34.
  • CAR comprising an additional scfv specific for CD79, preferably CD79b.
  • CAR comprising an additional scfv specific for CD138.
  • CAR comprising an additional scfv specific for CD80.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for BCMA (CD269).
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for TNFRSF 17,
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for FLT-3.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD19.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD30.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for a major histocompatibility complex (MHC) molecule.
  • MHC major histocompatibility complex
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for an Immunoglobulin (Ig).
  • Ig Immunoglobulin
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD3.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD5.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD34.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD138.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD80.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for BCMA (CD269).
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for TNFRSF 17,
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for FLT-3.
  • a population of UCART cells comprising the UCART 22 according to any one of embodiment 1 to 8. 10.
  • the population of UCART cells according to embodiment 9 comprising a UCART 19, preferably a UCART19 expressing an anti-CD19 CAR comprising a sequence of SEQ. ID N°25 or SEQ. ID N°26 at the cell surface.
  • a kit comprising a UCART 22 and a UCART19 for a successive (at least once) or a concomitant or a successive (at least once) and then concomitant administration in a patient in need thereof.
  • kit according to any one of embodiment 11 to 13 further comprising a lymphodepleting treatment, administered before the UCART.
  • kits according to any one of embodiment 11 to 14 wherein lymphodepletion is achieved using fludarabine and cyclophosphamide preferably fludarabine 25 mg/m 2 i.v. ⁇ 5 doses on days -6 to -2 and cyclophosphamide 60 mg/kg i.v. for 1 dose on day -5.
  • kit according to any one of embodiment 11 to 15 comprising at least one other UCART cell directed against a cancer antigen selected from CD79a, CD79b, CD20, CD30, CD52, CD40, CD80, CD86, CD74, VEGF.
  • a pharmaceutical composition comprising the UCART 22 according to any one of embodiment 1 to 8 or a population of cells comprising said UCART 22 according embodiment 9 or 10 and a pharmaceutically acceptable excipient.
  • composition of embodiment 17 further comprising a Bryostatin, preferably Bryostatin-1.
  • a CD22-mediated hematological cancer selected from lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma, leukemia, multiple myeloma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, acute lymphocytic cancer, acute myeloid leukemia, preferably a CD22 expressing hematological cancer selected from (lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma, leukemia, multiple myeloma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, acute lymphocytic cancer, acute myeloid
  • a CD22-mediated hematological cancer selected from lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma,
  • a CD19-mediated hematological cancer selected from lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma, leukemia, multiple myeloma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, acute lymphocytic cancer, acute myeloid leukemia, preferably a CD19 expressing hematological cancer selected from (lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma, leukemia, multiple myeloma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, acute lymphocytic cancer, acute my
  • the invention provides an anti-CD22 CAR comprising a hinge domain selected from FcRllla, CD8alpha, IgGl, lgG4, and PD1, preferably from CD8 alpha or lgG4.
  • a scfv specific for CD22 comprising a VH and a VL linked to each other by a linker LI, preferably a linker comprising 1 to 3 "GGGGS" motif, more preferably one GGGGS” motif.
  • the ANTI-CD22 CAR according to any one of the above wherein said scfv specific for CD22 is linked to a transmembrane domain by a hinge selected from a hinge from FcRllla, CD8alpha, IgGl, preferably from CD8 alpha.
  • the ANTI-CD22 CAR according to any one of the above comprising an intracellular domain, said an intracellular domain comprising a CD3zeta signaling domain and a 4-1BB signaling domain.
  • the anti-CD22 CAR as any one of the above wherein the anti-CD22 CAR comprises at least one, preferably two, three or four monoclonal antibody (mAb)-specific epitopes, preferably two inserted into the linker L of the scfv specific for CD22 and/or into the hinge.
  • mAb monoclonal antibody
  • the anti-CD22 CAR as any one of the above, wherein the mAb-specific epitope is a polypeptide selected from: CPYSNPSLC, NSELLSLINDMPITNDQKKLMSNN, CQFDLSTRRLKC, CQYNLSSRALKC, CVWQRWQKSYVC, CVWQRWQKSYVC, SFVLNWYRMSPSNQTDKLAAFPEDR, SGTYLCGAISLAPKAQJKE, ELPTQGTFSNVSTNVSPAKPTTTA, ELPTQGTFSNVSTNVSPAKPTTTA, GQN DTSQTSSPS, preferably ELPTQGTFSNVSTNVSPAKPTTTA and/or CPYSNPSLC (SEQ ID N°19).
  • the mAb-specific epitope is a polypeptide selected from: CPYSNPSLC, NSELLSLINDMPITNDQKKLMSNN, CQFDLSTRRLKC, CQYNLSSRALKC, CVWQ
  • the invention provides a polynucleotide encoding an ANTI-CD22 CAR according to any one of the above or a polynucleotide having at least 80% identity with said a polynucleotide encoding an ANTI-CD22 CAR, a vector comprising a polynucleotide according to any one of the obove polynucleotides .
  • genes are edited in said UCART22 in particular the dCK gene, the B2M gene, CD52 gene.
  • the UCART22 as above is provided wherein and at least one additional gene is edited or engineered, said gene is selected from a gene encoding aryl hydrocarbon receptor (AHR), Transforming growth factor beta receptor) (TGF beta receptor), Interleukin 10 receptor (IL- 10 R), Program cell death protein 1, a combination thereof.
  • AHR aryl hydrocarbon receptor
  • TGF beta receptor Transforming growth factor beta receptor
  • IL- 10 R Interleukin 10 receptor
  • Program cell death protein 1 a combination thereof.
  • TGF beta receptor Transforming growth factor beta receptor
  • IL-10 R Interleukin 10 receptor
  • AHR aryl hydrocarbon receptor
  • IL-10 R Interleukin 10 receptor
  • Program cell death protein 1 a combination thereof.
  • AHR aryl hydrocarbon receptor
  • TGF beta receptor Transforming growth factor beta receptor
  • Program cell death protein 1 Program cell death protein 1, a combination thereof.
  • Table 9 List of genes encoding immune checkpoint proteins that may be inactivated according to the present invention in the CD22 CAR engineered T cells of the invention
  • CTLA4 PPP2CA, PPP2CB, PTPN6,
  • CTLA4 (CD152)
  • PDCD1 (PD-1, CD279)
  • the UCART22 as above comprising an anti-CD22 CAR (UCART22) according to any one of the above and a polynucleotide coding said anti-CD22 CAR (UCART22) inserted into the genome, into the CD25 gene.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR or a multi-chain CAR.
  • the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for any one of the following tumor-associated surface antigens selected from CD19, CD20, CD30, a major histocompatibility complex (MHC) molecule, an Immunoglobulin (Ig), CD3, CD5, CD34, CD79, preferably CD79b, CD138, B7-1 (CD80), BCMA (CD269, TNFRSF 17), FLT-3, or PAX5, preferably CD19.
  • MHC major histocompatibility complex
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD19.
  • the UCART22 according to any one of the above expressing an anti-CD22 CAR and an anti- CD19CAR, preferably of SEQ. ID N°94 or of SEQ. ID N°95.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD20.
  • MHC major histocompatibility complex
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for an Immunoglobulin (Ig).
  • Ig Immunoglobulin
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD3.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD5.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD34.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD79, preferably CD79b.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD138.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for CD80.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for BCMA (CD269).
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a single-chain CAR comprising an additional scfv specific for TNFRSF 17,
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD19.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR, comprising an additional scfv specific for CD79 a or CD79b.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain (mc) CAR comprising an additional scfv specific for CD19.
  • the UCART22 according to any one of the above expressing an anti-CD22 mcCAR and an anti-CD19CAR, preferably of SEQ ID N°94 or of SEQ ID N°95.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD20.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD30.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for a major histocompatibility complex (MHC) molecule.
  • MHC major histocompatibility complex
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for an Immunoglobulin (Ig).
  • Ig Immunoglobulin
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD3.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD5.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD34.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD138.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for CD80.
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for BCMA (CD269).
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for TNFRSF 17,
  • the UCART22 according to any one of the above wherein the anti-CD22 CAR is a multi-chain CAR comprising an additional scfv specific for FLT-3.
  • a population of cells comprising the UCART 22 according to any one of the above.
  • a population of cells comprising the UCART 22 according to any one of the above and wherein cells expressing said anti-CD22 CAR also express an anti-CD19 CAR, preferably said anti-CD19 CAR comprises a sequence of SEQ. ID N°25 or SEQ. ID N°26 at the cell surface.
  • a CD22 CAR T cell (UCART22), optionally combined to a protein kinase C inhibitor such as bryostatin 1 as a pharmaceutical composition of the invention, is particularly useful in for the treatment of CLL, ALL, Multiple myeloma, (MM), Blastic plasmacytoid dendritic cell neoplasm (BPDCN), especially refractory / relapse ALL, refractory / relapse CLL and or aggressive forms of these diseases, more preferably refractory or relapse B-ALL.
  • MM Multiple myeloma
  • BPDCN Blastic plasmacytoid dendritic cell neoplasm
  • a CD22 CAR T cell (UCART22), derived from m971, optionally combined to a protein kinase C inhibitor such as bryostatin 1 as a pharmaceutical composition of the invention, is particularly useful in for the treatment of CLL, ALL, Multiple myeloma, (MM), Blastic plasmacytoid dendritic cell neoplasm (BPDCN), especially refractory / relapse ALL, refractory / relapse CLL and or aggressive forms of these diseases, more preferably refractory or relapse B-ALL.
  • MM Multiple myeloma
  • BPDCN Blastic plasmacytoid dendritic cell neoplasm
  • the engineered immune cells of the present invention not only display high level of in vivo activity toward malignant cells, less cytokine release but also their number and activity is controlled conferring safety and efficiency for immunotherapy.
  • the present invention provides an engineered human T Cell Receptor Knock Out (TCR KO) cell endowed with a Chimeric Antigen Receptor specific for CD22 (CD22 CAR) (UCART 22), preferably expressed at the cell surface, wherein said CD22 CAR comprises:
  • an antigen binding domain specific for CD22 optionally a leader sequence
  • said UCART22 comprising at least one additional edited gene, preferably a deletion in the CD52 gene.
  • the present invention also provides the UCART CD22 as above wherein the antigen binding domain comprises a scfv specific for CD22, derived from a m917 antibody (m971), preferably said scfv comprises a sequence selected from SEQ ID N° 12, SEQ ID N° 13, SEQ. ID N° 14 and from SEQ. ID N° 15, more preferably a sequence from SEQ ID NM5.
  • the present invention also provides an engineered human T Cell Receptor Knock Out (TCR KO) cell endowed with a Chimeric Antigen Receptor specific for CD22 (CD22 CAR) (UCART 22), preferably expressed at the cell surface, wherein said CD22 CAR comprises:
  • an antigen binding domain specific for CD22 optionally a leader sequence
  • said UCART22 comprising at least one additional edited gene, preferably a deletion in the CD52 gene and wherein the antigen binding domain comprises a scfv specific for the distal part of
  • CD22 said CAR having a SEQ IDN°20.
  • the UCART CD22 according to the above comprising the following sequences :
  • the present invention also provides a UCART 22 as above comprising a polypeptide of SEQ ID N015 and a safety switch comprising : . a RQR8 temporarily linked to the CD22 CAR by a peptide 2A or
  • At least two rituximab mAb-specific epitopes preferably 3 rituximab mAb- specific epitopes and more preferably 3 rituximab mAb-specific epitopes and a QBEN-10 mAb-specific epitopes linked to the CD22 CAR. [allowing both sorting and/or depletion of the immune cells endowed with said CD22 CAR].
  • the present invention also provides a UCART 22 as above comprising at least one additional edited gene, preferably a deletion in CD52 gene, or in a dCK gene or a deletion in a beta2 microglobulin gene or in CTIIA gene, even more preferably a deletion in CD52 gene, and/or an insertion in the HIF-lalpha gene, conferring resistance to hypoxia.
  • the present invention provides a UCART 22 as above comprising a deletion in CD52 gene, in combination with alemtuzumab.
  • the present invention also provides a UCART 22 as above wherein said CD22 CAR is expressed under hypoxia (low 02 concentration that is less than 5% 02, preferably less than 1% 02).
  • the present invention also provides a UCART 22 as above comprising a polynucleotide encoding a polypeptide comprising a CD22 CAR and a safety switch.
  • the present invention provides a UCART 22 as above comprising a polynucleotide of SEO ID NO. 22 and of SEO IDN°18 in the same gene, preferably in the TRAC gene.
  • the present invention also provides a UCART 22 as above comprising a polynucleotide encoding a polypeptide comprising a CD22 CAR and a safety switch.
  • the present invention provides a UCART 22 as above comprising a polynucleotide of SEO ID NO. 20 and of SEO IDN°18 in the same gene, preferably in the TRAC gene.
  • the present invention provides a population of cells comprising a UCART 22 as above.
  • the present invention provides a pharmaceutical composition comprising either the UCART 22 as above or a population of cells comprising said UCART 22 any of the above and a pharmaceutically acceptable excipient.
  • a pharmaceutical composition comprising the UCART 22 according to the invention or a population of cells comprising said UCART 22 in combination with a UCART CD19 and a pharmaceutically acceptable excipient is provided.
  • UCART 19 and UCART 22 may be given at the same time, concomitantly or successively starting by UCART 19 or by UCART 22 as a function of CD19 and CD22 expression level a cancer cells of patients.
  • a pharmaceutical composition comprising the UCART 22/19 or UCART 19/22 (bispecific CAR single chain or multichain CAR or cells expressing both CD19CAR and CD22 CAR) and a pharmaceutically acceptable excipient, is provided.
  • the present invention provides a pharmaceutical composition as above further comprising a compound of the bryostatin family, preferably bryostatin 1.
  • the present invention provides a therapeutically effective amount of UCART 22 as above or of the pharmaceutical composition comprising said UCART 22 as above for use as a medication for treating a patient.
  • the present invention provides a therapeutically effective amount of UCART 22 as above or of the pharmaceutical composition as above for use as a medication for treating a patient wherein treating a patient comprises administering at least two times (re dosing) said therapeutically effective amount of UCART CD22 or said pharmaceutical composition for avoiding a relapsing.
  • the present invention provides a UCART CD22 according to any one of the above or the pharmaceutical composition according to any one of the above for use as a medication for treating a patient wherein treating a patient comprises administering a UCART 22 as above or a pharmaceutical composition as above at least two times for avoiding the relapsing.
  • the present invention provides a therapeutically effective amount of UCART 22 as above or of the pharmaceutical composition as above for use as a medication for treating a patient as above for the treatment of a CD22-related pathology, preferably a CD22- related B-cell malignancy (eg CD22-related hematological cancer).
  • a CD22-related pathology preferably a CD22- related B-cell malignancy (eg CD22-related hematological cancer).
  • the present invention provides:
  • a hematological cancer such as a hematological cancer selected from (lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma, leukemia, multiple myeloma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt's lymphoma, acute lymphocytic cancer, acute myeloid leukemia, preferably a CD22-expressing hematological cancer, more preferably a relapse refractory CD22-expressing hematological cancer, even more preferably an aggressive form of said CD22-related hematological cancer.
  • a hematological cancer selected from (lymphoma, Hodgkin lymphoma, non Hodgkin lymphoma, leukemia, multiple myeloma, B-chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL), and Burkitt'
  • the UCART22 is used for treating patients with relapse refractory B ALL.
  • the present invention provides a therapeutically effective amount of UCART 22 as above or of a pharmaceutical composition as above for use as a medication for treating a patient wherein said patient suffers from a cancer selected from alveolar rhabdomyosarcoma, bladder cancer (e.g., bladder carcinoma), bone cancer, brain cancer (e.g., medulloblastoma), breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, cancer of the gallbladder, cancer of the pleura, cancer of the nose, cancer of the nasal cavity, cancer of the middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, head and neck cancer (e.g., head and neck squamous cell carcinoma), hypopha
  • the present invention provides:
  • TCR KO T Cell Receptor Knock Out
  • CAR Chimeric Antigen Receptor
  • said anti-CD22 CAR comprises: i) at least one extracellular domain comprising :
  • an antigen binding domain specific for CD22 optionally a leader sequence
  • said UCART22 comprising at least one additional edited gene, preferably a CD52 inactivated gene, a dCK inactivated gene, a beta 2 microglobulin inactivated gene or an inserted HIF-lalpha gene.
  • the antigen binding domain comprises a scfv specific for CD22, said scfv is derived from a m917 antibody (m971), preferably said scfv comprises a sequence selected from SEQ ID N° 12, SEQ ID N° 13, SEQ ID N° 14 or from SEQ ID N° 15, more preferably a sequence from SEQ. ID NM5.
  • the UCART 22 according to any one of 1 to 2 comprising a polypeptide of SEQ. ID N015 and a safety switch, said safety switch comprising :
  • rituximab mAb-specific epitopes at least two rituximab mAb-specific epitopes, preferably 3 rituximab mAb-specific epitopes and more preferably 3 rituximab mAb-specific epitopes and a QBEN-10 mAb- specific epitopes linked to the CD22 CAR
  • the UCART 22 according to any one of 1 to 3 comprising a CD52 inactivated gene, even more preferably a CD52 inactivated gene and HIF-lalpha inserted gene conferring resistance alemtuzumab and to hypoxia.
  • the UCART 22 according to any one of the above comprising an anti-CD22 CAR at the cell surface, a polynucleotide encoding said anti-CD22 CAR inserted into the TRAC gene and an exogenous polynucleotide sequence encoding IL-12 inserted into the CD25 genomic sequence, the B2M genomic sequence or into the PD1 genomic sequence.
  • the UCART 22 according to any one of 1 to 6 further comprising a polynucleotide of SEQ.
  • a population of cells comprising said UCART 22 according to any one of 1 to 7.
  • composition according to 9 further comprising a bryostatin, preferably bryostatin-1.
  • the therapeutically effective amount of UCART 22 according to any one of 1 to 7 or of the pharmaceutical composition according to 9 or 10 for use as a medication for treating a patient according to 11 wherein treating a patient comprises administering at least two times (re dosing) said therapeutically effective amount of UCART CD22 or said pharmaceutical composition for avoiding a relapsing.
  • the therapeutically effective amount of UCART 22 according to any one of 1 to 7 or of the pharmaceutical composition according to 9 or 10 for use as a medication for treating a patient according to 11 or 12 for the treatment of a CD22-related pathology, preferably a CD22-related B-cell malignancy.
  • the engineered immune cell presented in figure 1 may be a T-cell endowed with a polynucleotide encoding a CAR of the invention. This T-cell is further engineered to allow a better and safer engraftment into the patient.
  • X, or Y is an edited gene that may be mutated, deleted and/or having an insertion.
  • Figure 3 Examples of CD22 CAR constructs of the invention comprising a safety switch.
  • R may be inserted into the scfv, between a VH and a VL domain (or a VL and a VH domain) and/or into the hinge.
  • Figure 4 represents one example of polypeptide which will be cleaved so that a safety switch (RQ.R8) and a CD22 CAR will be expressed at the cell surface.
  • Figure 5 Degranulating activity of UCART22 Degranulating activity of UCART22 (scfv-Vl against the proximal domain of CD22) as compared to the degranulating activity of non transduced (NT) or that of T cells transduced with a CAR targeting the distal part of CD22 (scfv-V2), in the presence of CD22-positive NALM-16 cells as compared to CD22 negative SUP-T1 cells.
  • Figure 6 Cytotoxic activity of UCART22
  • Figure 8 Mice survival in the presence of control cells, UCART22 (scfv-Vl against the proximal domain of CD22) or CART22 (no TRAC deletion).
  • the CD22 specific Chimeric Antigen Receptors of the invention comprises an extracellular domain comprising an extracellular ligand-binding domain and a hinge, optionally a suicide domain, a transmembrane domain and an intracellular domain comprising a signaling transducing domain.
  • the full length extracellular domain of CD22 is from amino acid (aa) 20-to aa 687
  • the membrane proximal domain of CD22 is from aa 243 to aa 687
  • the membrane distal domain of CD22 is from aa 20 to aa 425.
  • the extracellular ligand-binding domain may be chosen to recognize a particular form (glycosylated) CD22 that acts as a cell surface marker on target cells associated with a particular disease state.
  • said extracellular ligand-binding domain comprises at least one single chain antibody fragment (scFv) comprising the light (V L ) and the heavy (V H ) variable fragment of a target antigen specific monoclonal anti CD22 antibody joined by a linker, in particular a flexible linker.
  • Said V L and V H are preferably from the antibody m971 as in Table 2 below. They are preferably linked together by a flexible linker comprising for instance the sequence SEQ. ID NO.10.
  • V-l signal VH VL FcyRllla CD8a 41BB CD3 ⁇ CD peptide hinge TM -IC m971 SEQ SEQ SEQ SEQ ID SEQ SEQ SEQ ID
  • the CD22 CAR of the invention comprises a sequence of SEQ ID N°15.
  • said CARs preferentially comprise an extracellular ligand-binding domain comprising a polypeptide sequence displaying at least 90 %, 95 %, 96%, 97 %, 98%, 99 % or 100% identity with an amino acid sequence SEQ ID NO: 12.
  • said CARs preferentially comprise an extracellular ligand-binding domain comprising a polypeptide sequence displaying at least 90 %, 95 %, 96%, 97 %, 98%, 99 % or 100% identity with an amino acid sequence SEQ ID NO: 13.
  • said CARs preferentially comprise an extracellular ligand-binding domain comprising a polypeptide sequence displaying at least 90 %, 95 %, 96%, 97 %, 98%, 99 % or 100% identity with an amino acid sequence SEQ ID NO: 12. and a polypeptide sequence displaying at least 90 %, 91%, 92% 93% 94%, 95 %, 96%, 97 %, 98%, 99 % or 100% identity with an amino acid sequence selected from the group consisting of SEQ ID NO: 13.
  • the extracellular domain can further comprise a hinge region between said extracellular ligand-binding domain and said transmembrane domain.
  • the term "hinge region” used herein generally means any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand-binding domain. In particular, hinge region is used to provide more flexibility and accessibility for the extracellular ligand- binding domain.
  • a hinge region may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 10 to 50 amino acids. Hinge region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, or CD4, or from all or part of an antibody constant region.
  • the hinge region may be a synthetic sequence that corresponds to a naturally occurring hinge sequence, or may be an entirely synthetic hinge sequence.
  • said hinge domain comprises a part of a human CD8 alpha chain, FcRllla receptor or IgGl, respectively referred to in this specification as SEQ. ID NO. 4, SEQ ID NO. 5 and SEQ ID NO.6, or in a more preferred embodiment, a hinge polypeptide which display at least 80%, preferably at least 90 %, 95 % 97 % 99 % or 100% sequence identity with SEQ ID N°4, even more preferably 100% sequence identity with SEQ ID N°4.
  • a Hinge from lgG4 or from PD1 is part of the present invention and disclosed in WO2016120216 and may be used in the construction of a CD22 CAR according to the invention.
  • a CD22 CAR according to the present invention is anchored into the membrane of the cell.
  • such CD22 CAR further comprises a transmembrane domain.
  • the distinguishing features of appropriate transmembrane domains comprise the ability to be expressed at the surface of a cell, preferably in the present invention an immune cell, in particular lymphocyte cells or Natural killer (NK) cells, and to interact together for directing cellular response of immune cell against a predefined target cell.
  • the transmembrane domain can be derived either from a natural or from a synthetic source.
  • the transmembrane domain can be derived from any membrane-bound or transmembrane protein.
  • the transmembrane polypeptide can be a subunit of the T-cell receptor such as ⁇ , ⁇ , or ⁇ , polypeptide constituting CD3 complex, IL2 receptor p55 (a chain), p75 ( ⁇ chain) or chain, subunit chain of Fc receptors, in particular Fc receptor III or CD proteins.
  • the transmembrane domain can be synthetic and can comprise predominantly hydrophobic residues such as leucine and valine.
  • transmembrane domain is derived from the human CD8 alpha chain (e.g. NP_001139345.1).
  • a CD22CAR according to the invention generally further comprises a transmembrane domain (TM) more particularly from CD8a, showing identity with the polypeptides of SEQ. ID NO. 6 or SEQ. ID NO.7.
  • a CAR according to the invention comprises a TM showing at least 70%, preferably at least 80%, more preferably at least 90 %, 91%, 92%, 93%, 94%, 95 %, 96%, 97 %, 98%, 99 % or 100% sequence identity with the polypeptides of SEQ ID NO. 6.
  • a CD22 CAR according to the invention generally further comprises a transmembrane domain (TM) from CD8a showing identity with the polypeptides of SEQ ID NO. 6.
  • a CAR according to the invention comprises a TM showing at least 70%, preferably at least 80%, more preferably at least 90 %, 91%, 92%, 93%, 94%, 95 %, 96%, 97 %, 98%, 99 % or 100% sequence identity with the polypeptides of SEQ ID NO. 6.
  • a CD22 CAR according to the present invention comprises an intracellular domain that comprises a signal transducing domain or intracellular signaling domain.
  • the signal transducing domain or intracellular signaling domain of a CD22 CAR is responsible for intracellular signaling following the binding of extracellular ligand binding domain to the target resulting in the activation of the immune cell and immune response (cytolytic activity against the target cell).
  • the signal transducing domain is responsible for the activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed.
  • the effector function of a T cell can be a cytolytic activity or helper activity including the secretion of cytokines.
  • the term "signal transducing domain” refers to the portion of a protein which transduces the effector signal function signal and directs the cell to perform a specialized function.
  • Preferred examples of signal transducing domain in a CD22 CAR of the invention can be the cytoplasmic sequences of the T cell receptor and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivate or variant of these sequences and any synthetic sequence that has the same functional capability.
  • Signal transduction domain comprises two distinct classes of cytoplasmic signaling sequence, those that initiate antigen-dependent primary activation, and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal.
  • Primary cytoplasmic signaling sequence can comprise signaling motifs which are known as immunoreceptor tyrosine-based activation motifs of ITAMs.
  • ITAMs are well defined signaling motifs found in the intracytoplasmic tail of a variety of receptors that serve as binding sites for syk/zap70 class tyrosine kinases.
  • Examples of ITAM used in the invention can include as non-limiting examples those derived from TCRzeta, FcRgamma, FcRbeta, FcRepsilon, CD3gamma, CD3delta, CD3epsilon, CD5, CD22, CD79a, CD79b and CD66d.
  • the signaling transducing domain of the CAR can comprise the CD3zeta signaling domain which has amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90 %, 95 % 97 % 99 % or 100% sequence identity with amino acid sequence selected from the group consisting of (SEO ID NO: 9).
  • said CD3zeta signaling domain is comprising a polypeptide sequence displaying at least 90 %, 91%, 92% 93% 94%, 95 %, 96%, 97 %, 98%, 99 % or 100% identity with SEO ID NO: 9.
  • the signaling transducing domain of the CD22 CAR consists in a CD3zeta signaling domain of SEO ID NO: 9 and excludes any sequence from human CD28 signaling domain.
  • the signal transduction domain of the CAR of the present invention comprises a co-stimulatory signal molecule.
  • a co-stimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient immune response.
  • Co-stimulatory ligand refers to a molecule on an antigen presenting cell that specifically binds a cognate co- stimulatory molecule on a T-cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation activation, differentiation and the like.
  • a co-stimulatory ligand can include but is not limited to CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1CB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, 4-lBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as but not limited to, CD27, 4-lBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • LFA-1 lymphocyte function-associated antigen-1
  • a "co-stimulatory molecule” refers to the cognate binding partner on a T-cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation.
  • Co-stimulatory molecules include, but are not limited to, an MHC class I molecule, BTLA and Toll ligand receptor.
  • costimulatory molecules include CD27, CD8, 4-lBB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 and a ligand that specifically binds with CD83 and the like.
  • the signal transduction domain of the CAR of the present invention comprises a part of co-stimulatory signal molecule consisting of fragment of 4-lBB (GenBank: AAA53133.)
  • the signal transduction domain of the CAR of the present invention comprises amino acid sequence which comprises at least 70%, preferably at least 80%, more preferably at least 90 %, 95 % 97 % 99 % or 100% sequence identity with amino acid sequence selected from the group consisting of SEQ ID NO: 8.
  • the signal transduction domain of the CAR of the present invention comprises no sequence from CD28 (NP_006130.1).
  • CD22 CAR CD22 specific chimeric antigen receptor
  • binding domain specific for CD22 preferably a binding domain specific for human CD22, more preferably said binding domain specific for human CD22 is a single-chain variable fragment (scFv),
  • the CD22 CAR of the invention does not contain any sequence from CD28 and comprises a sequence leader, a TM domain and a hinge from CD8 a, preferably no sequence from CD28 and comprises a sequence leader of SEQ ID NO. 1, a TM domain of SEQ ID NO. 6 of and a hinge of SEQ ID NO. 4 from CD8 a.
  • the CD22 CAR of the invention comprises a leader sequence from human CD8 a (SEQ ID NO.l.) or a leader sequence having at least 95% identity with SEQ ID NO.l.
  • the CD22 CAR of the invention comprises a leader sequence of SEQ ID NO.2 or a leader sequence having at least 95% identity with SEQ ID NO.2.
  • -an intracellular signaling domain comprising a human CD3zeta signaling domain.
  • CD22 CAR CD22 specific chimeric antigen receptor
  • a binding domain specific for CD22 preferably a binding domain specific for human CD22, more preferably said domain specific for human CD22 is a single-chain varia ble fragment (scFv), even more preferably comprising a VH and an VL from m971,
  • -an intracellular signaling domain comprising a human CD3zeta signaling domain.
  • CD22 CAR CD22 specific chimeric antigen receptor
  • a binding domain specific for CD22 preferably a binding domain specific for human CD22, more preferably said domain specific for human CD22 is a single-chain varia ble fragment (scFv), even more preferably comprising a VH and an VL from m971.
  • scFv single-chain varia ble fragment
  • -an intracellular signaling domain comprising a human CD3zeta signaling domain.
  • CD22 CAR with a signal peptide of SEQ I D NO l or of SEQ ID NO 2, preferably of SEQ I D NO 1 More preferably, said CD22 CAR has no sequence from CD28.
  • a scfv of the invention is derived from an antibody specific for CD22, it comprises a VH domain separated to a VL domain by a linker, said VH and/or VL domains contributing to the binding to CD22.
  • the UCART 22 of the invention comprises a scfv from m971 antibody with one GS4 linker between the VH and the VL and 2R between the VL and the CD8alpha hinge.
  • a scfv is a fusion protein of the variable regions of the heavy (V H domain) of SEO I D NO.12: and light chains (V L domain) of SEO I D NO.13: of a n immunoglobulin specific for CD22, m971, connected with a linker peptide, preferably a linker of SEO ID NO10.
  • said scfv of the invention further comprises a leader sequence (or signal peptide), preferably said leader sequence is linked to the VH domain.
  • leader sequence is linked to the VL domain.
  • a VH domain is linked to a hinge, in another embodiment a VL domain is linked to said hinge.
  • the present invention provides a scfv linked to a hinge having different length preferably a hinge from CD8a, IgGl or FcRl l la (See figure 2), more preferably from CD8a.
  • the present invention provides a CD22 CAR comprising:
  • a signal peptide for example a signal peptide of SEO I D NO. 2 or from CD8alpha of SEO I D NO. 1.
  • - a hinge from human CD8 alpha chain or a Hinge from human IgGl or a hinge from FcRll la, preferably from CD8 alpha.
  • TM transmembrane domain from CD8alpha(a) - a co-stimulatory signal molecule from human 4-1BB
  • CD22 CAR of the invention consists in :
  • leader sequence for example a CD8 a leader sequence or a CD8a signal peptide
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, or a VL, a linker, and a VH, said VH and VL are derived from m971
  • One of the CD22 CAR of the invention comprises successively :
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971 two successive epitopes recognized by rituximab,
  • One of the CD22 CAR of the invention comprises successively :
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971 two successive epitopes recognized by rituximab, a CD8 a TM a co-stimulatory signal molecule from 4-1BB an intracellular CD3zeta signaling domain
  • One of the CD22 CAR of the invention comprises successively :
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971 two successive epitopes recognized by rituximab, a CD8 a hinge a CD8 a TM a co-stimulatory signal molecule from 4-1BB an intracellular CD3zeta signaling domain
  • One of the CD22 CAR of the invention comprises successively :
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971 two successive epitopes recognized by rituximab, a CD8 a TM a co-stimulatory signal molecule from 4-1BB an intracellular CD3zeta signaling domain
  • One of the CD22 CAR of the invention comprises successively :
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971, a anti-CD19 scfv two successive epitopes recognized by rituximab, • a CD8 a hinge
  • CD22 CAR of the invention comprises successively :
  • an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971, an anti-CD19 scfv two successive epitopes recognized by rituximab, ⁇ a CD8 a TM
  • One of the CD22 CAR of the invention comprises successively :
  • a CD8a signal peptide removable upon expression at the cell surface, - an anti-CD19 scfv and an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971, two successive epitopes recognized by rituximab,
  • One of the CD22 CAR of the invention comprises successively :
  • an anti-CD19 scfv and an anti-CD22 scfv comprising a VH, a linker, and a VL, said VH and VL from m971, two successive epitopes recognized by rituximab, a CD8 a TM a co-stimulatory signal molecule from 4-1BB an intracellular CD3zeta signaling domain.
  • a linker according to the invention may include sequences with added functionalities, e.g. an epitope tag (Sblattero & Bradbury, 2000 Nature Biotechnology 18, 75 - 80), at least on sequence of SEQ ID NO. 20, preferably 2, separated by a linker, sequences improving scFv properties of the present invention, often in the context of particular antibody sequences.
  • linkers suitable within the present invention is the 15-mer peptide linker (RGRGRGRGRSRGGGS) (Zhihong Shen, Heping Yan, Ying Zhang, Raymond L. Mernaugh, and Xiangqun Zeng (2008), Anal Chem. 80(6): 1910-1917).
  • a CD22 CAR comprising
  • an anti-CD22 scfv comprising a VH of SEQ ID NO. 12, a linker of SEQ ID N°10, and a VL of SEQ ID NO 13 a human CD8 a hinge of SEQ ID NO.4, a human CD8 a TM of SEQ ID NO.6 a co-stimulatory signal molecule from 4-1BB of SEQ ID NO.8 an intracellular CD3zeta signaling domain of SEQ ID NO. 9.
  • the present invention also provides: A CD22 CAR comprising
  • an anti-CD22 scfv comprising a VH of SEQ ID NO. 12, a linker of SEQ ID N°10, and a VL of SEQ ID NO 13 a human FcyRllla hinge of SEQ ID NO.3, a human CD8 a TM of SEQ ID NO.6 a co-stimulatory signal molecule from 4-1BB of SEQ ID NO.8 an intracellular CD3zeta signaling domain of SEQ ID NO. 9.
  • the present invention provides An CD22 CAR comprising
  • the present invention provides An CD22 CAR comprising
  • a human CD8a leader sequence (CD8 a leader or CD8a signal peptide) of SEQ ID NO. 1 an anti-CD22 scfv comprising a VL of SEQ ID NO 13, a linker of SEQ ID N°10, and a VH of SEQ ID NO. 12, a human CDA alpha hinge of SEQ ID NO.4, a human CD8 a TM of SEQ ID NO.6 a co-stimulatory signal molecule from 4-1BB of SEQ ID NO.8 an intracellular CD3zeta signaling domain of SEQ ID NO. 9.
  • VH domain separated to a VL domain by a linker, said VH and VL contributing to the binding to CD22; said linker having at least 90 %, 95 % 97 %, 99 % or 100% sequence identity with the polypeptide of SEQ ID NO 10.
  • VH domain having at least 90 %, 95 % 97 %, 99 % or 100% sequence identity with the polypeptide of SEQ ID NO 12.
  • co-stimulatory signal molecule derived from human 4-1BB (or 4-1BB intracellular domain) having an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90 %, 95 % 97 %, 99 % or 100% sequence identity with amino acid sequence selected from the group consisting of SEQ ID NO: 8
  • an intracellular signaling domain comprising the CD3zeta signaling domain having an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90%, 95% 97%, 99 % or 100 % sequence identity with amino acid sequence selected from the group consisting of SEQ ID NO: 9.
  • the present invention provides a CD22 CAR having a sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity with the polynucleotide of SEQ ID N°22.
  • V3-m971 (CD8a-CD8aTM-41BB.IC-CD3 IC)
  • CD22 CAR of the invention comprises the following sequence.
  • the present invention provides the following sequences: QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWI RQSPSRGLEWLGRTYYRSKWYNDYAV SVKSRITI NPDTSKNQFSLQLNSVTPEDTAVYYCAREVTGDLEDAFDIWGQGTMVTVSSGGGGSGG GGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQTIWSYLNWYQQRPGKAPNLLIYAASSLQSGV PSRFSGRGSGTDFTLTISSLQAEDFATYYCQQSYSIPQTFGQGTKLEIKTTTPAPRPPTPAPTIASQPLS LRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYI FKQPFM RPVQ TTQEEDGCSCRFPEEEEEEGGCELRVKFSRSADAPAYQQGQNQLYN ELNLGRREEYDVLDKRRGRD
  • the UCART22 of the present invention comprises a sequence of SEQ I D N° 20
  • the UCART22 of the present invention comprises a sequence of SEQ I D N° 22
  • the UCART22 of the present invention comprises a sequence of SEQ I D N° 22 inserted into a human TRAC gene (such as in human TRAC gene
  • Chromosome 14 - NC_000014.9 expresses at the cell surface an anti-CD22 CAR specific for the proximal part of CD22.
  • the UCART22 of the present invention comprises a sequence of SEQ I D N° 20 inserted into a human TRAC gene (such as in human TRAC gene Chromosome 14 - NC_000014.9) and expresses at the cell surface an anti-CD22 CAR specific for the distal part of CD22.
  • an anti-CD22 binding domain of the CD22 CAR of the invention is an a nti- CD22 binding domain specific for the distal portion of CD22.
  • HA22-CA Accordingly the present invention provides a CD22 CAR with the following sequence :
  • An anti- CD22 binding domain specific for the distal portion of CD22 may be expressed alone or with an anti- CD22 binding domain specific for the proximal portion of CD22 in the UCART22 of the invention.
  • the donor CDR may undergo few amino acid changes that may significantly affect or alter the binding characteristics of the CD22 CAR of the invention. Indeed, one of the invention provided here is a CD22 CAR which binding to CD22-expressing cell (and cytolytic activity) is maintained but the affinity is modified to reduce the intensity of the response (cytokine release).
  • Conservative amino acid substitutions mean substitutions in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • the present invention provides a CD22 CAR having conservative sequence modifications (or an amino acid sequence change) as compared to the amino acid sequence of the polypeptide of SEQ ID N°15.
  • the present invention provides a CD22 CAR having an amino acid sequence with 2 amino acid changes as compared to the amino acid sequence of the polypeptide of SEQ ID N°15.
  • the present invention provides a CD22 CAR having an amino acid sequence with 3 amino acid changes as compared to the amino acid sequence of the polypeptide of SEQ ID N°15.
  • the present invention provides a CD22 CAR having an amino acid sequence with 4 amino acid changes as compared to the amino acid sequence of the polypeptide of SEQ ID N°15
  • the present invention provides a CD22 CAR having an amino acid sequence with 5 amino acid changes as compared to the amino acid sequence of the polypeptide of SEQ ID N°15 and at least one CDR in SEQ ID N°15 is conserved.
  • the present invention provides a CD22 CAR having an amino acid sequence with from 1 to 15 amino acid changes as compared to the amino acid sequence of the polypeptide of SEQ ID N°15 and at least one CDR in SEQ ID N°15,is conserved.
  • the sequence of CD22 CAR of the invention is modified by changing 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids as compared to the wt CD22 CAR, to reduce the HAMA (human anti-mouse response), without affecting the binding capacity of said CAR to its target (CD22).
  • the present invention provides a CD22 CAR having an amino acid sequence with at least 1 amino acid change as compared to the amino acid sequence of wt (wt is m971) said at least 1 amino acid change having no impact or improving the binding and/or activity of said CD22 CAR in primary T cells.
  • Binding characteristics may be modified using adapted technique initially described in Mitchell Ho, Satoshi Nagata, and Ira Pastan. Isolation of anti-CD22 Fv with high affinity by Fv display on human cells PNAS 2006 103 (25) 9637-9642; published ahead of print June 8, 2006, doi:10.1073/pnas.0603653103 which is incorporated herein by reference.
  • Those optimized scfv also bear at least one mutations equivalent to mutations Pro-91- Thr-92 (PT) Gly-91-Ala-92 and Val-91-Phe-92.
  • the present invention provides an anti CD22 CAR comprising :
  • a ligand binding-domain optionally optimized comprising a VH domain and a VL domain from a monoclonal anti-CD22 antibody having one of the following Pro-91-Thr-92 (PT), Gly-91-Ala-92, Val-91-Phe-92, mutations or equivalent, a hinge, comprising a CD8 alpha (a) hinge
  • cytoplasmic domain comprising a CD3 zeta signaling domain and a co-stimulatory domain from 4-1BB.
  • the present invention provides an anti CD22 CAR as above wherein said monoclonal anti-CD22 antibody is from m971 antibody with hots spot in CDRs.
  • said monoclonal anti-CD22 antibody is from m971 antibody with hots spot in CDRs.
  • PT Pro-91-Thr-92
  • Gly-91-Ala-92 Gly-91-Ala-92
  • Val- 91-Phe-92 mutations.
  • the present invention provides an isolated engineered (TCR and dCK KO) immune T cell comprising an anti CD22 CAR comprising
  • An extracellular domain comprising,
  • cytoplasmic domain comprising a CD3 zeta signaling domain and a co-stimulatory domain from 4-1BB.
  • the present invention provides an isolated engineered (TCR and CD52 KO) immune T cell comprising an anti CD22 CAR comprising
  • An extracellular domain comprising,
  • cytoplasmic domain comprising a CD3 zeta signaling domain and a co-stimulatory domain from 4-1BB.
  • An extracellular domain comprising, a signal peptide, a ligand binding-domain comprising a VH domain and a VL domain from a monoclonal anti-CD22 antibody having at least one of the following Pro-91-Thr-92, Gly-91-Ala-92 mutation; Val-91-Phe-92 mutation, a hinge, comprising a CD8 alpha (a) hinge - a CD8 alpha transmembrane domain and
  • cytoplasmic domain comprising a CD3 zeta signaling domain and a co-stimulatory domain from 4-1BB.
  • the CAR 22 may be coexpressed at the cell surface with at least one, preferably two, more preferably three, monoclonal antibody (mAb)-specific epitopes, said mAb-specific epitope may be fused to a transmembrane domain of CD8.
  • said mAb -specific epitope is an epitope recognized by rituximab, and/or from Q.BEN10 and the peptide coexpressed with the cD22 CAR is RQ.R8.
  • At least one, preferably two, more preferably three, monoclonal antibody (mAb)-specific epitopes may be inserted into the linker L of the scfv (binding the VH to the VL) specific for CD22 and/or into the hinge of the CD22 CAR.
  • Molecular antibody (mAb)-specific epitope may be one of the following a mAb-specific epitope specifically recognized by an monoclonal antibody selected from ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, denosumab, golimumab,
  • the epitope-specific mAb may be used for in vitro cell sorting and/or in vivo cell depletion of immune cells expressing a CD22.
  • the extracellular binding domain of the CD22 CAR of the invention may comprises one of the following sequences : Vi-Li-V 2 -(L) x -Epitopel-(L) x -;
  • VI is VL, preferably of SEQ. ID N°12 and V2 is VH, preferably of SEQ ID N°13 or VI is VH and V2 is VL;
  • LI is a linker suitable to link the VH chain to the VL chain; preferably of SEQ. ID N°10
  • L is a linker comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrence of L in the same extracellular binding domain, and,
  • x is 0 or 1 and each occurrence of x is selected independently from the others;
  • Epitope 1 Epitope 2 and Epitope 3 are mAb-specific epitopes and can be identical or different.
  • the extracellular binding domain comprises one of the following sequences
  • Vi is V L and V 2 is V H or Vi is V H and V 2 is V L ; and VH, and VL are optimized VH and VL from m971.
  • Li is any linker suitable to link the V H chain to the V L chain;
  • L is a linker comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrences of L in the same extracellular binding domain, and,
  • Epitope 1 Epitope 2 and Epitope 3 are mAb-specific epitopes and can be identical or different.
  • Li is a linker comprising Glycine and/or Serine, preferably, Li is a linker comprising the amino acid sequence (Gly-Gly-Gly-Ser) n or (Gly-Gly-Gly-Gly-Ser) n , where n is 1, 2, 3, 4 or
  • L is a linker comprising Glycine and/or Serine, preferably L is a linker having an amino acid sequence selected from SGG, GGS, SGGS, SSGGS, GGGG, SGGGG, GGGGS, SGGGGS, GGGGGS, SGGGGGS, SGGGGG, GSGGGGS, GGGGGGGS, SGGGGGGG, SGGGGGGGS, and SGGGGSGGGGS, preferably .L is a SGGGG, GGGGS or SGGGGS.
  • Epitope 1, Epitope 2, Epitope 3 and Epitope 4 are independently selected from mAb-specific epitopes specifically recognized by ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, denosumab, golimumab,
  • Epitope 1, Epitope 2, Epitope 3 and Epitope 4 are mAb-specific epitopes specifically recognized by :
  • Cetuximab Colorectal cancer DB00002 epidermal
  • VEGF Age related endothelial macular growth degeneration factor
  • Omalizuma mainly allergy- DB00043 immunoglo b related asthma bulin E (IgE)
  • VEGF-A Vascular endothelial growth factor A
  • the mAb-specific epitope may therefore comprise one polypeptide selected from :
  • CPYSNPSLC NSELLSLINDMPITNDQKKLMSNN, CQFDLSTRRLKC, CQYNLSSRALKC, CVWQRWQKSYVC, CVWQRWQKSYVC, SFVLNWYRMSPSNQTDKLAAFPEDR, SGTYLCGAISLAPKAQIKE, ELPTQGTFSNVSTNVSPAKPTTTA, ELPTQGTFSNVSTNVSPAKPTTTA,
  • the mAb-specific epitope is a mAb-specific epitope having an amino acid sequence of ELPTQGTFSNVSTNVSPAKPTTTA and/or CPYSNPSLC (SEQ ID N019).
  • the CD22 CAR of the invention comprises 3 mAb- specific epitopes having an amino acid sequence of CPYSNPSLC (R) and one having an amino acid sequence of ELPTQGTFSNVSTNVSPAKPTTTA (Q).
  • the CD22 CAR of the invention comprises 2 mAb-specific epitopes having an amino acid sequence of CPYSNPSLC (R) located at the NT part of the hinge, just after the VL.
  • At least one sequence to which rituximab binds to (R) and/or a sequence to which QBENIO binds to (Q) may be inserted into the linker GGGGSGGGGSGGGGS and/or into the Hinge as previously described in (WO2016120216).
  • the CD22 CAR of the present invention is a single chain CAR (scCAR).
  • the single chain anti-CD22 CAR of the invention comprises a scfv from m971 and at least one other binding domain, preferably specific for the distal part of CD22, alternatively for another B cell antigen, especially if expressed by B cells malignancies such as CD34, CD10, CD79a, CD20, IgD, CD5, CD23, CD19, STAT5, CD3, CD30, BCMA.
  • the CD22 CAR of the present invention is a multichain CAR (mcCAR). Multichain CD22 CARs are part of the present invention and may be produced as described in details in WO2014039523, which is incorporated herein by reference.
  • the V H domain and the V L c iomain of an immunoglobulin or a part of an immunoglobulin specific for CD22 may be carried by two different and isolated (non covalently bound) chains of a multichain CAR.
  • the CD22 CAR of the invention comprises at least two, preferably 3 transmembrane domains (non covalently bound to each other) with at least one of the transmembrane domain comprising a scfv specific for CD22 of the invention.
  • the V H domain and the V L domain of an immunoglobulin specific for CD22, preferably from m971 may be carried by one chain of a multichain CAR.
  • the V H domain and the V L domain of an immunoglobulin specific for CD22 may be carried by one chain of a multichain CAR and the V H domain and the V L domain of another immunoglobulin specific for CD22, may be carried by another chain of the mc CAR.
  • the CD22 specific CAR according to the invention can comprise another extracellular ligand-binding domain, to simultaneously bind other elements in target thereby augmenting immune cell activation and function.
  • the extracellular ligand-binding domains can be placed in tandem on the same transmembrane polypeptide, and optionally can be separated by a linker.
  • said different extracellular ligand-binding domains can be placed on different transmembrane polypeptides composing the multichain CAR.
  • the present invention relates to a population of CARs comprising different extracellular ligand binding domains, one of each is specific for CD22.
  • the extracellular binding domain specific for CD22 and the second extracellular binding domain are on the same scCAR, In another embodiment, the extracellular binding domain specific for CD22 and the second extracellular binding domain are on the same mc CAR and belong to the same or to two different and non covalently bound transmembrane domains of said mc CAR.
  • second extracellular binding domain may be any extracellular binding domain binding specific to an antigen associated (coexpressed - even temporarily) to CD22 on pathological cells, such as CD34, CD10, CD79a, CD20, IgD, CD5, CD23, CD19, STAT5, CD3, CD30, BCMA, PAX5,CD19, CD20, CD30, glycosphingolipids, a major histocompatibility complex (MHC) molecule, an Ig, CD3, CD34, CD79, preferably CD79a, CD138, B7-1 (CD80), B7-2 (CD86), a major histocompatibility complex (MHC) molecule, BCMA (CD269, TNFRSF 17) or FLT-3, Pax5.
  • MHC major histocompatibility complex
  • the invention also provides related CD22 CAR nucleic acids, CD22 CAR recombinant expression vectors, engineered TCR KO cells, preferably T cells comprising at least another edited gene endowed with the CD22 CAR, populations of said TCR KO cells endowed with a CD22 CAR, and pharmaceutical compositions relating to the CD22 CARs, protein, expression vector, engineered TCR KO CD52 KO cells expressing said CD22CAR of the invention.
  • the invention provides the following objects : a CD22 CAR of the invention - related nucleic acids, -recombinant expression vectors, engineered TCR KO cells comprising at least another edited gene selected from a gene conferring resistance to hypoxia, a gene conferring resistance to alemtuzumab, to protease inhibitor, such as bortezomib, a gene conferring resistance to PNA (dCK) and endowed with a CD22 CAR, and related nucleic acid, populations of engineered TCR KO cells comprising at least another edited gene as below, endowed with said CD22 CAR and pharmaceutical compositions comprising said same objects as a medicament.
  • a CD22 CAR of the invention - related nucleic acids, -recombinant expression vectors, engineered TCR KO cells comprising at least another edited gene selected from a gene conferring resistance to hypoxia, a gene conferring resistance to alemtuzumab, to protease inhibitor, such as bortezomib,
  • a polynucleotide may consist in an expression cassette or expression vector (e.g. a plasmid for introduction into a bacterial host cell, or a viral vector such as a baculovirus vector for transfection of an insect host cell, or a plasmid or viral vector such as a lentivirus or an adeno associated virus for introduction into a mammalian, preferably human host cell.
  • an expression cassette or expression vector e.g. a plasmid for introduction into a bacterial host cell, or a viral vector such as a baculovirus vector for transfection of an insect host cell, or a plasmid or viral vector such as a lentivirus or an adeno associated virus for introduction into a mammalian, preferably human host cell.
  • the different nucleic acid sequences can be included in one polynucleotide or vector which comprises a nucleic acid sequence encoding ribosomal skip sequence such as a sequence encoding a 2A peptide.
  • 2A peptides which were identified in the Aphthovirus subgroup of picornaviruses, causes a ribosomal "skip" from one codon to the next without the formation of a peptide bond between the two amino acids encoded by the codons (see (Donnelly and Elliott 2001; Atkins, Wills et al. 2007; Doronina, Wu et al. 2008)).
  • the present invention provides a vector as in figure 4 coding for a RQ.R8 and an anti-CD22CAR linked by a peptide 2A.
  • cognate is meant three nucleotides on an mRNA (or on the sense strand of a DNA molecule) that are translated by a ribosome into one amino acid residue.
  • two polypeptides can be synthesized from a single, contiguous open reading frame within an mRNA when the polypeptides are separated by a 2A oligopeptide sequence that is in frame.
  • Such ribosomal skip mechanisms are well known in the art and are known to be used by several vectors for the expression of several proteins encoded by a single messenger RNA.
  • a vector allowing a CD22 CAR of the invention to be expressed in a cell is another object of the present invention.
  • said vector allows a transient expression of the CD22 CAR of the invention.
  • said vector allows a constitutive and stable expression of a CD22 CAR of the invention by insertion of the sequence coding said CD22 CAR into the genome of a cell.
  • the expression of a CD22 CAR of the invention and/or the survival of the cell expressing the CD22 CAR of the invention may be controlled using a gene under the control of an inducible promoter as described in (R. Kuhn, F. Schwenk, M. Aguet, K. Rajewsky. Inducible gene targeting in mice. Science 8 September 1995: Vol. 269 no. 5229 pp. 1427-1429 DOI :10.1126/science.7660125, and cited references.
  • a CD22 CAR wherein the extracellular domain comprises at least two CD20 mimotopes of SEQ ID NO 19 (CPYSNPSLC) located between m971 scfv domains and the hinge from human CD8alpha.
  • CPYSNPSLC CD20 mimotopes of SEQ ID NO 19
  • the present invention provides a vector comprising a sequence coding a CD22 CAR selected from SEQ. ID NO. 22.
  • a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is provided in polynucleotide sequence or vector sequence.
  • the secretory signal sequence is operably linked to the transmembrane nucleic acid sequence, i.e., the two sequences are joined in the correct reading frame and positioned to direct the newly synthesized polypeptide into the secretory pathway of the host cell.
  • Secretory signal sequences are commonly positioned 5' to the nucleic acid sequence encoding the polypeptide of interest, although certain secretory signal sequences may be positioned elsewhere in the nucleic acid sequence of interest (see, e.g., Welch et al., U.S. Patent No. 5,037,743; Holland et al., U.S. Patent No. 5,143,830).
  • the signal peptide comprises the amino acid sequence SEQ ID NO: 1 and 2.
  • the signal peptide of the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 1 from human CD8 alpha.
  • the nucleic acid sequences of the present invention are codon- optimized for expression in mammalian cells, preferably for expression in human cells. Codon-optimization refers to the exchange in a sequence of interest of codons that are generally rare in highly expressed genes of a given species by codons that are generally frequent in highly expressed genes of such species, such codons encoding the amino acids as the codons that are being exchanged.
  • the present invention encompasses a method of preparing immune cells for immunotherapy comprising introducing ex-vivo into said immune cells a polynucleotide or a vector encoding one of the CD22 CAR of the invention, preferably of SEQ. ID NO. 15 as previously described.
  • said polynucleotides are included into a vector in view of being stably expressed in the immune cells.
  • said method further comprises the step of genetically modifying said cell to make it more suitable for adoptive transfer, and/or for use with a drug affecting said immune cell survival, in particular for transplant (also called allograft, or homograft) alone or in combination with the drug for which the immune cell is made resistant to.
  • a drug affecting said immune cell survival in particular for transplant (also called allograft, or homograft) alone or in combination with the drug for which the immune cell is made resistant to.
  • engineered cells may be initially isolated from a donor and used for a reinjection into the same donor in combination with a drug to which it is made resistant to.
  • the method of the present invention is based on cellular homology-directed repair (HDR) mechanisms to "knock in” a CD22 CAR in the TRAC gene (encoding the TCR alpha subunit of the TCR) resulting in a more efficient product.
  • HDR with an exogenous DNA sequence has been described previously in T cells using short oligonucleotides paired with CRISPR/Cas9.
  • Others have shown that adeno- associated virus (AAV) vectors ca n be used as a template in conjunction with a site- specific nuclease Crispr/Cas9 or MegaTAL to achieve gene insertion via HDR.
  • AAV adeno-associated virus
  • AAV6 vector may be used after genetic editing using specific TALEN of a gene such as the TRAC gene (gene encoding the alpha subunit or the TCR) or any gene disclosed in PCT/EP2017/076798.
  • the present invention also provides an engineered immune cells comprising a sequence coding a CAR, preferably a CD22 CAR as described above located in a precise region of the TRAC gene determined by the TALEN used.
  • the sequence in the TRAC gene of said engineered immune cell is unique due to the TALEN specificity.
  • an engineered immune cell comprising the following sequence;
  • Y is A or T or G or C and flanking or comprising a sequence of the TRAC gene targeted by a TALEN comprising at least ttgtcccacagATATC, preferably ttgtcccacagATATCCAG and (XXX)n is A or T or G or C and part of an exogenous sequence to be inserted into the TRAC gene, preferably a sequence encoding a CAR, more preferably a sequence encoding a CD22 CAR.
  • the TRAC gene is deleted and the inserted gene is expressed under the control of the TRAC promotor.
  • Additional or alternative sequences such as IRES internal ribosome entry site; maybe interposed between the TALEN target and XXX.
  • the TALEN target is SEQ ID N° 21 and the CAR CD22 is SEQ ID N° 22.
  • sequence cleaved by said TALEN is AGAACCCTGACCCTG.
  • the sequence AGAACCCTGACCCTG may be conserved at least in part (see figure 9) in an engineered cell of the invention depending on the insert sequence.
  • the present invention provides an engineered immune cell comprising a TRAC gene comprising a SEQ. ID N° 22.
  • the present invention provides an engineered immune cell comprising a sequence encoding a CAR specific for CD19 or a sequence encoding a CAR specific for CD22 inserted into the TRAC gene, preferably anywhere at the locus : AGAACCCTGACCCTG.
  • the engineered immune cell of the invention comprises two different sequences encoding a CAR and express said two different CARs. At the cell surface, undetectable level of TCR.
  • the engineered immune cell of the invention comprises two different sequences encoding a CAR and express said two different CARs.
  • undetectable level of TCR and of MHC Class I At the cell surface, undetectable level of TCR and of MHC Class I.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ. ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD19 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD34 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD79a is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD79b is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD10 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for IgD is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD5 is inserted
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD23 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD30 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for BCMA is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for FLT3 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD138 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ. ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD80 is inserted.
  • the engineered immune cell of the invention comprises into its genomic TRAC gene a sequence coding CD22, preferably of SEQ ID N°22, and another genomic sequence in which another exogenous gene coding for a CAR specific for CD86 is inserted.
  • Another genomic sequence in which another exogenous gene coding for a second CAR is inserted may be any one of the genes disclosed in PCT/EP2017/076798 or in
  • the other exogenous gene encoding a CAR may be inserted into the TRAC gene in frame with a self cleaving peptide and with the CD22 CAR sequence, preferably SEQ ID N° or into another geneencoding a protein as those disclosed in PCT/EP2017/076798, or chosen among PD1 (Uniprot Q151 16), CTLA4 (Uniprot P16410), PPP2CA (Uniprot P67775), PPP2CB (Uniprot P62714), PTPN6 (Uniprot P29350), PTPN22 (Uniprot Q9Y2R2), LAG3 (Uniprot P18627), HAVCR2 (Uniprot Q8TDQ0), BTLA (Uniprot Q7Z6A9), CD160 (Uniprot 095971 ), TIG IT (Uniprot Q495A1 ), CD96 (Uniprot P40200), CRTAM (Uniprot
  • LAIR1 Uniprot Q6GTX8
  • SIGLEC7 Uniprot Q9Y286
  • SIGLEC9 Uniprot Q9Y336
  • CD244 Uniprot Q9BZW8
  • TNFRSF10B Uniprot 014763
  • TNFRSF10A Uniprot 000220
  • CASP8 Uniprot Q14790
  • CASP10 Uniprot Q92851
  • CASP3 Uniprot P42574
  • CASP6 Uniprot P55212
  • CASP7 Uniprot P55210
  • FADD Uniprot Q13158
  • FAS Uniprot P25445)
  • TGFBRII Uniprot P37173
  • TGFRBRI Uniprot
  • SMAD2 Uniprot Q15796
  • SMAD3 Uniprot P84022
  • SMAD4 Uniprot Q13485
  • SMAD10 Uniprot B7ZSB5
  • SKI Uniprot P12755
  • SKIL Uniprot P12757
  • TGIF1 Uniprot Q15583
  • M ORA Uniprot Q13651
  • IL10RB Uniprot Q08334
  • HMOX2 Uniprot P30519
  • IL6R Uniprot P08887
  • IL6ST Uniprot P40189
  • EIF2AK4 Uniprot Q9P2K8
  • CSK Uniprot P41240
  • PAG1 Uniprot Q9NWQ8
  • SIT1 Uniprot Q9Y3P8
  • FOXP3 (Uniprot Q9BZS1 ), PRDM1 (Uniprot Q60636), BATF (Uniprot Q16520), GUCY1A2 (Uniprot P33402), GUCY1A3 (Uniprot Q02108), GUCY1 B2 (Uniprot Q8BXH3) and GUCY1 B3 (Uniprot Q02153).
  • Preferred edited (KO) genes in UCART 22 are TNFRSF10B (Uniprot 014763), TNFRSF10A (Uniprot 000220), IL10RA (Uniprot Q13651 ), IL10RB (Uniprot Q08334, TGFBRII (Uniprot P37173), TGFRBRI (Uniprot Q15582), PD1 (Uniprot Q151 16), CTLA4 (Uniprot P16410), LAG 3 (Uniprot P18627), HAVCR2 (Uniprot Q8TDQ0), TIGIT (Uniprot Q495A1 ).
  • the gene in which the second CAR is inserted is a genomic gene active during T cell activation selected from any one of those described in table A:
  • Table AA Zfp640 zinc finger protein 640
  • the other gene in which the second CAR may be inserted may be a gene encoding any one of the protein in Table B selected from ...
  • interleukin 1 receptor type I
  • tumor necrosis factor (ligand) superfamily member 4 neuronal calcium sensor 1
  • microtubule-associated protein IB IB
  • mitogen-activated protein kinase kinase 3 opposite strand PERP, TP53 apoptosis effector
  • nuclear receptor subfamily 4 group A, member 2
  • lymphotoxin A Acute lymphotoxin A
  • Mirl7 host gene 1 (non-protein coding)
  • solute carrier family 5 sodium-dependent vitamin transporter
  • member 6 sodium-dependent vitamin transporter
  • solute carrier family 19 thiamine transporter
  • member 2 ubiquitin domain containing 2
  • nuclear receptor subfamily 4 group A, member 3
  • interleukin 15 receptor alpha chain
  • solute carrier family 4 sodium bicarbonate cotransporter, member
  • tumor necrosis factor receptor superfamily member 4
  • tumor necrosis factor (ligand) superfamily member 11
  • SAM domain SAM domain
  • SH3 domain nuclear localization signals
  • 1 solute carrier family 5 inositol transporters
  • member 3 SAM domain, SH3 domain and nuclear localization signals, 1 solute carrier family 5 (inositol transporters), member 3
  • ESF1 nucleolar pre-rRNA processing protein
  • homolog S, cerevisiae
  • furin paired basic amino acid cleaving enzyme
  • M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein) GRAM domain containing IB
  • nuclear receptor subfamily 4 group A, member 1
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  • arsA arsenite transporter ATP-binding, homolog 1 (bacterial) polymerase (RNA) I polypeptide C
  • beta nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, beta
  • proviral integration site 1 1
  • NOP14 nucleolar protein ribosomal protein L7-like 1
  • hypoxia inducible factor 1 alpha subunit
  • proteaseome proteaseome activator subunit 3 (PA28)
  • UCART22 may be prepared using , AAV vector, preferably AAV6 vector and even more preferably AAV6 /2 vector for inserting the CD22 CAR or another gene as disclosed herein.
  • AAV vector(s) may be used after genetic editing of a gene such as the TRAC gene (gene encoding the alpha subunit or the TCR) or any gene disclosed in
  • Adoptive cell transfer is the transfer of cells into a patient.
  • the cells may have originated from the patient him- or herself and then been altered before being transferred back (syngenic transfer) or, they may have come from another individual.
  • the cells are most commonly derived from the immune system, with the goal of transferring improved immune functionality and characteristics along with the cells back to the patient.
  • Transferring autologous cells, or cells from the patient minimizes graft- versus-host disease (GVHD) or tissue or organ rejection.
  • GVHD graft- versus-host disease
  • CD22 CART cells minimizes GVHD.
  • Transferring TCR-deficient MHCI deficient CD22CART minimizes GVHD and HVGD.
  • the step of genetically modifying (engineering) said immune cell takes place before the step of introducing the polynucleotides or vectors encoding one of the CD22 CAR of the invention into said cells.
  • the immune cell can be made less allogeneic, for instance, by inactivating at least one gene expressing one or more component of T-cell receptor (TCR) as described in WO 2013/176915, which can be combined with the inactivation of a gene encoding or regulating HLA expression such as ⁇ 2 ⁇ gene as described in WO2008102199 or in
  • the immune cells of the invention can be further genetically engineered to improve the resistance of engineered immune cells to an immunosuppressive drug or a chemotherapy treatment, which are used as standard care for treating CD22 positive malignant cells as disclosed in WO201575195 which is incorporated herein by reference.
  • the genes which can be inactivated to confer drug resistance to the T-cell is a glucocorticoid receptor (GR) and CD52. Genes are inactivated to make the cells resistant to these treatments and give them a competitive advantage over patient's own T-cells not endowed with specific CD22 CARs.
  • GR glucocorticoid receptor
  • the inactivation of the CD52 and TRAC gene in the engineered immune cell according to the invention is performed using a TALE nuclease or a CRISPR CAS9 system.
  • the gene which can be inactivated to confer drug resistance to the T-cell is the CD52 in TCR KO immune T cells endowed with a CD22 CAR.
  • the gene which can be inactivated to confer drug resistance to the T-cell is a glucocorticoid receptor (GR).
  • GR glucocorticoid receptor
  • Expression of CD3 gene can also be suppressed or reduced to confer resistance to Teplizumab, which is another immune suppressive drug.
  • Expression of HPRT can also be suppressed or reduced according to the invention to confer resistance to 6- thioguanine, a cytostatic agent commonly used in chemotherapy especially for the treatment of acute lymphoblasic leukemia.
  • dCK deoxycytidine kinase
  • the gene which can be inactivated to confer drug resistance to the T-cell is the human deoxycytidine kinase (dCK) gene.
  • dCK human deoxycytidine kinase
  • This enzyme is required for the phosphorylation of the deoxyribonucleosides deoxycytidine (dC), deoxyguanosine (dG) and deoxyadenosine (dA).
  • Purine nucleotide analogs (PNAs) are metabolized by dCK into mono-, di- and tri-phosphate PNA.
  • RNR ribonucleotide reductase
  • the inactivation of the dCK gene in the engineered immune cell according to the invention is mediated by a TALE nuclease or a CRISPR CAS9 system.
  • TALE nuclease or a CRISPR CAS9 system.
  • CRISPR CAS9 CRISPR CAS9
  • This dCK inactivation in engineered immune cells of the invention confers resistance to purine nucleoside analogs (PNAs) such as clofarabine and fludarabine.
  • PNAs purine nucleoside analogs
  • the dCK inactivation in engineered immune cells of the invention is combined with an inactivation of TRAC genes rendering these double knock out (KO) (TCR or TRAC KO and dCK KO) cells both resistant to drug such as clofarabine and less allogeneic.
  • KO double knock out
  • the CD52 inactivation in engineered immune cells of the invention is combined with an inactivation of TRAC gene rendering these double knock out (KO) (TCR or TRAC KO and CD52 KO) cells both resistant to drug such as CAMPATH (alemtuzumab) and less allogeneic.
  • KO double knock out
  • This double feature is particularly useful for a therapeutic goal, allowing "off-the- shelf” allogeneic cells (UCART22) for immunotherapy in conjunction with chemotherapy to treat patients with cancer in need thereof.
  • This double KO inactivation dCK/TRAC or CD52/TRAC can be performed simultaneously or sequentially.
  • TALE- nuclease dCK/TRAC pairs which gave success in the invention is described in PCT/EP2014/075317, in particular, the target sequences in the 2 loci (dCK and TRAC). Document PCT/EP2014/075317 is incorporated herein in its entirety.
  • the present invention provides a primary T cells expressing a CD22 CAR of SEO ID NO.15, wherein, wherein the CD52 and TRAC genes are inactivated by deletion for their use in the treatment of CLL, ALL, preferably their aggressive, relapsing refractory forms, optionally in lymphodepleted patients, more preferably relapsing refractory forms of B- ALL.
  • the immune cells can be further manipulated to make them more active or limit exhaustion, by inactivating genes encoding proteins that act as "immune checkpoints" that act as regulators of T-cells activation, such as PDCD1 or CTLA-4. Examples of genes, which expression could be reduced or suppressed are indicated in Table 9.
  • the present invention also provides a primary T cells expressing a CD22 CAR of SEO ID NO.15, wherein the CD52, TRAC and dCK genes were deleted.
  • the present invention also provides a primary T cells expressing a CD22 CAR that were made resistant to hypoxia.
  • the present invention also provides a primary T cells expressing a CD22 CAR of SEO ID NO.15, wherein the CD52, TRAC and dCK genes were deleted and sequences of HIF-la were inserted to make cells resistant to hypoxia.
  • the expression and cytolytic activity of CD22 CAR T cell of the invention is maintained, or the expression of CD22 CAR T cell induced and the activity maintained under low oxygen condition (hypoxia), (as compared to normal oxygen condition 20% 02 vs 1 to 5 % 02) and said cell still target and destroy tumor cells when embedded into tissues.
  • low oxygen condition hyperoxia
  • hypoxia- inducible CAR in T cell examples include WO2013123061 or in Juillerat, A. et al. An oxygen sensitive self-decision making engineered CAR T-celISc/ ' . Rep. 7, 39833; doi: 10.1038/srep39833 (2017), both incorporated by reference): A synthetic promoter specific for the OxiTF driving the expression of the CD22 CAR was constructed.
  • the OxiTF is design to activate a synthetic genetic element encoding a CD22 CAR.
  • engineered T cells can "detect" a decrease in oxygen level (as compared to the mean level of 02 in the blood) and trigger the expression of the CD22 CAR.
  • CD22 CAR Cell surface exposure of CD22 CAR enables the recognition of tumor antigen under hypoxia that eventually triggers T cells activation and proliferation via the activation and co-stimulatory domains present within said CD22 CAR. Ultimately, tumor antigen expressing cells are lysed by the UCART22 of the invention.
  • immune cells may be also engineered to remain efficient under low 02 condition (low oxygen concentration means 1-5%) by overexpressing at least one, preferably all of the following factors : Oct3, Oct4, Sox2, Klf4 and c-Myc , or by editing a HIF-la factor.
  • an oxygen sensitive CD22 single chain CAR -expressing engineered cell and a hypoxia resistant CD22 CAR -expressing engineered cell were constructed and tested successfully.
  • CD22 is mainly expressed on CD22-expressing B cell malignancies, which are "liquid” tumors" and therefore are not supposed to create hypoxia in contrast to solid tumor, it was not expected that a CD22 CAR engineered immune cells resistant to hypoxia would be more efficient than CD22 CAR engineered immune cells which are not resistant to hypoxia against B-ALL from patient.
  • the UCART22 of the invention reaching the nested cancer cells clustered or homing in tissues may be able to lyse these cells.
  • genes may be edited in the UCART22 of the present invention such as those above table 5:
  • Table 5 List of genes encoding immune checkpoint proteins that may be inactivated according to the present invention in the CD22 CAR engineered T cells of the invention
  • CTLA4 PPP2CA, PPP2CB,
  • CTLA4 (CD152)
  • TNFRSF10B TNFRSF10A
  • TNFRSF10A TNFRSF10A
  • the present invention provides an isolated engineered immune T cells expressing a CD22 CAR of SEQ ID NO.15, wherein, the dCK and/or CD52 and TRAC genes are edited, that is, inactivated by deletion, for their use in the treatment of CLL, ALL, preferably their aggressive, relapsing refractory forms, in lymphodepleted patients.
  • the present invention provides an isolated engineered immune T cells expressing a CD22 CAR of SEQ ID NO.15, wherein, the b2m and TRAC genes are edited, that is, inactivated by deletion, for their use in the treatment of CLL, ALL, preferably their aggressive, relapsing refractory forms, in lymphodepleted patients.
  • the present invention provides an isolated engineered immune T cells expressing a CD22 CAR of SEQ ID NO.15, wherein TRAC and IL-10R genes are edited, that is, inactivated by deletion, for their use in the treatment of CLL, ALL, preferably their aggressive, relapsing refractory forms, in lymphodepleted patients.
  • the present invention provides an engineered immune T cells expressing a CD22 CAR (UCART22) comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition a TGFbeta receptor KO gene.
  • the present invention provides an engineered immune T cells expressing a CD22 CAR (UCART22) comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition an IL-10 receptor KO gene.
  • the present invention provides an engineered immune T cells expressing a CD22 CAR (UCART22) comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition an AHR KO gene.
  • UCART22 a CD22 CAR
  • a deficient TCR alpha gene so that the cell surface expression of the TCR is compromised
  • B2M deficient gene so that the expression of MHC class I molecules at the cell surface is compromised
  • AHR KO gene an engineered immune T cells expressing a CD22 CAR (UCART22) comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition an AHR KO gene.
  • the present invention provides an engineered immune T cells expressing a CD22 CAR (UCART22) comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition a PD1 KO gene.
  • UCART22 a deficient TCR alpha gene
  • B2M deficient gene so that the expression of MHC class I molecules at the cell surface is compromised
  • PD1 KO gene a PD1 KO gene.
  • the present invention provides an engineered immune T cells expressing a CD22 CAR
  • UCART22 comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition a LAG-3 KO gene.
  • the present invention provides an engineered immune T cells expressing a CD22 CAR (UCART22) comprising a deficient TCR alpha gene (so that the cell surface expression of the TCR is compromised), a B2M deficient gene (so that the expression of MHC class I molecules at the cell surface is compromised), and in addition a TIM-3 KO gene.
  • the present invention provides an isolated engineered immune T cells expressing a CD22 CAR of SEQ. ID NO.15 wherein, wherein the CD52, and TRAC genes are inactivated by deletion for their use in the treatment of relapsing refractory forms of BALL, in lymphodepleted patients.
  • a method of engineering the immune cells involves introducing into said T cells polynucleotides, in particular mRNAs, encoding specific rare- cutting endonuclease to selectively inactivate the genes, as those mentioned above, by DNA cleavage.
  • said rare-cutting endonucleases are TALE- nucleases or Cas9 endonuclease.
  • TAL-nucleases have so far proven higher specificity and cleavage efficiency over the other types of rare-cutting endonucleases, making them the endonucleases of choice and preferred for producing of the engineered immune cells on a large scale with a constant turn-over.
  • CD22 CAR of the invention can be introduced as a transgene encoded by one plasmid vector of the invention.
  • Said plasmid vector encoding a CD22 CAR of the invention can also contain a selection marker which provides for identification and/or selection of cells which received said vector.
  • CD22 CAR A method allowing a CD22 CAR according to the invention to be introduced and then expressed into an isolated immune cell was described elsewhere, for example in WO2013126720 or in WO2015121454 which are incorporated herein by reference in entirety.
  • Polypeptides corresponding to the CD22 CAR of the invention may be synthesized in situ in the cell as a result of the introduction of polynucleotides encoding said polypeptides into the cell. Alternatively, said polypeptides could be produced outside the cell and then introduced thereto.
  • Methods for introducing a polynucleotide construct into cells are known in the art and including as non-limiting examples stable transformation methods wherein the polynucleotide construct is integrated into the genome of the cell, transient transformation methods wherein the polynucleotide construct is not integrated into the genome of the cell and virus mediated methods.
  • Said polynucleotides may be introduced into a cell by for example, recombinant viral vectors (e.g. retroviruses, such as lentiviruses, adenoviruses, adeno associated virus), liposome and the like.
  • transient transformation methods include for example microinjection, electroporation or particle bombardment.
  • Said polynucleotides may be included in vectors, more particularly plasmids or virus, in view of being expressed in cells.
  • said polynucleotide encoding a CD22 CAR is inserted into an AAV6 vector and introduced into a given gene.
  • Methods for preparing a vector allowing the CD22 CAR of the invention to be introduced and then expressed into an isolated T cell were described elsewhere, for example in WO2013126720 which is incorporated herein by reference.
  • An engineered immune cell endowed with a CD22 CAR (UCART 22) is another object of the present invention.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Mycology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/EP2018/058367 2017-03-31 2018-03-30 Universal anti-cd22 chimeric antigen receptor engineered immune cells Ceased WO2018178377A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
JP2020503358A JP7314115B2 (ja) 2017-03-31 2018-03-30 ユニバーサル抗cd22キメラ抗原受容体操作免疫細胞
RU2019133365A RU2775453C2 (ru) 2017-03-31 2018-03-30 Сконструированные универсальные иммунные клетки с анти-cd22 химерным антигенным рецептором
MX2019011475A MX2019011475A (es) 2017-03-31 2018-03-30 Celulas inmunes universales manipuladas para ser dotadas con receptor de antigeno quimerico anti-cd22.
AU2018246377A AU2018246377B2 (en) 2017-03-31 2018-03-30 Universal anti-CD22 chimeric antigen receptor engineered immune cells
KR1020197032371A KR102726269B1 (ko) 2017-03-31 2018-03-30 범용 항-cd22 키메라 항원 수용체 조작된 면역 세포
ES18715024T ES2979232T3 (es) 2017-03-31 2018-03-30 Células inmunitarias con receptor de antígeno quimérico anti-CD22 universal
CA3058268A CA3058268A1 (en) 2017-03-31 2018-03-30 Universal anti-cd22 chimeric antigen receptor engineered immune cells
EP24166930.8A EP4414380A3 (en) 2017-03-31 2018-03-30 Universal anti-cd22 chimeric antigen receptor engineered immune cells
DK18715024.8T DK3592379T3 (da) 2017-03-31 2018-03-30 Universelle anti-cd22-kimære antigenreceptor-modificerede immunceller
BR112019020203-0A BR112019020203A2 (pt) 2017-03-31 2018-03-30 Células imunes universais modificadas do receptor de anticorpos quiméricos anti-cd22
US16/498,899 US11944643B2 (en) 2017-03-31 2018-03-30 Universal anti-CD22 chimeric antigen receptor engineered immune cells
CN201880036267.2A CN110869046B (zh) 2017-03-31 2018-03-30 通用型抗cd22嵌合抗原受体工程化的免疫细胞
EP18715024.8A EP3592379B1 (en) 2017-03-31 2018-03-30 Universal anti-cd22 chimeric antigen receptor engineered immune cells
IL269538A IL269538B2 (en) 2017-03-31 2019-09-23 Universal anti–cd22 chimeric antigen receptor transgenic immune cells
JP2023114120A JP7634045B2 (ja) 2017-03-31 2023-07-12 ユニバーサル抗cd22キメラ抗原受容体操作免疫細胞
US18/393,322 US12133867B2 (en) 2017-03-31 2023-12-21 Universal anti-CD22 chimeric antigen receptor engineered immune cells
US18/898,069 US20250026808A1 (en) 2017-03-31 2024-09-26 Universal anti-cd22 chimeric antigen receptor engineered immune cells

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
DKPA201770239 2017-03-31
DKPA201770239 2017-03-31
DKPA201770240 2017-03-31
DKPA201770240 2017-03-31
DKPA201770542 2017-06-30
DKPA201770542 2017-06-30
EPPCT/EP2017/076800 2017-10-19
PCT/EP2017/076800 WO2018073393A2 (en) 2016-10-19 2017-10-19 Tal-effector nuclease (talen) -modified allogenic cells suitable for therapy

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/498,899 A-371-Of-International US11944643B2 (en) 2017-03-31 2018-03-30 Universal anti-CD22 chimeric antigen receptor engineered immune cells
US18/393,322 Continuation US12133867B2 (en) 2017-03-31 2023-12-21 Universal anti-CD22 chimeric antigen receptor engineered immune cells

Publications (1)

Publication Number Publication Date
WO2018178377A1 true WO2018178377A1 (en) 2018-10-04

Family

ID=63674321

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/EP2018/058367 Ceased WO2018178377A1 (en) 2017-03-31 2018-03-30 Universal anti-cd22 chimeric antigen receptor engineered immune cells
PCT/EP2018/058368 Ceased WO2018178378A1 (en) 2017-03-31 2018-03-30 New universal chimeric antigen receptor t cells specific for cd22

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/EP2018/058368 Ceased WO2018178378A1 (en) 2017-03-31 2018-03-30 New universal chimeric antigen receptor t cells specific for cd22

Country Status (14)

Country Link
US (4) US11944643B2 (https=)
EP (3) EP4414380A3 (https=)
JP (2) JP7314115B2 (https=)
KR (1) KR102726269B1 (https=)
CN (1) CN110869046B (https=)
AU (2) AU2018246377B2 (https=)
BR (1) BR112019020203A2 (https=)
CA (1) CA3058268A1 (https=)
DK (1) DK3592379T3 (https=)
ES (1) ES2979232T3 (https=)
IL (1) IL269538B2 (https=)
MX (1) MX2019011475A (https=)
PT (1) PT3592379T (https=)
WO (2) WO2018178377A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111944850A (zh) * 2020-08-28 2020-11-17 澳门大学 表达抗cd22嵌合抗原受体和pd-l1阻断蛋白的细胞的制备方法、表达载体及应用
EP3774919A4 (en) * 2018-03-30 2021-12-29 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
JP2022532996A (ja) * 2019-04-26 2022-07-21 アロジーン セラピューティクス,インコーポレイテッド リツキシマブ耐性キメラ抗原受容体およびその用途
US20230279350A1 (en) * 2020-07-31 2023-09-07 Cellectis S.A. Dual car-t cells
EP4151653A4 (en) * 2020-04-16 2024-05-08 Shanghai Cellular Biopharmaceutical Group Ltd. Cd22-targeted chimeric antigen receptor, preparation method therefor and application thereof
US12133867B2 (en) 2017-03-31 2024-11-05 Cellectis Sa Universal anti-CD22 chimeric antigen receptor engineered immune cells
RU2839662C1 (ru) * 2020-07-31 2025-05-07 Селлектис С.А. Т-клетки с двумя химерными антигенными рецепторами car

Families Citing this family (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190161530A1 (en) * 2016-04-07 2019-05-30 Bluebird Bio, Inc. Chimeric antigen receptor t cell compositions
CA3038532A1 (en) 2016-10-05 2018-04-12 The Board Of Trustees Of The Leland Stanford Junior University Bryostatin compounds and methods of preparing the same
JP2020537515A (ja) 2017-10-03 2020-12-24 ジュノー セラピューティクス インコーポレイテッド Hpv特異的結合分子
CA3094468A1 (en) * 2018-04-05 2019-10-10 Juno Therapeutics, Inc. Methods of producing cells expressing a recombinant receptor and related compositions
CN113454117B (zh) 2018-12-19 2025-07-04 宾夕法尼亚大学董事会 Cd2/5/7敲除抗-cd2/5/7嵌合抗原受体t细胞针对t细胞淋巴瘤和白血病的用途
EP3972585A4 (en) * 2019-05-21 2023-06-21 The Board Of Trustees Of The Leland Stanford Junior University Bryostatin compounds for enhancement of immunotherapy
EP4127188A4 (en) * 2020-03-31 2024-08-21 Walking Fish Therapeutics MODIFIED B CELLS AND METHODS OF USE THEREOF
GB202007842D0 (en) * 2020-05-26 2020-07-08 Quell Therapeutics Ltd Polypeptide useful in adoptive cell therapy
KR20230118887A (ko) 2020-12-03 2023-08-14 센츄리 쎄라퓨틱스 인코포레이티드 유전자 조작 세포 및 이의 용도
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
AR124414A1 (es) 2020-12-18 2023-03-22 Century Therapeutics Inc Sistema de receptor de antígeno quimérico con especificidad de receptor adaptable
WO2022177961A1 (en) * 2021-02-16 2022-08-25 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Hla class i–restricted t cell receptors against cd22
KR102829757B1 (ko) * 2021-11-17 2025-07-09 (주)이노베이션바이오 인간화된 cd22에 특이적인 항체 및 이를 이용한 키메라 항원 수용체
EP4452319A1 (en) * 2021-12-22 2024-10-30 Flagship Pioneering Innovations VI, LLC Compositions and methods for delivery of therapeutic agents to acceptor cells
CN118359729A (zh) * 2023-01-19 2024-07-19 武汉昭智生物技术有限公司 一种car分子、包含其的细胞或外泌体及它们的应用
WO2025049961A1 (en) * 2023-09-01 2025-03-06 Cargo Therapeutics, Inc. Anti-cd22 chimeric antigen receptor (car) therapies
WO2025212803A2 (en) * 2024-04-03 2025-10-09 Umoja Biopharma, Inc. Lentiviral delivery of anti-cd22 chimeric antigen receptors
CN119775433B (zh) * 2024-12-09 2025-11-28 吉林大学第一医院 一种细胞膜表达的il-15融合蛋白及其在细胞治疗中的应用

Citations (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5143830A (en) 1986-05-15 1992-09-01 Holland Ian B Process for the production of a polypeptide
WO1997034598A1 (en) 1996-03-20 1997-09-25 The United States Of America, Represented By The Secretary, Department Of Health And Human Services Method of treating cancer using c-26 modified bryostatin
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO2001040214A1 (en) 1999-11-30 2001-06-07 The Board Of Trustees Of The Leland Stanford Junior University Bryostatin analogues, synthetic methods and uses
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
WO2008102199A1 (en) 2007-02-20 2008-08-28 Cellectis Meganuclease variants cleaving a dna target sequence from the beta-2-microglobulin gene and uses thereof
WO2012138927A2 (en) 2011-04-05 2012-10-11 Philippe Duchateau Method for the generation of compact tale-nucleases and uses thereof
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126720A2 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for the assessment of target cancer cell resistance to car engineered t cell killing
WO2013176915A1 (en) 2012-05-25 2013-11-28 Roman Galetto Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
WO2014065961A1 (en) 2012-10-24 2014-05-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services M971 chimeric antigen receptors
EP2737904A2 (en) 2007-02-09 2014-06-04 Blanchette Rockefeller Neurosciences Institute Therapeutic effects of bryostatins, bryologs, and other related substances on ischemia/stroke-induced memory impairment and brain injury
WO2014191128A1 (en) 2013-05-29 2014-12-04 Cellectis Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system
WO2015075195A1 (en) 2013-11-22 2015-05-28 Cellectis Method of engineering chemotherapy drug resistant t-cells for immunotherapy
WO2015092024A2 (en) * 2013-12-20 2015-06-25 Cellectis Method of engineering multi-input signal sensitive t cell for immunotherapy
WO2015121454A1 (en) 2014-02-14 2015-08-20 Cellectis Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells
WO2015136001A1 (en) 2014-03-11 2015-09-17 Cellectis Method for generating t-cells compatible for allogenic transplantation
WO2016120216A1 (en) 2015-01-26 2016-08-04 Cellectis mAb-DRIVEN CHIMERIC ANTIGEN RECEPTOR SYSTEMS FOR SORTING/DEPLETING ENGINEERED IMMUNE CELLS
CN105968210A (zh) * 2016-05-13 2016-09-28 深圳生创精准医疗科技有限公司 靶向cd22的强杀伤性嵌合抗原受体t细胞及其在制备治疗肿瘤的药物中的用途
WO2016201047A1 (en) 2015-06-09 2016-12-15 Editas Medicine, Inc. Crispr/cas-related methods and compositions for improving transplantation
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
JP2001522244A (ja) 1997-04-24 2001-11-13 ユニバーシティ オブ ワシントン パルボウイルスベクターによる標的化した遺伝子改変
TWI452136B (zh) * 2010-11-17 2014-09-11 中外製藥股份有限公司 A multiple specific antigen-binding molecule that replaces the function of Factor VIII in blood coagulation
US8790651B2 (en) * 2011-07-21 2014-07-29 Zoetis Llc Interleukin-31 monoclonal antibody
ES2654060T3 (es) 2011-10-20 2018-02-12 The U.S.A. As Represented By The Secretary, Department Of Health And Human Services Receptores de antígenos quiméricos anti-CD22
GB201206559D0 (en) 2012-04-13 2012-05-30 Ucl Business Plc Polypeptide
PL3119807T3 (pl) * 2014-03-19 2019-09-30 Cellectis Specyficzne wobec cd123 chimeryczne receptory antygenowe do immunoterapii nowotworów
EP3131927B8 (en) * 2014-04-14 2020-12-23 Cellectis Bcma (cd269) specific chimeric antigen receptors for cancer immunotherapy
WO2016124765A1 (en) * 2015-02-06 2016-08-11 Cellectis Primary hematopoietic cells genetically engineered by slow release of nucleic acids using nanoparticles
US10738116B2 (en) * 2015-03-19 2020-08-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Dual specific anti-CD22-anti-CD19 chimeric antigen receptors
AU2016243583B2 (en) * 2015-03-27 2022-03-10 President And Fellows Of Harvard College Modified T cells and methods of making and using the same
CN105958210B (zh) 2016-05-06 2018-10-30 中国科学院国家天文台 Fast望远镜开孔式反射面单元及其开孔方法
AU2017291851B2 (en) 2016-07-06 2022-10-13 Cellectis Sequential gene editing in primary immune cells
WO2018073391A1 (en) 2016-10-19 2018-04-26 Cellectis Targeted gene insertion for improved immune cells therapy
WO2018073393A2 (en) * 2016-10-19 2018-04-26 Cellectis Tal-effector nuclease (talen) -modified allogenic cells suitable for therapy
WO2018073394A1 (en) 2016-10-19 2018-04-26 Cellectis Cell death inducing chimeric antigen receptors
AU2018246377B2 (en) * 2017-03-31 2025-01-30 Cellectis Sa Universal anti-CD22 chimeric antigen receptor engineered immune cells
CA3067914A1 (en) * 2017-06-30 2019-01-03 Cellectis Cellular immunotherapy for repetitive administration
EP4185616A1 (en) * 2020-07-24 2023-05-31 Cellectis S.A. T-cells expressing immune cell engagers in allogenic settings

Patent Citations (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
US5143830A (en) 1986-05-15 1992-09-01 Holland Ian B Process for the production of a polypeptide
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
WO1997034598A1 (en) 1996-03-20 1997-09-25 The United States Of America, Represented By The Secretary, Department Of Health And Human Services Method of treating cancer using c-26 modified bryostatin
WO2001040214A1 (en) 1999-11-30 2001-06-07 The Board Of Trustees Of The Leland Stanford Junior University Bryostatin analogues, synthetic methods and uses
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
EP2737904A2 (en) 2007-02-09 2014-06-04 Blanchette Rockefeller Neurosciences Institute Therapeutic effects of bryostatins, bryologs, and other related substances on ischemia/stroke-induced memory impairment and brain injury
WO2008102199A1 (en) 2007-02-20 2008-08-28 Cellectis Meganuclease variants cleaving a dna target sequence from the beta-2-microglobulin gene and uses thereof
WO2012138927A2 (en) 2011-04-05 2012-10-11 Philippe Duchateau Method for the generation of compact tale-nucleases and uses thereof
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126720A2 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for the assessment of target cancer cell resistance to car engineered t cell killing
WO2013176915A1 (en) 2012-05-25 2013-11-28 Roman Galetto Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
WO2014065961A1 (en) 2012-10-24 2014-05-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services M971 chimeric antigen receptors
WO2014191128A1 (en) 2013-05-29 2014-12-04 Cellectis Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system
WO2015075195A1 (en) 2013-11-22 2015-05-28 Cellectis Method of engineering chemotherapy drug resistant t-cells for immunotherapy
WO2015092024A2 (en) * 2013-12-20 2015-06-25 Cellectis Method of engineering multi-input signal sensitive t cell for immunotherapy
WO2015121454A1 (en) 2014-02-14 2015-08-20 Cellectis Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells
WO2015136001A1 (en) 2014-03-11 2015-09-17 Cellectis Method for generating t-cells compatible for allogenic transplantation
WO2016120216A1 (en) 2015-01-26 2016-08-04 Cellectis mAb-DRIVEN CHIMERIC ANTIGEN RECEPTOR SYSTEMS FOR SORTING/DEPLETING ENGINEERED IMMUNE CELLS
WO2016201047A1 (en) 2015-06-09 2016-12-15 Editas Medicine, Inc. Crispr/cas-related methods and compositions for improving transplantation
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
CN105968210A (zh) * 2016-05-13 2016-09-28 深圳生创精准医疗科技有限公司 靶向cd22的强杀伤性嵌合抗原受体t细胞及其在制备治疗肿瘤的药物中的用途

Non-Patent Citations (108)

* Cited by examiner, † Cited by third party
Title
"Cell And Molecular Biology", 1987, ACADEMIC PRESS, article "Immunochemical Methods"
"GenBank", Database accession no. AAA53133
"Gene Expression Technology", vol. 185
"Gene Transfer Vectors For Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY
"Handbook Of Experimental Immunology", vol. I-IV, 1986
"Immobilized Cells And Enzymes", 1986, IRL PRESS
"Manipulating the Mouse Embryo", 1986, COLD SPRING HARBOR LABORATORY PRESS
"Methods In ENZYMOLOGY", ACADEMIC PRESS, INC.
"METHODS IN ENZYMOLOGY", vol. 154 and
"Nucleic Acid Hybridization", 1984
"Oligonucleotide Synthesis", 1984
"Transcription And Translation", 1984
"Uniprot", Database accession no. 000220
"Uniprot", Database accession no. 014763
"Uniprot", Database accession no. 095727
"Uniprot", Database accession no. 095971
"Uniprot", Database accession no. B7ZSB5
"Uniprot", Database accession no. P08887
"Uniprot", Database accession no. P12755
"Uniprot", Database accession no. P12757
"Uniprot", Database accession no. P16410
"Uniprot", Database accession no. P18627
"Uniprot", Database accession no. P25445
"Uniprot", Database accession no. P29350
"Uniprot", Database accession no. P30519
"Uniprot", Database accession no. P33402
"Uniprot", Database accession no. P37173
"Uniprot", Database accession no. P40189
"Uniprot", Database accession no. P40200
"Uniprot", Database accession no. P41240
"Uniprot", Database accession no. P42574
"Uniprot", Database accession no. P55210
"Uniprot", Database accession no. P55212
"Uniprot", Database accession no. P62714
"Uniprot", Database accession no. P67775
"Uniprot", Database accession no. P84022
"Uniprot", Database accession no. Q02108
"Uniprot", Database accession no. Q02153
"Uniprot", Database accession no. Q08334
"Uniprot", Database accession no. Q13158
"Uniprot", Database accession no. Q13485
"Uniprot", Database accession no. Q13651
"Uniprot", Database accession no. Q14790
"Uniprot", Database accession no. Q15116
"Uniprot", Database accession no. Q15582
"Uniprot", Database accession no. Q15583
"Uniprot", Database accession no. Q15796
"Uniprot", Database accession no. Q16520
"Uniprot", Database accession no. Q495A1
"Uniprot", Database accession no. Q60636
"Uniprot", Database accession no. Q6GTX8
"Uniprot", Database accession no. Q7Z6A9
"Uniprot", Database accession no. Q8BXH3
"Uniprot", Database accession no. Q8TDQ0
"Uniprot", Database accession no. Q92851
"Uniprot", Database accession no. Q9BZS1
"Uniprot", Database accession no. Q9BZW8
"Uniprot", Database accession no. Q9NWQ8
"Uniprot", Database accession no. Q9P2K8
"Uniprot", Database accession no. Q9Y286
"Uniprot", Database accession no. Q9Y2R2
"Uniprot", Database accession no. Q9Y336
"Uniprot", Database accession no. Q9Y3P8
B. PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984
BRENTJENS RJ; DAVILA ML; RIVIERE I; PARK J; WANG X; COWELL LG ET AL.: "CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia", SCI TRANSL MED., vol. 5, no. 177, 2013, pages 177ra38, XP055234457, DOI: doi:10.1126/scitranslmed.3005930
BRIAN PHILIP ET AL: "86. A Highly Compact Epitope-Based Marker Suicide Gene for Safer and Easier Adoptive T-Cell Gene Therapy", GENE & CELL THERAPY, 1 May 2012 (2012-05-01), pages S35 - s36, XP055476201, Retrieved from the Internet <URL:https://www.cell.com/molecular-therapy-family/molecular-therapy/pdf/S1525-0016(16)35890-7.pdf> [retrieved on 20180517] *
COFFIN, J. M. ET AL.: "Fundamental Virology", 1996, LIPPINCOTT-RAVEN PUBLISHERS, article "Retroviridae: The viruses and their replication"
E K MAI; U BERTSCH; J DURIG; C KUNZ; M HAENEL; I W BLAU; M MUNDER; A JAUCH; B SCHURICH; T HIELSCHER: "Phase III trial of bortezomib, cyclophosphamide and dexamethasone (VCD) versus bortezomib, doxorubicin and dexamethasone (PAd) in newly diagnosed myeloma", LEUKEMIA, 19 March 2015 (2015-03-19)
FADERL S; THOMAS DA; O'BRIEN S; RAVANDI F; GARCIA-MANERO G; BORTHAKUR G ET AL.: "Augmented hyper-CVAD based on dose-intensified vincristine, dexamethasone, and asparaginase in adult acute lymphoblastic leukemia salvage therapy", CLIN LYMPHOMA MYELOMA LEUK., vol. 11, no. 1, 2011, pages 54 - 9
FIELDING AK; RICHARDS SM; CHOPRA R; LAZARUS HM; LITZOW MR; BUCK G ET AL.: "Outcome of 609 adults after relapse of acute lymphoblastic leukemia (ALL); an MRC UKALL12/ECOG 2993 study", BLOOD, vol. 109, no. 3, 2007, pages 944 - 50
FREDERICK M. AUSUBEL: "Molecular Biology", 2000, WILEY AND SON INC, LIBRARY OF CONGRESS
GOUBLE A., SCHIFFER-MNNIOUI C., THOMAS S., GAUTRON A-S. ET AL.: "UCART22:allogenic adoptive immunotherapy of leukemia by targeting CD22 with CAT T-cells", CANCER RES., vol. 77, no. 13, 3763, 1 July 2017 (2017-07-01), XP002781056, DOI: 10.1158/1538-7445.AM2017-3763 *
GREENLEE ET AL., CA CANCER J. CLIN., vol. 50, 2000, pages 7 - 33
GRUPP SA; KALOS M; BARRETT D; APLENC R; PORTER DL; RHEINGOLD SR ET AL.: "Chimeric antigen receptor-modified T cells for acute lymphoid leukemia", N ENGL J MED., vol. 368, no. 16, 2013, pages 1509 - 18, XP055169041, DOI: doi:10.1056/NEJMoa1215134
HASO ET AL., BLOOD, vol. 121, no. 7, 2013, pages 1165 - 1174
HASO W; LEE DW; SHAH NN; STETLER-STEVENSON M; YUAN CM; PASTAN IH; DIMITROV DS; MORGAN RA; FITZGERALD DJ; BARRETT DM: "Anti-CD22-chimeric antigen receptors targeting B-cell precursor acute lymphoblastic leukemia", BLOOD, vol. 121, no. 7, 14 February 2013 (2013-02-14), pages 1165 - 74
INABA H; GREAVES M; MULLIGHAN CG: "Acute lymphoblastic leukaemia", LANCET, vol. 381, no. 9881, 2013, pages 1943 - 55, XP055335069, DOI: doi:10.1016/S0140-6736(12)62187-4
JUILLERAT, A. ET AL., AN OXYGEN SENSITIVE SELF-DECISION MAKING ENGINEERED CAR T-CE REP., vol. 7, 2017, pages 39833
JULIA WELLS ET AL: "Pre-Clinical Activity of Allogeneic Anti-CD22 CAR-T Cells for the Treatment of B-Cell Acute Lymphoblastic Leukemia", vol. 130 suppl. 1, 7 December 2017 (2017-12-07), pages 808, XP009505340, ISSN: 0006-4971, Retrieved from the Internet <URL:http://www.bloodjournal.org/content/130/Suppl_1/808?utm_source=TrendMD&utm_medium=cpc&utm_campaign=Blood_TrendMD_0> *
JUSTIN EYQUEM ET AL: "Targeting a CAR to the TRAC locus with CRISPR/Cas9 enhances tumour rejection", NATURE, vol. 543, no. 7643, 22 February 2017 (2017-02-22), GB, pages 113 - 117, XP055397283, ISSN: 0028-0836, DOI: 10.1038/nature21405 *
KEBRIAEI P; SINGH H; HULS MH; FIGLIOLA MJ; BASSETT R; OLIVARES S ET AL.: "Phase I trials using Sleeping Beauty to generate CD19-specific CAR T cells", J CLIN INVEST., vol. 126, no. 9, 2016, pages 3363 - 76
KOCHENDERFER JN; WILSON WH; JANIK JE; DUDLEY ME; STETLER-STEVENSON M; FELDMAN SA ET AL.: "Eradication of B-lineage cells and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19", BLOOD, vol. 116, no. 20, 2010, pages 4099 - 102
KOCHENDERFERJN; DUDLEY ME; KASSIM SH; SOMERVILLE RP; CARPENTER RO; STETLER-STEVENSON M ET AL.: "Chemotherapy-refractory diffuse large B-cell lymphoma and indolent B-cell malignancies can be effectively treated with autologous T cells expressing an anti-CD19 chimeric antigen receptor", J CLIN ONCOL., vol. 33, no. 6, 2015, pages 540 - 9
LEE DW; KOCHENDERFER JN; STETLER-STEVENSON M; CUI YK; DELBROOK C; FELDMAN SA ET AL.: "T cells expressing CD19 chimeric antigen receptors for acute lymphoblastic leukaemia in children and young adults: a phase 1 dose-escalation trial", LANCET, vol. 385, no. 9967, 2015, pages 517 - 28, XP055388598, DOI: doi:10.1016/S0140-6736(14)61403-3
LONG ADRIENNE H ET AL: "Lessons learned from a highly-active CD22-specific chimeric antigen receptor", ONCOIMMUNOLOGY, LANDES BIOSCIENCE, US, vol. 2, no. 4, 1 April 2013 (2013-04-01), pages e23621/1 - 3, XP009173972, ISSN: 2162-4011, DOI: 10.4161/ONCI.23621 *
MACLEOD ET AL.: "Integration of a CD19 CAR into the TCR Alpha Chain Locus Streamlines Production of Allogeneic Gene-Edited CAR T Cells", MOLECULAR THERAPY, 2017
MAUDE SL; TEACHEY DT; PORTER DL; GRUPP SA: "CD19-targeted chimeric antigen receptor T-cell therapy for acute lymphoblastic leukemia", BLOOD, vol. 125, no. 26, 2015, pages 4017 - 23, XP055565639, DOI: doi:10.1182/blood-2014-
MITCHELL HO; SATOSHI NAGATA; IRA PASTAN: "Isolation of anti-CD22 Fv with high affinity by Fv display on human cells", PNAS 2006, vol. 103, no. 25, 8 June 2006 (2006-06-08), pages 9637 - 9642
MULLIGHAN CG: "Genome sequencing of lymphoid malignancies", BLOOD, vol. 122, no. 24, 2013, pages 3899 - 907, XP055549775, DOI: doi:10.1182/blood-2013-08-460311
MULLIGHAN CG: "Genomic characterization of childhood acute lymphoblastic leukemia", SEMIN HEMATOL., vol. 50, no. 4, 2013, pages 314 - 24
ORIOL A; VIVES S; HERNANDEZ-RIVAS JM; TORMO M; HERAS I; RIVAS C ET AL.: "Outcome after relapse of acute lymphoblastic leukemia in adult patients included in four consecutive risk-adapted trials by the PETHEMA Study Group", HAEMATOLOGICA, vol. 95, no. 4, 2010, pages 589 - 96
PARK JH; GEYER MB; BRENTJENS RJ: "CD19-targeted CAR T-cell therapeutics for hematologic malignancies: interpreting clinical outcomes to date", BLOOD, vol. 127, no. 26, 2016, pages 3312 - 20, XP055449358, DOI: doi:10.1182/blood-2016-02-629063
PORTER DL; LEVINE BL; KALOS M; BAGG A; JUNE CH: "Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia", N ENGL J MED., vol. 365, no. 8, 2011, pages 725 - 33, XP055247863, DOI: doi:10.1056/NEJMoa1103849
R. I. FRESHNEY: "Culture Of Animal Cells", 1987, ALAN R. LISS, INC.
R. KUHN; F. SCHWENK; M. AGUET; K. RAJEWSKY: "Inducible gene targeting in mice", SCIENCE, vol. 269, no. 5229, 8 September 1995 (1995-09-08), pages 1427 - 1429, XP002081198, DOI: doi:10.1126/science.7660125
RAULF-HEIMSOTH M: "T cell - primary culture from peripheral blood", METHODS MOL MED., vol. 138, 2008, pages 17 - 30
SAMBROOK: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR, NEW YORK: COLD SPRING HARBOR LABORATORY PRESS
SBLATTERO; BRADBURY, NATURE BIOTECHNOLOGY, vol. 18, 2000, pages 75 - 80
TARASEVICIUTE, A.; KEAN, L.; JENSEN, M. C.: "Creation of the First Non-Human Primate Model That Faithfully Recapitulates Chimeric Antigen Receptor (CAR) T Cell-Mediated Cytokine Release Syndrome (CRS) and Neurologic Toxicity Following B Cell-Directed CAR-T Cell Therapy", BLOOD, vol. 128, no. 22, 2016, pages 651, Retrieved from the Internet <URL:http://www.bloodjournal.org/content/128/22/651>
TAVERNIER E; BOIRON JM; HUGUET F; BRADSTOCK K; VEY N; KOVACSOVICS T ET AL.: "Outcome of treatment after first relapse in adults with acute lymphoblastic leukemia initially treated by the LALA-94 trial. Leukemia : official journal of the Leukemia Society of America", LEUKEMIA RESEARCH FUND, vol. 21, no. 9, 2007, pages 1907 - 14
VALTON ET AL., MOLECULAR THERAPY, vol. 23, no. 9, September 2015 (2015-09-01), pages 1507 - 1518
VARTERASIAN ML1; MOHAMMAD RM; SHURAFA MS; HULBURD K; PEMBERTON PA; RODRIGUEZ DH; SPADONI V; EILENDER DS; MURGO A; WALL N: "Phase II trial of bryostatin 1 in patients with relapsed low-grade non-Hodgkin's lymphoma and chronic lymphocytic leukemia", CLIN CANCER RES., vol. 6, no. 3, March 2000 (2000-03-01), pages 825 - 8
W. HASO ET AL: "Anti-CD22-chimeric antigen receptors targeting B cell precursor acute lymphoblastic leukemia", BLOOD, 14 December 2012 (2012-12-14), XP055048750, ISSN: 0006-4971, DOI: 10.1182/blood-2012-06-438002 *
WASEEM QASIM ET AL.: "Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells", SCIENCE TRANSLATIONAL MEDICINE, 25 January 2017 (2017-01-25)
WELLS J., CAI T., SCHIFFER-MANNIOU C., FILIPE S. ET AL.: "Pre-Clinical Activity of Allogeneic Anti-CD22 CAR-T Cells for the Treatment of B-Cell Acute Lymphoblastic Leukemia", 7 December 2017 (2017-12-07), XP002781137, Retrieved from the Internet <URL:http://www.cellectis.com/uploads/files/ASH2017_UCART22.pdf> [retrieved on 20180517] *
WENDER, PAUL A.; JEREMY L. BARYZA; CHAD E. BENNETT; F. CHRISTOPHER BI; STACEY E. BRENNER; MICHAEL 0. CLARKE; JOSHUA C. HORAN; CIND: "The Practical Synthesis of a Novel and Highly Potent Analogue of Bryostatin", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 124, no. 46, 2002, pages 13648 - 13649, XP002965044, DOI: doi:10.1021/ja027509+
XIAO X; HO M; ZHU Z; PASTAN I; DIMITROV DS: "Identification and characterization of fully human anti-CD22 monoclonal antibodies", MABS, vol. 1, no. 3, 2009, pages 297 - 303, XP009173960, DOI: doi:10.4161/mabs.1.3.8113
ZHIHONG SHEN; HEPING YAN; YING ZHANG; RAYMOND L. MERNAUGH; XIANGQUN ZENG, ANAL CHEM., vol. 80, no. 6, 2008, pages 1910 - 1917

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12133867B2 (en) 2017-03-31 2024-11-05 Cellectis Sa Universal anti-CD22 chimeric antigen receptor engineered immune cells
EP3774919A4 (en) * 2018-03-30 2021-12-29 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
JP2022532996A (ja) * 2019-04-26 2022-07-21 アロジーン セラピューティクス,インコーポレイテッド リツキシマブ耐性キメラ抗原受容体およびその用途
JP7664180B2 (ja) 2019-04-26 2025-04-17 アロジーン セラピューティクス,インコーポレイテッド リツキシマブ耐性キメラ抗原受容体およびその用途
JP2025109712A (ja) * 2019-04-26 2025-07-25 アロジーン セラピューティクス,インコーポレイテッド リツキシマブ耐性キメラ抗原受容体およびその用途
US12447178B2 (en) 2019-04-26 2025-10-21 Allogene Therapeutics, Inc. Method of treatment using anti-CD19 rituximab-resistant chimeric antigen receptors
EP4151653A4 (en) * 2020-04-16 2024-05-08 Shanghai Cellular Biopharmaceutical Group Ltd. Cd22-targeted chimeric antigen receptor, preparation method therefor and application thereof
US20230279350A1 (en) * 2020-07-31 2023-09-07 Cellectis S.A. Dual car-t cells
RU2839662C1 (ru) * 2020-07-31 2025-05-07 Селлектис С.А. Т-клетки с двумя химерными антигенными рецепторами car
US12618048B2 (en) * 2020-07-31 2026-05-05 Cellectis S.A. Dual CAR-T cells
CN111944850A (zh) * 2020-08-28 2020-11-17 澳门大学 表达抗cd22嵌合抗原受体和pd-l1阻断蛋白的细胞的制备方法、表达载体及应用

Also Published As

Publication number Publication date
CN110869046B (zh) 2025-02-25
JP2020512019A (ja) 2020-04-23
US20210100839A1 (en) 2021-04-08
EP3592379B1 (en) 2024-04-24
EP3592380A1 (en) 2020-01-15
MX2019011475A (es) 2019-12-16
JP7634045B2 (ja) 2025-02-20
PT3592379T (pt) 2024-05-31
AU2018246377B2 (en) 2025-01-30
BR112019020203A2 (pt) 2020-06-02
US20250026808A1 (en) 2025-01-23
JP2023139070A (ja) 2023-10-03
AU2018246377A1 (en) 2019-10-17
US20210161954A1 (en) 2021-06-03
WO2018178378A1 (en) 2018-10-04
IL269538B2 (en) 2023-07-01
EP3592380B1 (en) 2024-10-09
EP4414380A2 (en) 2024-08-14
DK3592379T3 (da) 2024-06-03
CA3058268A1 (en) 2018-10-04
US12133867B2 (en) 2024-11-05
KR20200015467A (ko) 2020-02-12
CN110869046A (zh) 2020-03-06
IL269538A (en) 2019-11-28
RU2019133365A3 (https=) 2021-07-20
KR102726269B1 (ko) 2024-11-05
AU2018246378A1 (en) 2019-10-17
US20240189354A1 (en) 2024-06-13
EP4414380A3 (en) 2024-12-04
IL269538B1 (en) 2023-03-01
EP3592379A1 (en) 2020-01-15
ES2979232T3 (es) 2024-09-25
JP7314115B2 (ja) 2023-07-25
RU2019133365A (ru) 2021-04-30
US11690873B2 (en) 2023-07-04
US11944643B2 (en) 2024-04-02

Similar Documents

Publication Publication Date Title
US12133867B2 (en) Universal anti-CD22 chimeric antigen receptor engineered immune cells
US11987639B2 (en) Trophoblast glycoprotein (5T4, TPBG) specific chimeric antigen receptors for cancer immunotherapy
EP3298046B1 (en) Anti-gd3 specific chimeric antigen receptors for cancer immunotherapy
EP3126390B2 (en) Cd33 specific chimeric antigen receptors for cancer immunotherapy
RU2775453C2 (ru) Сконструированные универсальные иммунные клетки с анти-cd22 химерным антигенным рецептором
HK40021192A (en) Universal anti-cd22 chimeric antigen receptor engineered immune cells
HK40021192B (en) Universal anti-cd22 chimeric antigen receptor engineered immune cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18715024

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3058268

Country of ref document: CA

Ref document number: 2020503358

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019020203

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2018246377

Country of ref document: AU

Date of ref document: 20180330

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018715024

Country of ref document: EP

Effective date: 20191010

ENP Entry into the national phase

Ref document number: 20197032371

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112019020203

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190926

WWG Wipo information: grant in national office

Ref document number: 201880036267.2

Country of ref document: CN