WO2018144542A1 - TGFβ AND ACTRII ANTAGONISTS FOR USE IN INCREASING IMMUNE ACTIVITY - Google Patents
TGFβ AND ACTRII ANTAGONISTS FOR USE IN INCREASING IMMUNE ACTIVITY Download PDFInfo
- Publication number
- WO2018144542A1 WO2018144542A1 PCT/US2018/016148 US2018016148W WO2018144542A1 WO 2018144542 A1 WO2018144542 A1 WO 2018144542A1 US 2018016148 W US2018016148 W US 2018016148W WO 2018144542 A1 WO2018144542 A1 WO 2018144542A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- polypeptide
- seq
- acid sequence
- patient
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/45—Transferases (2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/495—Transforming growth factor [TGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/51—Bone morphogenetic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/1103—Receptor protein serine/threonine kinase (2.7.11.30)
Definitions
- Cancer immunotherapy is a new paradigm in cancer treatment that, instead of targeting cancer cells, focuses on activation of the immune system. Its principle is to rearm the host's immune response, especially the adaptive T cell response, to identify and kill the cancer cells and to achieve long-lasting, protective immunity.
- cancer immunotherapy agents are also being investigated for the ability to improve immune responses in other disorders, particularly in infectious diseases wherein the pathogen is immune-evasive and/or compromises the host immune system.
- Demonstration that anti- PD-1 or anti-PD-Ll therapy induced durable responses in melanoma, kidney, and lung cancer in clinical trials further signify the potential use of immunotherapy in the treatment of a broad spectrum of cancers (Pardoll, D. M., Nat Immunol. 2012; 13 : 1129-32).
- ipilimumab therapy has a high toxicity profile, presumably because anti-CTLA-4 treatment, by interfering with the primary T cell inhibitory checkpoint, can lead to the generation of new autoreactive T cells.
- anti-PD-1 therapy can nevertheless sometimes result in potentially fatal lung-related autoimmune adverse events.
- the data presented herein demonstrates that ActRII antagonists (inhibitors) and TGFP antagonists (particularly inhibitors of TGFP2) can be used alone or in combination to treat cancer.
- ActRII antagonists inhibitors
- TGFP antagonists particularly inhibitors of TGFP2
- treatment with an ActRIIA polypeptide, an ActRIIB polypeptide, or a pan-specific TGFp antibody separately, decreased tumor burden and increased survival time a cancer model.
- an ActRII antagonist in combination with a TGFP antagonist can be used to synergistically increase antitumor activity compared to the effects observed with either agent alone.
- the disclosure provides, in part, methods of using an ActRII antagonist, a TGFP antagonist, or a combination of an ActRII antagonist and a TGFP antagonist, alone or in combination with one or more supportive therapies and/or active agents, to treat cancer, particularly treating or preventing one or more complications of a cancer (e.g., reducing tumor burden).
- the data indicate that efficacy of ActRII and TGFP antagonist therapy is dependent on the immune system. Therefore, in part, the instant disclosure relates to the discovery that ActRII and TGFP antagonists may be used as immunotherapeutics, particularly to treat a wide variety of cancers (e.g., cancers associated with immunosuppression and/or immune exhaustion).
- immune potentiating agents may be useful in treating a wide variety of infectious diseases, particularly pathogenic agents which promote immunosuppression and/or immune exhaustion. Also, such immune potentiating agents may be useful in boosting the immunization efficacy of vaccines (e.g., infectious disease and cancer vaccines).
- vaccines e.g., infectious disease and cancer vaccines
- the disclosure provides various ActRII and TGFp antagonists that can be used, alone or in combination, to increase immune responses in a subject in need thereof, treat cancer, treat infectious diseases, and/or increase immunization efficacy, optionally in combination with one or more supportive therapies and/or additional active agents.
- the ActRIIA polypeptides, ActRIIB polypeptides, and TGFp antibody described in the examples may affect the immune system and/or cancer through a
- ActRII-binding and/or TGFpRII-binding ligands e.g., inhibition of one or more of GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, and activin AE), BMP6, GDF3, BMP 10, BMP9, TGFp2, TGFpl, and TGFP3 may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of additional agents, including, perhaps, other members of this ligand superfamily, and such collective inhibition may lead to the desired effect on, for example, cancer], other types of ActRII signaling and TGFpRII signaling pathway inhibitors [e.g., ActRII and/or TGFpRII ligand inhibitors; type I-, type II-, and/or co-receptor inhibitors (e.g., inhibitors of one or more of ALK4, ALK5, ActRIIA, ActRIIB, TGFpRII,
- agents that inhibit ActRII ActRIIA and/or ActRIIB activity are collectively referred to as "ActRII antagonists:" or “ActRII inhibitors” and include, for example, agents that inhibit one or more of ActRIIA, ActRIIB, ALK4, and ActRII ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, and activin AE), GDF11, GDF8, BMP6, GDF3, BMP10, and BMP9].
- ActRII ActRIIA and/or ActRIIB activity
- ActRII inhibitors include, for example, agents that inhibit one or more of ActRIIA, ActRIIB, ALK4, and ActRII ligands [e.g., activin (e.g., activin A, activin B, activin C, activin E, activin AB, and activin AE), GDF11, GDF8, BMP6, GDF3, BMP10, and
- agents that inhibit TGFpRII activity are collectively referred to as "TGFP antagonists:” or “TGFP inhibitors” and include, for example, agents that inhibit one or more of TGFpRII, ALK5, betaglycan, and TGFpRII ligands (e.g., TGFpl, TGFp2, and TGFp3).
- TGFP antagonists include, for example, agents that inhibit one or more of TGFpRII, ALK5, betaglycan, and TGFpRII ligands (e.g., TGFpl, TGFp2, and TGFp3).
- the disclosure relates to methods of inducing an immune response in a patient comprising administering to a patient in need thereof an ActRII antagonist and a TGFP antagonist wherein the ActRII antagonist and TGFP antagonist are administering in an effective amount.
- the disclosure relates to methods of potentiating an immune response in a patient comprising administering to a patient in need thereof an ActRII antagonist and a TGFP antagonist wherein the ActRII antagonist and TGFP antagonist are administering in an effective amount.
- the disclosure relates to use of an ActRII antagonist in combination with a TGFP antagonist to induce or potentiate an immune response in a patient in need thereof.
- the disclosure relates to use of a TGFP antagonist in combination with a ActRII antagonist to induce or potentiate an immune response in a patient in need thereof.
- the patient has a cancer.
- the patient has a tumor.
- the initiated or potentiated immune response is against a cancer. In some embodiments, the initiated or potentiated immune response is against a tumor. In some embodiments, the initiated or potentiated immune response inhibits growth of a cancer. In some embodiments, the initiated or potentiated immune response inhibits growth of a tumor. In some embodiments, the initiated or potentiated immune response decreases cancer cell burden in the patient. In some embodiments, the initiated or potentiated immune response decreases tumor cell burden in the patient. In some embodiments, the initiated or potentiated immune response treats or prevents cancer metastasis. In some embodiments, the initiated or potentiated immune response treats or prevents tumor metastasis. In some embodiments, the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes
- the cancer promotes immune cell exhaustion in the patient.
- the tumor promotes immune cell exhaustion in the patient.
- the cancer promotes T cell exhaustion.
- the tumor promotes T cell exhaustion.
- the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to
- the patient has a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia e.g., metastatic melanoma
- lung cancer e.g., squamous non-
- the initiated or potentiated immune response is against a pathogen. In some embodiments, the initiated or potentiated immune response treats infection by a pathogen in the patient. In some embodiments, the initiated or potentiated immune response prevents infection by a pathogen in the patient. In some embodiments, the pathogen promotes immunosuppression in the patient. In some embodiments, the pathogen promotes immune cell exhaustion in the patient. In some embodiments, the pathogen promotes T cell exhaustion. In some embodiments, the pathogen is responsive to immunotherapy. In some embodiments, the pathogen is selected from the group consisting of: a bacterial, viral, fungal, or parasitic pathogen. In some embodiments, the patient is at risk for developing immune exhaustion.
- the patient has a disease or condition associated with immune exhaustion.
- the initiated or potentiated immune response comprises a T cell immune response.
- the initiated or potentiated immune response vaccinates the patient against a cancer or pathogen.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab,
- the patient does not have an autoimmune disease.
- the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation.
- the patient does not have graft vs. host disease.
- the disclosure relates to methods of treating cancer in a patient comprising administering to a patient in need thereof an ActRII antagonist and a TGFP antagonist wherein the ActRII antagonist and the TGFP antagonist are administered in an effective amount.
- the disclosure relates to method of treating a tumor in a patient comprising administering to a patient in need thereof an ActRII antagonist and a TGFP antagonist wherein the ActRII antagonist and the TGFP antagonist are administered in an effective amount.
- the disclosure relates to use of an ActRII antagonist in combination with a TGFP antagonist to treat cancer or a tumor in a patient in need thereof.
- the disclosure relates to use of a TGFp antagonist in combination with an ActRII antagonist to treat cancer or a tumor in a patient in need thereof.
- the method inhibits growth of a cancer. In some embodiments, the method inhibits growth of a tumor. In some embodiments, the method decreases cancer cell burden in the patient. In some embodiments, the method decreases tumor cell burden in the patient. In some embodiments, the method treats or prevents cancer metastasis. In some
- the method treats or prevents tumor metastasis.
- the cancer promotes immunosuppression in the patient.
- the tumor promotes immunosuppression in the patient.
- the cancer promotes immune cell exhaustion in the patient.
- the tumor promotes immune cell exhaustion in the patient.
- the cancer promotes T cell exhaustion.
- the tumor promotes T cell exhaustion.
- the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- the patient is at risk for developing immune exhaustion.
- the patient has a disease or condition associated
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death- ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of treating immune exhaustion in a patient comprising administering to a patient in need thereof an ActRII antagonist and a TGFP antagonist wherein the ActRII antagonist and the TGFP antagonist are administered in an effective amount.
- the disclosure relates to methods of preventing immune exhaustion in a patient comprising administering to a patient in need thereof an ActRII antagonist and a TGFP antagonist wherein the ActRII antagonist and the TGFP antagonist are administered in an effective amount.
- the disclosure relates to use of an ActRII antagonist in combination with a TGFP antagonist for treating or preventing immune exhaustion.
- the disclosure relates to use of a TGFp antagonist in combination with a ActRII antagonist for treating or preventing immune exhaustion.
- the patient has a cancer.
- the patient has a tumor.
- the method inhibits growth of a cancer.
- the method inhibits growth of a tumor.
- the method decreases cancer cell burden in the patient.
- the method decreases tumor cell burden in the patient.
- the method treats or prevents cancer metastasis.
- the method treats or prevents tumor metastasis.
- the cancer promotes immunosuppression in the patient.
- the tumor promotes immunosuppression in the patient.
- the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia e.g., metastatic melanoma
- lung cancer e.g., squamous non-
- the patient is infected with a pathogen.
- the method treats infection by a pathogen in the patient.
- the method prevents infection by a pathogen in the patient.
- the pathogen promotes immunosuppression in the patient.
- the pathogen promotes immune cell exhaustion in the patient. In some embodiments, the pathogen promotes T cell exhaustion. In some embodiments, the pathogen is responsive to immunotherapy. In some embodiments, the pathogen is selected from the group consisting of: a bacterial, viral, fungal, or parasitic pathogen. In some embodiments, immune exhaustion comprises a T cell immune exhaustion. In some embodiments, the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor. In some embodiments, the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen. In some embodiments, the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune- oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death- ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death- ligand 1
- a CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic T-lymphocyte antigen 4
- PD-1) binding agent e
- the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of inducing an immune response against an antigen in a patient comprising administering to a patient in need thereof: a TGFP antagonist, an ActRII antagonist, and the antigen wherein the TGFP antagonist, the ActRII antagonist, and the antigen are administered in an effective amount.
- the disclosure relates to methods of potentiating an immune response against an antigen in a patient comprising administering to a patient in need thereof: a TGFP antagonist, an ActRII antagonist, and the antigen wherein the TGFp antagonist, the ActRII antagonist, and the antigen are administered in an effective amount.
- the disclosure relates to use of an ActRII antagonist in combination with a TGFP antagonist for inducing or potentiating an immune response against an antigen.
- the antigen is a cancer antigen. In some embodiments, the antigen is a tumor antigen.
- the cancer or tumor antigen is associated with a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia melanoma
- lung cancer e.g., squamous non-small cell
- the antigen is a pathogen antigen.
- the pathogen antigen is associated with a pathogen selected from the group consisting of: a bacterial pathogen, a viral pathogen, a fungal pathogen, or a parasite pathogen.
- the cancer antigen is administered in accordance with a vaccination protocol.
- the tumor antigen is administered in accordance with a vaccination protocol.
- the pathogen antigen is administered in accordance with a vaccination protocol.
- the initiated or potentiated immune response vaccinates the patient against a cancer.
- the initiated or potentiated immune response vaccinates the patient against a tumor.
- the initiated or potentiated immune response vaccinates the patient against a pathogen.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab,
- the cancer promotes immunosuppression in the patient.
- the tumor promotes immunosuppression in the patient.
- the cancer promotes immune cell exhaustion in the patient.
- the tumor promotes immune cell exhaustion in the patient.
- the cancer promotes T cell exhaustion.
- the cancer promotes T cell exhaustion.
- the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to
- the pathogen promotes immunosuppression in the patient. In some embodiments, the pathogen promotes immune cell exhaustion in the patient. In some embodiments, the pathogen promotes T cell exhaustion. In some embodiments, the pathogen is responsive to immunotherapy. In some embodiments, the patient has a disease or condition associated with immune exhaustion. In some embodiments, the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of vaccinating a patient against a cancer comprising administering to a patient in need thereof: a TGFP antagonist, an ActRII antagonist, and a cancer antigen, wherein the TGFp antagonist, the ActRII antagonist, and the antigen are administered in an amount effective to vaccinate the patient.
- the disclosure relates to methods of vaccinating a patient against a pathogen comprising administering to a patient in need thereof: a TGFp antagonist, an ActRII antagonist, and a pathogen antigen, wherein the TGFp antagonist, the ActRII antagonist, and the antigen are administered in an amount effective to vaccinate the patient.
- the disclosure relates to use of an ActRII antagonist in combination with a TGFp antagonist and a cancer antigen to vaccinate the patient against a cancer. In some aspects, the disclosure relates to use of a TGFP antagonist in combination with an ActRII antagonist and a cancer antigen to vaccinate the patient against a cancer. In some aspects, the disclosure relates to use of an ActRII antagonist in combination with a TGFP antagonist and a pathogen antigen to vaccinate the patient against a pathogen. In some aspects, the disclosure relates to use of a TGFP antagonist in combination with an ActRII antagonist and a pathogen antigen to vaccinate the patient against a pathogen.
- the cancer or tumor antigen is associated with a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia melanoma
- lung cancer e.g., squamous non-small cell
- the pathogen antigen is associated with a pathogen selected from the group consisting of: a bacterial pathogen, a viral pathogen, a fungal pathogen, or a parasite pathogen.
- the cancer antigen is administered in accordance with a vaccination protocol.
- the tumor antigen is administered in accordance with a vaccination protocol.
- the pathogen antigen is administered in accordance with a vaccination protocol.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death-ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death-ligand 1
- PD-L1 antibody e.g., a PD-L1 antibody
- CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic
- the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to immunotherapy. In some embodiments, the pathogen promotes
- the pathogen promotes immune cell exhaustion in the patient. In some embodiments, the pathogen promotes T cell exhaustion. In some embodiments, the pathogen is responsive to immunotherapy. In some embodiments, the patient has a disease or condition associated with immune exhaustion. In some embodiments, the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of potentiating an immune response induced by a vaccine in a patient comprising administering a TGFP antagonist and an ActRII antagonist to a patient in an amount effective to potentiate an immune response induced by the vaccine in the patient.
- the disclosure relates to use of an ActRII antagonist in combination with a TGFP antagonist to potentiate an immune response induced by a vaccine in a patient in need thereof.
- the disclosure relates to use of an TGFP antagonist in combination with a ActRII antagonist to potentiate an immune response induced by a vaccine in a patient in need thereof.
- the vaccine is a cancer vaccine.
- the vaccine is a tumor vaccine.
- the initiated or potentiated immune response inhibits growth of a cancer. In some embodiments, the initiated or potentiated immune response inhibits growth of a tumor. In some embodiments, the initiated or potentiated immune response decreases cancer cell burden in the patient. In some embodiments, the initiated or potentiated immune response decreases tumor cell burden in the patient. In some embodiments, the initiated or potentiated immune response treats or prevents cancer metastasis. In some embodiments, the initiated or potentiated immune response treats or prevents tumor metastasis. In some embodiments, the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient.
- the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia e.g., metastatic melanoma
- lung cancer e.g., squamous non-
- the vaccine is a pathogen vaccine.
- the initiated or potentiated immune response treats infection by a pathogen in the patient.
- the initiated or potentiated immune response prevents infection by a pathogen in the patient.
- the pathogen promotes immunosuppression in the patient.
- the pathogen promotes immune cell exhaustion in the patient.
- the pathogen promotes T cell exhaustion.
- the pathogen is responsive to immunotherapy.
- the pathogen is selected from the group consisting of: a bacterial, viral, fungal, or parasitic pathogen.
- the patient is at risk for developing immune exhaustion.
- the patient has a disease or condition associated with immune exhaustion.
- the initiated or potentiated immune response comprises a T cell immune response.
- the initiated or potentiated immune response vaccinates the patient against a cancer or pathogen.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune- oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death- ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death- ligand 1
- a CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic T-lymphocyte antigen 4
- PD-1) binding agent e
- the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of inducing an immune response in a patient comprising administering to a patient in need thereof and effective amount of a TGFp antagonist. In some aspects, the disclosure relates to methods of potentiating an immune response in a patient comprising administering to a patient in need thereof and effective amount of a TGFp antagonist. In some aspects, the disclosure relates to use of a TGFP antagonist for inducing or potentiating an immune response in a patient in need thereof. In some embodiments, the patient has a cancer. In some embodiments, the patient has a tumor. In some embodiments, the initiated or potentiated immune response is against a cancer. In some embodiments, the initiated or potentiated immune response is against a tumor.
- the initiated or potentiated immune response inhibits growth of a cancer. In some embodiments, the initiated or potentiated immune response inhibits growth of a tumor. In some embodiments, the initiated or potentiated immune response decreases cancer cell burden in the patient. In some embodiments, the initiated or potentiated immune response decreases tumor cell burden in the patient. In some embodiments, the initiated or potentiated immune response treats or prevents cancer metastasis. In some embodiments, the initiated or potentiated immune response treats or prevents tumor metastasis. In some embodiments, the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to
- the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of:
- leukemia melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic
- the initiated or potentiated immune response is against a pathogen. In some embodiments, the initiated or potentiated immune response treats infection by a pathogen in the patient.
- the initiated or potentiated immune response prevents infection by a pathogen in the patient.
- the pathogen promotes immunosuppression in the patient.
- the pathogen promotes immune cell exhaustion in the patient.
- the pathogen promotes T cell exhaustion.
- the pathogen is responsive to immunotherapy.
- the pathogen is selected from the group consisting of: a bacterial, viral, fungal, or parasitic pathogen.
- the patient is at risk for developing immune exhaustion.
- the patient has a disease or condition associated with immune exhaustion.
- the initiated or potentiated immune response comprises a T cell immune response.
- the initiated or potentiated immune response vaccinates the patient against a cancer or pathogen.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab,
- the patient does not have an autoimmune disease.
- the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation.
- the patient does not have graft vs. host disease.
- the disclosure relates to methods of treating cancer in a patient comprising administering to a patient in need thereof an effective amount of a TGFP antagonist. In some aspects, the disclosure relates to methods of treating a tumor in a patient comprising administering to a patient in need thereof an effective amount of a TGFP antagonist. In some aspects, the disclosure relates to use of a TGFp antagonist for treating cancer or a tumor in a patient in need thereof. In some embodiments, the method inhibits growth of a cancer. In some embodiments, the method inhibits growth of a tumor. In some embodiments, the method decreases cancer cell burden in the patient. In some embodiments, the method decreases tumor cell burden in the patient. In some embodiments, the method treats or prevents cancer metastasis.
- the method treats or prevents tumor metastasis.
- the cancer promotes immunosuppression in the patient.
- the tumor promotes immunosuppression in the patient.
- the cancer promotes immune cell exhaustion in the patient.
- the tumor promotes immune cell exhaustion in the patient.
- the cancer promotes T cell exhaustion.
- the tumor promotes T cell exhaustion.
- the cancer is responsive to
- the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of:
- leukemia melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic
- the patient is at risk for developing immune exhaustion.
- the patient has a disease or condition associated with immune exhaustion.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death-ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- the patient does not have an PD death-ligand 1 (PD-L1) binding agent
- the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of treating immune exhaustion in a patient comprising administering to a patient in need thereof an effective amount of a TGFp antagonist. In some aspects, the disclosure relates to methods of preventing immune exhaustion in a patient comprising administering to a patient in need thereof an effective amount of a TGFp antagonist. In some embodiments, the disclosure relates to use of a TGFp antagonist for treating or preventing immune exhaustion in a patient in need thereof.
- the patient has a cancer. In some embodiments, the patient has a tumor. In some embodiments, the method inhibits growth of a cancer. In some embodiments, the method inhibits growth of a tumor. In some embodiments, the method decreases cancer cell burden in the patient.
- the method decreases tumor cell burden in the patient. In some embodiments, the method treats or prevents cancer metastasis. In some embodiments, the method treats or prevents tumor metastasis. In some embodiments, the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia e.g., metastatic melanoma
- lung cancer e.g., squamous non-
- the patient is infected with a pathogen.
- the method treats infection by a pathogen in the patient.
- the method prevents infection by a pathogen in the patient.
- the pathogen promotes immunosuppression in the patient.
- the pathogen promotes immune cell exhaustion in the patient.
- the pathogen promotes T cell exhaustion.
- the pathogen is responsive to immunotherapy.
- the pathogen is selected from the group consisting of: a bacterial, viral, fungal, or parasitic pathogen.
- immune exhaustion comprises a T cell immune exhaustion.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor. In some embodiments, the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen. In some embodiments, the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune- oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death- ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death- ligand 1
- a CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic T-lymphocyte antigen 4
- PD-1) binding agent e
- the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to methods of inducing an immune response against an antigen in a patient comprising administering to a patient in need thereof a TGFP antagonist and the antigen wherein the TGFP antagonist and the antigen are administered in an effective amount.
- the disclosure relates to methods of potentiating an immune response against an antigen in a patient comprising administering to a patient in need thereof a TGFp antagonist and the antigen wherein the TGFp antagonist and the antigen are administered in an effective amount.
- the disclosure relates to use of a TGFp antagonist for inducing or potentiating an immune response against an antigen in a patient in need thereof.
- the antigen is a cancer antigen.
- the antigen is a tumor antigen.
- the cancer or tumor antigen is associated with a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia melanoma
- lung cancer e.
- the antigen is a pathogen antigen.
- the pathogen antigen is associated with a pathogen selected from the group consisting of: a bacterial pathogen, a viral pathogen, a fungal pathogen, or a parasite pathogen.
- the cancer antigen is administered in accordance with a vaccination protocol.
- the tumor antigen is administered in accordance with a vaccination protocol.
- the pathogen antigen is administered in accordance with a vaccination protocol.
- the initiated or potentiated immune response vaccinates the patient against a cancer.
- the initiated or potentiated immune response vaccinates the patient against a tumor.
- the initiated or potentiated immune response vaccinates the patient against a pathogen.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune- oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death- ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death- ligand 1
- a CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic T-lymphocyte antigen 4
- PD-1) binding agent e
- the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to
- the tumor is responsive to immunotherapy.
- the pathogen promotes immunosuppression in the patient.
- the pathogen promotes immune cell exhaustion in the patient.
- the pathogen promotes T cell exhaustion.
- the pathogen is responsive to immunotherapy.
- the patient has a disease or condition associated with immune exhaustion.
- the patient does not have an autoimmune disease.
- the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation.
- the patient does not have graft vs. host disease.
- the disclosure relate to methods of vaccinating a patient against cancer comprising administering to a patient in need thereof a TGFP antagonist and cancer antigen wherein the TGFP antagonist and the antigen are administered in an amount effective to vaccinate the patient.
- the disclosure relate to methods of vaccinating a patient against a pathogen comprising administering to a patient in need thereof a TGFP antagonist and a pathogen antigen wherein the TGFp antagonist and the antigen are administered in an amount effective to vaccinate the patient.
- the disclosure relates to use of a TGFP antagonist in combination with a pathogen or cancer antigen for vaccinating a patient a pathogen or cancer.
- the cancer or tumor antigen is associated with a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g., metastatic sarcoma).
- leukemia melanoma
- lung cancer e.g., squamous non-small cell
- the pathogen antigen is associated with a pathogen selected from the group consisting of: a bacterial pathogen, a viral pathogen, a fungal pathogen, or a parasite pathogen.
- the cancer antigen is administered in accordance with a vaccination protocol.
- the tumor antigen is administered in accordance with a vaccination protocol.
- the pathogen antigen is administered in accordance with a vaccination protocol.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune-oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death-ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death-ligand 1
- PD-L1 antibody e.g., a PD-L1 antibody
- CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic
- the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion. In some embodiments, the tumor promotes T cell exhaustion. In some embodiments, the cancer is responsive to immunotherapy. In some embodiments, the tumor is responsive to immunotherapy. In some embodiments, the pathogen promotes
- the pathogen promotes immune cell exhaustion in the patient. In some embodiments, the pathogen promotes T cell exhaustion. In some embodiments, the pathogen is responsive to immunotherapy. In some embodiments, the patient has a disease or condition associated with immune exhaustion. In some embodiments, the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease.
- the disclosure relates to potentiating an immune response induced by a vaccine in a patient comprising administering a TGFP antagonist to a patient in an amount effective to potentiate an immune response induced by the vaccine in the patient.
- the disclosure relates to use of a TGFp antagonist for potentiating an immune response induced by a vaccine in a patient in need thereof.
- the vaccine is a cancer vaccine.
- the vaccine is a tumor vaccine.
- the initiated or potentiated immune response inhibits growth of a cancer.
- the initiated or potentiated immune response inhibits growth of a tumor.
- the initiated or potentiated immune response decreases cancer cell burden in the patient. In some embodiments, the initiated or potentiated immune response decreases tumor cell burden in the patient. In some embodiments, the initiated or potentiated immune response treats or prevents cancer metastasis. In some embodiments, the initiated or potentiated immune response treats or prevents tumor metastasis. In some embodiments, the cancer promotes immunosuppression in the patient. In some embodiments, the tumor promotes immunosuppression in the patient. In some embodiments, the cancer promotes immune cell exhaustion in the patient. In some embodiments, the tumor promotes immune cell exhaustion in the patient. In some embodiments, the cancer promotes T cell exhaustion.
- the tumor promotes T cell exhaustion.
- the cancer is responsive to immunotherapy.
- the tumor is responsive to immunotherapy.
- the patient has a cancer or tumor selected from the group consisting of: leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer), renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme, and sarcoma (e.g
- the vaccine is a pathogen vaccine.
- the initiated or potentiated immune response treats infection by a pathogen in the patient.
- the initiated or potentiated immune response prevents infection by a pathogen in the patient.
- the pathogen promotes immunosuppression in the patient.
- the pathogen promotes immune cell exhaustion in the patient.
- the pathogen promotes T cell exhaustion.
- the pathogen is responsive to immunotherapy.
- the pathogen is selected from the group consisting of: a bacterial, viral, fungal, or parasitic pathogen.
- the patient is at risk for developing immune exhaustion.
- the patient has a disease or condition associated with immune exhaustion.
- the initiated or potentiated immune response comprises a T cell immune response.
- the initiated or potentiated immune response vaccinates the patient against a cancer or pathogen.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a cancer or tumor.
- the patient is further administered one or more additional active agents and/or supportive therapies for treating a pathogen.
- the patient is further administered one or more additional immuno-oncology agents.
- the one or more additional immune- oncology agents is selected from the group consisting of: alemtuzumab, ipilimumab, nivolumab, ofatmumab, rituximab, pembrolizumab, atexolizumab, a programmed death- ligand 1 (PD-L1) binding agent (e.g., a PD-L1 antibody), a CD20-directed cytolytic binding agent (e.g., a CD-20 antibody), a cytotoxic T-lymphocyte antigen 4 (CTLA-4) binding agent (e.g., a CTLA-4 antibody), and a programmed death receptor-1 (PD-1) binding agent (e.g., a PD-1 antibody).
- PD-L1 programmed death- ligand 1
- a CD20-directed cytolytic binding agent e.g., a CD-20 antibody
- CTLA-4 cytotoxic T-lymphocyte antigen 4
- PD-1) binding agent e
- the patient does not have an autoimmune disease. In some embodiments, the patient is not undergoing a tissue or organ transplantation or has not received a tissue or organ transplantation. In some embodiments, the patient does not have graft vs. host disease. In some embodiments, ActRII antagonists of the disclosure are agents that can inhibit
- ActRII e.g., an ActRIIA and/or ActRIIB receptor
- ALK4 particularly inhibiting downstream signaling.
- ActRII antagonists of the disclosure are agents that can inhibit one or more ActRII and/ALK4-binding ligands [e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- ActRII antagonists of the disclosure are agents that can inhibit one or more intracellular mediators of the ActRII and/or ALK4 signaling pathway (e.g., Smads 2 and 3).
- ActRII antagonist agents include, for example, ActRII (ActRIIA or ActRIIB) polypeptides, or combination of ActRII polypeptides, as well as variants thereof (e.g., a GDF trap polypeptide); an antibody, or combination of antibodies, that inhibit one or more ActRII ligands, ALK4 receptor, and/or ActRII receptor; a polynucleotide, or combination of polynucleotides, that inhibits of one or more ActRII ligands, ALK4, ActRII receptor, and/or ActRII and/or ALK4 downstream signaling component (e.g., Smads); a small molecule, or combination of small molecules, that inhibits of one or more ActRII ligands, ALK4, ActRII receptor, and/or ActRII and/or ALK4 downstream signaling component (e.g., Smads), as well as combinations thereof.
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least GDF11. Effects on GDF11 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, a GDF11 antagonist, or combination of antagonist, of the disclosure may bind to at least GDF11. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least GDF11 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least GDF8. Effects on GDF8 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay).
- a GDF8 antagonist, or combination of antagonist, of the disclosure may bind to at least GDF8.
- Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least GDF8 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least activin (e.g. activin A, activin B, activin C, activin E, activin AB, and activin AE). Effects on activin inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, an activin antagonist, or combination of antagonist, of the disclosure may bind to at least activin. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least activin A, activin B, activin AB, activin C, and/or activin E with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least activin A with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least BMP6. Effects on BMP6 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay).
- a BMP6 antagonist, or combination of antagonist, of the disclosure may bind to at least BMP6.
- Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least BMP6 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least GDF3. Effects on GDF3 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, a GDF3 antagonist, or combination of antagonist, of the disclosure may bind to at least GDF3. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least GDF3 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least BMP9. Effects on BMP9 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, a BMP9 antagonist, or combination of antagonist, of the disclosure may bind to at least BMP9. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least BMP9 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least BMP10. Effects on BMP10 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, a BMP 10 antagonist, or combination of antagonist, of the disclosure may bind to at least BMP 10. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least BMP 10 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ActRIIA. Effects on ActRIIA inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay).
- an ActRII antagonist, or combination of antagonist, of the disclosure may bind to at least ActRIIA.
- Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least ActRIIA with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist that binds to and/or inhibits ActRIIA may further bind to and/or inhibit ActRIIB.
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ActRIIB. Effects on ActRIIB inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, an ActRII antagonist, or combination of antagonist, of the disclosure may bind to at least ActRIIB. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least ActRIIB with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- an ActRII antagonist that binds to and/or inhibits ActRIIB may further bind to and/or inhibit ActRIIA.
- an ActRII antagonist, or combination of antagonists, to be used in accordance with methods and uses described herein is an agent that inhibits at least ALK4. Effects on ALK4 inhibition may be determined, for example, using a cell-based assay including those described herein (e.g., Smad signaling reporter assay). Therefore, in some embodiments, an ActRII antagonist, or combination of antagonist, of the disclosure may bind to at least ALK4. Ligand binding activity may be determined, for example, using a binding affinity assay including, for example, those described herein.
- an ActRII antagonist, or combination of antagonists, of the disclosure binds to at least ALK4 with a K D of at least 1 x 10 "7 M (e.g., at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, or at least 1 x 10 "12 M).
- the disclosure relates to compositions comprising an ActRII polypeptide and uses thereof.
- the term "ActRII polypeptide” collectively refers to naturally occurring ActRIIA and ActRIIB polypeptides as well as truncations and variants thereof such as those described herein (e.g., GDF trap polypeptides).
- ActRII polypeptides comprise, consist essentially of, or consist of a ligand-binding domain of an ActRII polypeptide or modified (variant) form thereof.
- an ActRIIA polypeptide comprises an ActRIIA ligand-binding domain of an ActRIIA
- an ActRIIB polypeptide may comprise of an ActRIIB ligand-binding domain of an ActRIIB polypeptide, for example, a portion of the ActRIIB extracellular domain.
- ActRII polypeptides to be used in accordance with the methods described herein are soluble polypeptides.
- an ActRIIA polypeptide of the disclosure comprises an amino acid sequence that is at least 70%, 75%,
- an ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 9.
- an ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 10.
- an ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11.
- an ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11.
- an ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%,
- ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 50.
- an ActRIIA polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 54.
- an ActRIIA polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 57.
- the disclosure relates an ActRIIB polypeptide, compositions comprising the same, and uses thereof.
- an ActRIIB polypeptide of the disclosure comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 29-109 of SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 29-109 of SEQ ID NO: 1, wherein the ActRIIB polypeptide does not comprise an acidic amino acid [naturally occurring (E or D) or artificial acidic amino acid] at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 25-131 of SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 25-131 of SEQ ID NO: 1, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 1, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 2, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 3.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 3, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 4.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 4, wherein the ActRIIB
- an ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 4.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%), or 100%) identical to the amino acid sequence of SEQ ID NO: 5.
- an ActRIIB polypeptide may comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 5, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 4.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 6.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 6, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 4.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 58.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 58, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%), or 100%) identical to the amino acid sequence of SEQ ID NO: 60.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 60, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 63.
- an ActRIIB polypeptide comprises of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 63, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 64.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 64, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 65.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 65, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 66.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 66, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 68.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 68, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 69.
- an ActRIIB polypeptide may comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 69, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 70.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 70, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 123.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 123, wherein the ActRIIB polypeptide does not comprise an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 131.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 131, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 132.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 132, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 133.
- an ActRIIB polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 133, wherein the ActRIIB polypeptide comprises an acidic amino acid at position 79 with respect to SEQ ID NO: 1.
- compositions comprising a GDF trap polypeptide and uses thereof.
- a GDF trap comprises of an altered
- ActRII ligand-binding domain has a ratio of K d for activin A binding to K d for GDF1 1 and/or GDF 8 binding that is at least 2-, 5-, 10-, 20, 50-, 100-, or even 1000-fold greater relative to the ratio for the wild-type ligand-binding domain.
- the GDF trap comprising an altered ligand-binding domain has a ratio of IC 50 for inhibiting activin A to IC 50 for inhibiting GDF 1 1 and/or GDF 8 that is at least 2-, 5-, 10-, 20-, 25- 50-, 100-, or even 1000-fold greater relative to the wild-type ActRII ligand-binding domain.
- the GDF trap comprising an altered ligand-binding domain inhibits GDF 1 1 and/or GDF8 with an IC 50 at least 2, 5, 10, 20, 50, or even 100 times less than the IC 50 for inhibiting activin A.
- These GDF traps can be fusion proteins that include an immunoglobulin Fc domain (either wild-type or mutant).
- the subject soluble GDF traps are antagonists (inhibitors) of GDF8 and/or GDF 1 1 -mediated intracellular signaling (e.g., Smad 2/3 signaling).
- the disclosure provides GDF traps which are soluble ActRIIB polypeptides comprising an altered ligand-binding (e.g., GDF 1 1 -binding) domain.
- GDF traps with altered ligand-binding domains may comprise, for example, one or more mutations at amino acid residues such as E37, E39, R40, K55, R56, Y60, A64, K74, W78, L79, D80, F82 and F101 of human ActRIIB (numbering is relative to SEQ ID NO: 1).
- the altered ligand-binding domain can have increased selectivity for a ligand such as
- GDF8/GDF1 1 relative to a wild-type ligand-binding domain of an ActRIIB receptor.
- these mutations are demonstrated herein to increase the selectivity of the altered ligand-binding domain for GDF1 1 (and therefore, presumably, GDF8) over activin: K74Y, K74F, K74I, L79D, L79E, and D80I.
- the following mutations have the reverse effect, increasing the ratio of activin binding over GDF1 1 : D54A, K55A, L79A and F82A.
- the overall (GDF1 1 and activin) binding activity can be increased by inclusion of the "tail" region or, presumably, an unstructured linker region, and also by use of a K74A mutation.
- a GDF trap is an ActRIIB polypeptide comprising an L79D or L79E mutation, optionally in combination with additional amino acid substitutions, additions, or deletions.
- TGFp antagonists of the disclosure are agents that can inhibit
- TGFpRII TGFpRII, ALK5, and/or betaglycan, particularly inhibiting downstream signaling.
- TGFp antagonists of the disclosure are agents that can inhibit one or more TGFpRII, ALK5, and/or betaglycan-binding ligands [e.g., TGFpi, TGFP2 and/or TGFP3].
- TGFp antagonists of the disclosure are agents that can inhibit one or more intracellular mediators of the TGFP and/or ALK5 signaling pathway (e.g., Smads).
- TGFp antagonist agents include, for example, TGFpRII polypeptides as well as variants thereof; an antibody, or combination of antibodies, that inhibit one or more TGFP ligands, ALK5 receptor, betaglycan, and/or TGFpRII receptor; a polynucleotide, or combination of polynucleotides, that inhibits of one or more TGFP ligands, ALK5, betaglycan, TGFpRII receptor, and/or TGFpRII and/or ALK5 downstream signaling component (e.g., Smads); a small molecule, or combination of small molecules, that inhibits of one or more TGFP ligands, ALK5, betaglycan, TGFpRII receptor, and/or
- TGFpRII and/or ALK5 downstream signaling component e.g., Smads
- TGFP antagonists bind to and/or inhibit TGFpi .
- TGFP antagonists bind to and/or inhibit TGFP2.
- TGFP antagonists bind to and/or inhibit TGFP3.
- TGFP antagonists bind to and/or inhibit TGFpi and TGFP3.
- TGFP antagonists bind to and/or inhibit TGFpi and TGFP2.
- TGFP antagonists bind to and/or inhibit TGFP2 and TGFP3.
- TGFP antagonists bind to and/or inhibit TGFpi, TGFP2 and TGFP3.
- a TGFpRII polypeptide of the disclosure comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 34.
- a TGFpRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 10.
- a TGFpRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 35.
- a TGFpRII polypeptide comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 148.
- a TGFpRII polypeptide comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 150.
- an agent to be used in accordance with the methods and uses described herein is both an ActRII and TGFp antagonist (ActRILTGFp).
- An ActRILTGFp antagonist is an agent that can inhibit one or more of ActRIIA, ActRIIB, ALK4, ActRII- and ALK4-binding ligands [e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9], and downstream signaling mediators (e.g., Smads) as well as inhibit one or more of TGFpRII; ALK5; betaglycan; TGFpRII-, ALK5-, and betaglycan-binding ligands [e.g., TGFpi, TGFP2 and/or TGFP3], and downstream signaling mediators (e.g., Smads).
- ActRILTGFp antagonist is an agent that can inhibit one or more
- an ActRILTGFp antagonist may be a bi-specific antibody that binds to and inhibits both activin A and TGFP2.
- an ActRILTGFp antagonist may be a polynucleotide or small molecule that inhibits one or more Smads, particularly Smads 2 and 3.
- ActRII polypeptides, TGFpRII polypeptides and variants thereof be homomultimers, for example, homodimer, homotrimers, homotetramers, homopentamers, and higher order homomultimer complexes.
- ActRII polypeptides and TGFpRII polypeptides are homodimers.
- ActRII polypeptide and TGFpRII polypeptides dimers described herein comprise an first ActRII or TGFpRII polypeptide covalently, or non-covalently, associated with an second ActRII or
- TGFpRII polypeptide wherein the first polypeptide comprises an ActRII domain or TGFpRII domain and an amino acid sequence of a first member (or second member) of an interaction pair (e.g., a constant domain of an immunoglobulin) and the second polypeptide comprises an ActRII polypeptide or TGFpRII polypeptide and an amino acid sequence of a second member (or first member) of the interaction pair.
- first polypeptide comprises an ActRII domain or TGFpRII domain and an amino acid sequence of a first member (or second member) of an interaction pair (e.g., a constant domain of an immunoglobulin)
- the second polypeptide comprises an ActRII polypeptide or TGFpRII polypeptide and an amino acid sequence of a second member (or first member) of the interaction pair.
- ActRII polypeptides and TGFpRII polypeptides may be fusion proteins.
- an ActRII polypeptide of TGFpRII polypeptide may be a fusion protein comprising an ActRII polypeptide domain or TGFpRII polypeptide domain and one or more heterologous (non- ActRII or non- TGFpRII) polypeptide domains.
- an ActRII polypeptide of TGFpRII polypeptide may be a fusion protein that has, as one domain, an amino acid sequence derived from an ActRII polypeptide or TGFpRII polypeptide (e.g., a ligand-binding domain of an ActRII receptor, TGFpRII receptor or a variant thereof) and one or more heterologous domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- an amino acid sequence derived from an ActRII polypeptide or TGFpRII polypeptide e.g., a ligand-binding domain of an ActRII receptor, TGFpRII receptor or a variant thereof
- heterologous domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- an ActRII polypeptide domain of TGFpRII polypeptide domain of a fusion protein is connected directly (fused) to one or more heterologous polypeptide domains, or an intervening sequence, such as a linker, may be positioned between the amino acid sequence of the ActRII polypeptide of TGFpRII polypeptide and the amino acid sequence of the one or more heterologous domains.
- an ActRII or TGFpRII fusion protein comprises a relatively
- the linker may correspond to the roughly 4-15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIA or ActRIIB (the "tail"), or it may be an artificial sequence of between 3 and 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure.
- a linker may be rich in glycine and proline residues and may, for example, contain repeating sequences of threonine/serine and glycines.
- linkers include, but are not limited to, the sequences TGGG (SEQ ID NO: 31), SGGG (SEQ ID NO: 32), TGGGG (SEQ ID NO: 29), SGGGG (SEQ ID NO: 30), GGGGS (SEQ ID NO: 33), GGGG (SEQ ID NO: 28), and GGG (SEQ ID NO: 27).
- ActRII or TGFpRII fusion proteins may comprise a constant domain of an immunoglobulin, including, for example, the Fc portion of an immunoglobulin.
- an amino acid sequence that is derived from an Fc domain of an IgG (IgGl, IgG2, IgG3, or IgG4), IgA (IgAl or IgA2), IgE, or IgM immunoglobulin.
- am Fc portion of an immunoglobulin domain may comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 22-26.
- an ActRII of TGFpRII fusion protein comprises an amino acid sequence as set forth in the formula A-B-C.
- the B portion is an Island C-terminally truncated ActRII polypeptide or TGFpRII polypeptide as described herein.
- the A and C portions may be independently zero, one, or more than one amino acids, and both A and C portions are heterologous to B.
- the A and/or C portions may be attached to the B portion via a linker sequence.
- an ActRII of TGFpRII fusion protein comprises a leader sequence.
- the leader sequence may be a native ActRII or TGFpRII leader sequence (e.g., a native ActRIIA, ActRIIB, or TGFpRII leader sequence) or a heterologous leader sequence.
- the leader sequence is a tissue plasminogen activator (TP A) leader sequence.
- an ALK4:ActRIIB heterodimer protein complex has a different ligand-binding profile/selectivity compared to corresponding ActRIIB and ALK4 homodimers.
- ALK4:ActRIIB heterodimer displays enhanced binding to activin B compared to either homodimer, retains strong binding to activin A, GDF8, and GDF l 1 as observed with ActRIIB homodimer, and exhibits substantially reduced binding to BMP9, BMP10, and GDF3.
- BMP9 displays low to no observable affinity for ALK4: ActRIIB heterodimer, whereas this ligand binds strongly to ActRIIB homodimer.
- ALK4 ActRIIB heterodimer retains intermediate-level binding to BMP6. See Figure 19. These results therefore demonstrate that ALK4: ActRIIB heterodimers are a more selective antagonists (inhibitors) of activin A, activin B, GDF8, and GDF l 1 compared to ActRIIB homodimers. Accordingly, an ALK4: ActRIIB heterodimer will be more useful than an ActRIIB homodimer in certain applications where such selective antagonism is advantageous.
- Examples include therapeutic applications where it is desirable to retain antagonism of one or more of activin (e.g., activin A, activin B, activin AB, activin AC), GDF8, and GDF l 1 but minimize antagonism of one or more of BMP9, BMP10, and GDF3.
- activin e.g., activin A, activin B, activin AB, activin AC
- GDF8 and GDF l 1
- an ALK4:ActRIIB heterodimer has been shown treat cancer in patient. Accordingly the present disclosure relates, in part, to
- heteromultimers comprising at least one ALK4 polypeptide and at least one ActRIIB polypeptide (ALK4:ActRIIB heteromultimers) as well as uses thereof.
- ALK4 polypeptides comprise a ligand-binding domain of an ALK4 receptor, for example, a portion of the ALK4 extracellular domain.
- ActRIIB polypeptides generally comprise a ligand-binding domain of an ActRIIB receptor, for example, a portion of the ActRIIB extracellular domain.
- such ALK4 and ActRIIB polypeptides, as well as resultant heteromultimers thereof are soluble.
- an ALK4:ActRIIB heteromultimer comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 34-101 of SEQ ID NO: 14.
- ALK4:ActRIIB heteromultimers comprises an ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 15.
- ALK4:ActRIIB heteromultimers comprises an ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 19.
- ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 19.
- ALK4:ActRIIB heteromultimers comprises an ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 143.
- ALK4: ActRIIB heteromultimers comprise an ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 145.
- ALK4: ActRIIB heteromultimers comprise an ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 79.
- ALK4:ActRIIB heteromultimers comprises an ALK4 amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 80.
- an ALK4: ActRIIB heteromul timer comprises an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1.
- ALK4: ActRIIB heteromultimers comprises an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2.
- ALK4:ActRIIB heteromultimers comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 3.
- ALK4:ActRIIB heteromultimers comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 5.
- ALK4: ActRIIB heteromultimers comprises an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 6.
- ALK4: ActRIIB heteromultimers comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 58.
- ALK4:ActRIIB heteromultimers comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 60.
- ALK4:ActRIIB heteromultimers comprises an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 63.
- ALK4:ActRIIB heteromultimers comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 139.
- ALK4:ActRIIB heteromultimers comprises an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 141
- ALK4:ActRIIB heteromultimers comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 77
- ALK4: ActRIIB heteromultimers may comprise an ActRIIB amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 95%, 95%, 95%, 92%
- ALK4 ActRIIB heteromul timer structures include, for example, heterodimers, heterotrimers, heterotetramers, heteropentamers, and higher order
- ALK4 ActRIIB heteromultimers are heterodimers.
- ALK4 and/or ActRIIB polypeptides may be fusion proteins.
- ALK4 and/or ActRIIB polypeptides generated as fusion proteins similar as described above for ActRII and TGFpRII fusion proteins described herein.
- an ActRII, TGFpRII, and/or ALK4 polypeptide may comprise a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- an ActRII, TGFpRII, and/or ALK4 polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- ActRII, TGFpRII, and/or ALK4 polypeptides may comprise at least one N-linked sugar, and may include two, three or more N-linked sugars. Such polypeptides may also comprise O-linked sugars.
- ActRII, TGFpRII, and/or ALK4 polypeptides may be produced in a variety of cell lines that glycosylate the protein in a manner that is suitable for patient use, including engineered insect or yeast cells, and mammalian cells such as COS cells, CHO cells, HEK cells and NSO cells.
- an ActRII, TGFpRII, and/or ALK4 polypeptide is glycosylated and has a glycosylation pattern obtainable from a Chinese hamster ovary cell line.
- ActRII, TGFpRII, and/or ALK4 polypeptides of the disclosure exhibit a serum half-life of at least 4, 6, 12, 24, 36, 48, or 72 hours in a mammal (e.g., a mouse or a human).
- ActRII, TGFpRII, and/or ALK4 polypeptides may exhibit a serum half-life of at least 6, 8, 10, 12, 14, 20, 25, or 30 days in a mammal (e.g., a mouse or a human).
- the disclosure provides pharmaceutical preparations comprising one or more ActRII antagonist and/or TGFp antagonist and a pharmaceutically acceptable carrier.
- a pharmaceutical preparation may also comprise one or more additional active agents such as a compound that is used to treat or prevent a disorder or condition as described herein [e.g., leukemia, melanoma (e.g., metastatic melanoma), lung cancer (e.g., squamous non-small cell lung cancer, renal cell carcinoma, bladder cancer, mesothelioma (e.g., metastatic mesothelioma), head and neck cancer (e.g., head and neck squamous cell cancer), esophageal cancer, gastric cancer, colorectal cancer (e.g., colorectal carcinoma), liver cancer (e.g., hepatocellular carcinoma), lymphoma, multiple myeloma, myelodysplastic syndrome, breast cancer, ovarian cancer, cervical cancer, glioblastoma multiforme
- a pharmaceutical preparation will preferably be pyrogen-free (meaning pyrogen free to the extent required by regulations governing the quality of products for therapeutic use).
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a disorder/condition described herein.
- additional compounds such as a compound that is used to treat a disorder/condition described herein.
- ALK4:ActRIIB heteromultimer pharmaceutical preparations are substantial free of ALK4 and/or ActRIIB homomultimers.
- ALK4:ActRIIB heteromultimer pharmaceutical preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%), 4%), 3%), 2%), or less than about 1% ALK4 homomultimers.
- ALK4:ActRIIB heteromultimer pharmaceutical preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%), 4%), 3%), 2%), or less than about 1% ALK4 homomultimers.
- ALK4:ActRIIB heteromultimer pharmaceutical preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ActRIIB homomultimers. In some embodiments, ALK4:ActRIIB heteromultimer pharmaceutical preparations comprise less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% ALK4 and ActRIIB homomultimers.
- a TGFp antagonist of the disclosure is an antibody or combination of antibodies.
- the TGFP antagonist antibody binds to TGFpi .
- the TGFP antagonist antibody binds to TGFP2.
- the TGFP antagonist antibody binds to TGFP3.
- the TGFP antagonist is a multi-specific antibody.
- the TGFp antagonist is a bi-specific antibody.
- the TGFP antagonist antibody binds to TGFpi and TGFP2.
- the TGFP antagonist antibody binds to TGFpi and TGFP3.
- the TGFP antagonist antibody binds to TGFpi and TGFP2.
- the TGFP antagonist antibody binds to TGFP2 and TGFP3. In some embodiments, the TGFP antagonist antibody binds to TGFpi, TGFP2, and TGFP3. In some embodiments, the TGFP antagonist antibody is fresolimumab. In some embodiments, the TGFP antagonist antibody binds to TGFpRII. In some embodiments, at TGFP antagonist antibody that binds to TGFpRII further binds to one or more of TGFP 1, TGFP2, TGFP3, ALK5, and betaglycan. In some embodiments, the TGFP antagonist antibody binds to ALK5.
- TGFP antagonist antibody that binds to ALK5 further binds to one or more of TGFpi, TGFP2, TGFP3, TGFpRII, and betaglycan. In some embodiments, the TGFp antagonist antibody binds to betaglycan. In some embodiments, at TGFp antagonist antibody that binds to betaglycan further binds to one or more of TGFP 1 , TGFP2, TGFP3, TGFpRII, and ALK5. In some embodiments, a TGFP antagonist antibody of the disclosure is also an ActRII antagonist antibody, particularly in the case of multi-specific antibodies, for example, bi-specific antibodies.
- multispecific antibody of the disclosure binds to one or more of TGFP 1, TGFP2, TGFP3 and activin. In some embodiments, a multispecific antibody of the disclosure binds to TGFP2 and activin A.
- an ActRII antagonist of the disclosure is an antibody or
- the ActRII antagonist is a multi-specific antibody. In some embodiments, the ActRII antagonist is a bi-specific antibody. In some embodiments, the ActRII antagonist antibody binds to one or more ligands selected from the group consisting of: activin A, activin B, GDF11, GDF8, GDF3, BMP6, BMP10, and BMP9. In some embodiments, the ActRII antagonist antibody binds activin A. In some embodiments, the ActRII antagonist antibody binds activin A.
- the ActRII antagonist antibody binds to ActRIIA. In some embodiments, the ActRII antagonist antibody binds to ActRIIB. In some embodiments, the ActRII antagonist antibody binds to ActRIIA and ActRIIB. In some embodiments, the ActRII antagonist antibody binds to ALK4. In some embodiments, an ActRII antagonist antibody that binds to one or more of activin A, activin B, GDF11, GDF8, GDF3, BMP6, BMP10, and BMP9 further binds to one or more of ActRIIA, ActRIIB, and ALK4.
- a ActRII antagonist antibody of the disclosure is also an TGFP antagonist antibody, particularly in the case of multi-specific antibodies, for example, bi-specific antibodies. Therefore, in some embodiments, an antibody that binds to one or more of ActRIIA, ActRIIB, ALK4, activin A, activin B, GDF11, GDF8, GDF3, BMP6, BMP10, and BMP9 further binds to one or more of TGFpl, TGFp2, TGFp3, TGFpRII, ALK5, and betaglycan.
- ActRIIA with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures, to directly contact ligand indicated with boxes.
- Figure 2 shows a multiple sequence alignment of various vertebrate ActRIIB proteins (SEQ ID NOs: 100-105) and human ActRIIA (SEQ ID NO: 122) as well as a consensus ActRII sequence derived from the alignment (SEQ ID NO: 106).
- Figure 3 shows a multiple sequence alignment of various vertebrate ActRIIA proteins and human ActRIIA (SEQ ID NOs: 107-114).
- Figure 4 shows a multiple sequence alignment of various vertebrate ALK4 proteins and human ALK4 (SEQ ID NOs: 115-121).
- Figure 5 shows the purification of ActRIIA-hFc expressed in CHO cells. The protein purifies as a single, well-defined peak as visualized by sizing column (top panel) and
- Figure 6 shows the binding of ActRIIA-hFc to activin (top panel) and GDF-11 (bottom panel), as measured by BiacoreTM assay.
- Figure 7 shows the full, unprocessed amino acid sequence for ActRIIB(25-131)-hFc (SEQ ID NO: 123).
- the TPA leader (residues 1-22) and double-truncated ActRIIB extracellular domain (residues 24-131, using numbering based on the native sequence in SEQ ID NO: 1) are each underlined.
- Highlighted is the glutamate revealed by sequencing to be the N-terminal amino acid of the mature fusion protein, which is at position 25 relative to SEQ ID NO: 1.
- Figure 8 shows a nucleotide sequence encoding ActRIIB(25-131)-hFc (the coding strand is shown at top, SEQ ID NO: 124, and the complement shown at bottom 3'-5', SEQ ID NO: 125). Sequences encoding the TPA leader (nucleotides 1-66) and ActRIIB extracellular domain (nucleotides 73-396) are underlined. The corresponding amino acid sequence for ActRIIB(25-131) is also shown.
- Figure 9 shows an alternative nucleotide sequence encoding ActRIIB(25-131)-hFc (the coding strand is shown at top, SEQ ID NO: 126, and the complement shown at bottom 3'-5', SEQ ID NO: 127).
- This sequence confers a greater level of protein expression in initial transformants, making cell line development a more rapid process.
- Sequences encoding the TPA leader (nucleotides 1-66) and ActRIIB extracellular domain (nucleotides 73-396) are underlined, and substitutions in the wild type nucleotide sequence of the ECD (see Figure 8) are highlighted.
- the corresponding amino acid sequence for ActRIIB(25-131) is also shown.
- Figure 10 shows the amino acid sequence of native precursor for the B (short) isoform of human TGFp receptor type II (hTpRII) (NP 003233.4; SEQ ID NO: 34).
- Solid underline indicates the mature extracellular domain (ECD) (residues 23-159), and double underline indicates valine that is replaced in the A (long) isoform.
- Dotted underline denotes leader (residues 1-22).
- Figure 11 shows the amino acid sequence of native precursor for the A (long) isoform of human TpRII (NP_001020018.1; SEQ ID NO: 35).
- Solid underline indicates the mature ECD (residues 23-184), and double underline indicates the splice-generated isoleucine substitution.
- Dotted underline denotes leader (residues 1-22).
- Figure 12 shows the full amino acid sequence for the truncated GDF trap
- ActRIIB(L79D 25-13 l)-hFc (SEQ ID NO: 131), including the TPA leader f double underline! truncated ActRIIB extracellular domain (residues 25-131 in SEQ ID NO: l; single underline), and hFc domain.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N- terminal residue in the mature fusion protein.
- Figure 13 shows the amino acid sequence for the truncated GDF trap ActRIIB(L79D
- Figure 15 shows a nucleotide sequence encoding ActRIIB(L79D 25-13 l)-hFc.
- SEQ ID NO: 134 corresponds to the sense strand
- SEQ ID NO: 135 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined, and the truncated ActRIIB extracellular domain (nucleotides 76-396) is single underlined.
- the amino acid sequence for the ActRIIB extracellular domain is also shown.
- Figure 16 shows an alternative nucleotide sequence encoding ActRIIB(L79D 25- 13 l)-hFc.
- SEQ ID NO: 136 corresponds to the sense strand
- SEQ ID NO: 137 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined
- the truncated ActRIIB extracellular domain (nucleotides 76-396) is underlined
- substitutions in the wild-type nucleotide sequence of the extracellular domain are double underlined and highlighted.
- the amino acid sequence for the ActRIIB extracellular domain is also shown.
- Figure 17 shows nucleotides 76-396 (SEQ ID NO: 138) of the alternative nucleotide sequence shown in Figure 16 (SEQ ID NO: 136). The same nucleotide substitutions indicated in Figure 16 are also underlined and highlighted here.
- SEQ ID NO: 138 encodes only the truncated ActRIIB extracellular domain (corresponding to residues 25-131 in SEQ ID NO: 1) with a L79D substitution, e.g., ActRIIB(L79D 25-131).
- Figure 18 shows multiple sequence alignment of Fc domains from human IgG isotypes using Clustal 2.1. Hinge regions are indicated by dotted underline. Double underline indicates examples of positions engineered in IgGl Fc to promote asymmetric chain pairing and the corresponding positions with respect to other isotypes IgG2, IgG3 and IgGl
- Figure 19 shows comparative ligand binding data for an ALK4-Fc:ActRIIB-Fc heterodimeric protein complex compared to ActRIIB-Fc homodimer and ALK4-Fc homodimer.
- ligands are ranked by k 0ff , a kinetic constant that correlates well with ligand signaling inhibition, and listed in descending order of binding affinity (ligands bound most tightly are listed at the top).
- yellow, red, green, and blue lines indicate magnitude of the off-rate constant.
- Solid black lines indicate ligands whose binding to heterodimer is enhanced or unchanged compared with homodimer, whereas dashed red lines indicate substantially reduced binding compared with homodimer.
- the ALK4-Fc: ActRIIB-Fc heterodimer displays enhanced binding to activin B compared with either homodimer, retains strong binding to activin A, GDF8, and GDF11 as observed with ActRIIB-Fc homodimer, and exhibits substantially reduced binding to BMP9, BMP10, and GDF3.
- the heterodimer retains intermediate-level binding to BMP6.
- Figure 20 shows comparative ALK4-Fc: ActRIIB-Fc heterodimer/ ActRIIB- Fc: ActRIIB-Fc homodimer IC 50 data as determined by an A-204 Reporter Gene Assay as described herein.
- ALK4-Fc: ActRIIB-Fc heterodimer inhibits activin A, activin B, GDF8, and GDF11 signaling pathways similarly to the ActRIIB-Fc:ActRIIB-Fc homodimer.
- ALK4-Fc:ActRIIB-Fc heterodimer inhibition of BMP9 and BMP10 signaling pathways is significantly reduced compared to the ActRIIB-Fc: ActRIIB-Fc homodimer.
- ALK4:ActRIIB heterodimers are more selective antagonists of activin A, activin B, GDF8, and GDF11 compared to corresponding ActRIIB:ActRIIB homodimers.
- Figures 21A and 21B show two schematic examples of heteromeric protein complexes comprising type I receptor and type II receptor polypeptides.
- Figure 21 A depicts a heterodimeric protein complex comprising one type I receptor fusion polypeptide and one type II receptor fusion polypeptide, which can be assembled covalently or noncovalently via a multimerization domain contained within each polypeptide chain. Two assembled multimerization domains constitute an interaction pair, which can be either guided or unguided.
- Figure 2 IB depicts a heterotetrameric protein complex comprising two
- FIG. 21 A shows a schematic example of a heteromeric protein complex comprising a type I receptor polypeptide (indicated as "I") (e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK4 protein from humans or other species such as those described herein) and a type II receptor polypeptide (indicated as " ⁇ ”) (e.g.
- I type I receptor polypeptide
- ⁇ type II receptor polypeptide
- the type I receptor polypeptide is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci")
- the type II receptor polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ").
- a linker may be positioned between the type I or type II receptor polypeptide and the corresponding member of the interaction pair.
- the first and second members of the interaction pair may be a guided (asymmetric) pair, meaning that the members of the pair associate preferentially with each other rather than self-associate, or the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self-associate without substantial preference and may have the same or different amino acid sequences.
- Traditional Fc fusion proteins and antibodies are examples of unguided interaction pairs, whereas a variety of engineered Fc domains have been designed as guided (asymmetric) interaction pairs [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- Figures 23A-23D show schematic examples of heteromeric protein complexes comprising an ALK4 polypeptide (e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ALK4 protein from humans or other species such as those described herein) and an ActRIIB polypeptide (e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular domain of an ActRIIB protein from humans or other species such as those described herein).
- an ALK4 polypeptide e.g. a polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99% or 100% identical to an extracellular
- the ALK4 polypeptide is part of a fusion polypeptide that comprises a first member of an interaction pair ("Ci")
- the ActRIIB polypeptide is part of a fusion polypeptide that comprises a second member of an interaction pair ("C 2 ").
- Suitable interaction pairs included, for example, heavy chain and/or light chain immunoglobulin interaction pairs, truncations, and variants thereof such as those described herein [e.g., Spiess et al (2015) Molecular Immunology 67(2A): 95-106].
- a linker may be positioned between the ALK4 or ActRIIB polypeptide and the corresponding member of the interaction pair.
- the first and second members of the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self- associate without substantial preference, and they may have the same or different amino acid sequences.
- the interaction pair may be a guided (asymmetric) pair, meaning that the members of the pair associate preferentially with each other rather than self-associate.
- Figure 23B Complexes of higher order can be envisioned.
- Figure 23C and 23D Figure 24 shows N-terminal alignment of hTpRII S hoit truncations and their hTpRIIi ong counte arts.
- the 25-amino-acid insertion present in hTpRIIi ong truncations is underlined. Note that the splicing process causes the valine flanking the insertion site in the short isoform to be replaced by an isoleucine in the long isoform. Boxed sequence denotes leader.
- the TGFP superfamily is comprised of over 30 secreted factors including TGFPs, activins, nodals, bone morphogenetic proteins (BMPs), growth and differentiation factors (GDFs), and anti-Mullerian hormone (AMH) [Weiss et al. (2013) Developmental Biology, 2(1): 47-63].
- BMPs bone morphogenetic proteins
- GDFs growth and differentiation factors
- AH anti-Mullerian hormone
- Ligands of the TGFP superfamily share the same dimeric structure in which the central 3-1/2 turn helix of one monomer packs against the concave surface formed by the beta-strands of the other monomer.
- the majority of TGFP family members are further stabilized by an intermolecular disulfide bond. This disulfide bonds traverses through a ring formed by two other disulfide bonds generating what has been termed a 'cysteine knot' motif [Lin et al. (2006) Reproduction 132: 179-190; and Hinck et al. (2012) FEBS Letters 586: 1860-1870].
- TGFP superfamily signaling is mediated by heteromeric complexes of type I and type II serine/threonine kinase receptors, which phosphorylate and activate downstream SMAD proteins ⁇ e.g., SMAD proteins 1, 2, 3, 5, and 8) upon ligand stimulation [Massague (2000) Nat. Rev. Mol. Cell Biol. 1 : 169-178].
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase specificity.
- type I receptors mediate intracellular signaling while the type II receptors are required for binding TGFP superfamily ligands.
- Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- the TGFP family can be divided into two phylogenetic branches based on the type I receptors they bind and the Smad proteins they activate.
- the other branch comprises the more distantly related proteins of the superfamily and includes, e.g., BMP2, BMP4, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF1, GDF5, GDF6, and GDF7, which signal through Smads 1, 5, and 8.
- TGFP isoforms are the founding members of the TGFP superfamily, of which there are 3 known isoforms in mammals designated as TGFpi, TGFP2, and TGFP3. Mature bioactive TGFP ligands function as homodimers and predominantly signal through the type I receptor ALK5, but have also been found to additionally signal through ALK1 in endothelial cells [Goumans et al.
- TGFpl is the most abundant and ubiquitously expressed isoform. TGFpi is known to have an important role in wound healing, and mice expressing a constitutively active TGFpi transgene develop fibrosis
- TGFpl expression was first described in human glioblastoma cells, and is occurs in neurons and astroglial cells of the embryonic nervous system.
- TGFP3 was initially isolated from a human rhabdomyosarcoma cell line and since has been found in lung adenocarcinoma and kidney carcinoma cell lines. TGFP3 is known to be important for palate and lung morphogenesis [Kubiczkova et al. (2012) Journal of Translational Medicine 10: 183].
- Activins are members of the TGFP superfamily and were initially discovered as regulators of secretion of follicle-stimulating hormone, but subsequently various reproductive and non-reproductive roles have been characterized.
- PAPA, PBPB, and PAPB respectively.
- the human genome also encodes an activin C and an activin E, which are primarily expressed in the liver, and heterodimeric forms containing Pc or p E are also known.
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos [DePaolo et al. (1991) Proc Soc Ep Biol Med. 198:500-512; Dyson et al. (1997) Curr Biol. 7:81-84; and Woodruff (1998) Biochem Pharmacol. 55:953-963]. In several tissues, activin signaling is antagonized by its related heterodimer, inhibin.
- activin promotes FSH synthesis and secretion, while inhibin reduces FSH synthesis and secretion.
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP, also known as FLRG or FSTL3), and a 2 -macroglobulin.
- agents that bind to "activin A” are agents that specifically bind to the PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex (e.g., a PAPA homodimer or a PAPB heterodimer).
- agents that bind to "activin A” are specific for epitopes present within the PA subunit, but do not bind to epitopes present within the non-PA subunit of the complex (e.g., the PB subunit of the complex).
- agents disclosed herein that antagonize (inhibit) "activin A” are agents that inhibit one or more activities as mediated by a PA subunit, whether in the context of an isolated PA subunit or as a dimeric complex (e.g., a PAPA homodimer or a PAPB heterodimer).
- agents that inhibit "activin A” are agents that specifically inhibit one or more activities of the PA subunit, but do not inhibit the activity of the non-p A subunit of the complex (e.g., the p B subunit of the complex).
- This principle applies also to agents that bind to and/or inhibit "activin B", “activin C", and "activin E”.
- Agents disclosed herein that antagonize "activin AB” are agents that inhibit one or more activities as mediated by the PA subunit and one or more activities as mediated by the PB subunit.
- the BMPs and GDFs together form a family of cysteine-knot cytokines sharing the characteristic fold of the TGFp superfamily [Rider et al. (2010) Biochem J., 429(1): 1-12].
- This family includes, for example, BMP2, BMP4, BMP6, BMP7, BMP2a, BMP3, BMP3b (also known as GDF10), BMP4, BMP5, BMP6, BMP7, BMP8, BMP8a, BMP8b, BMP9 (also known as GDF2), BMP10, BMP11 (also known as GDF11), BMP 12 (also known as GDF7), BMP 13 (also known as GDF6), BMP 14 (also known as GDF5), BMP15, GDF1, GDF3 (also known as VGR2), GDF8 (also known as myostatin), GDF9, GDF15, and decapentaplegic.
- BMP/GDFs display morphogenetic activities in the development of a wide range of tissues.
- BMP/GDF homo- and hetero-dimers interact with combinations of type I and type II receptor dimers to produce multiple possible signaling complexes, leading to the activation of one of two competing sets of SMAD transcription factors.
- BMP/GDFs have highly specific and localized functions. These are regulated in a number of ways, including the developmental restriction of BMP/GDF expression and through the secretion of several specific BMP antagonist proteins that bind with high affinity to the cytokines. Curiously, a number of these antagonists resemble TGFP superfamily ligands.
- ActRII antagonists inhibitors
- TGFp antagonists can be used alone or in combination to treat cancer.
- treatment with an ActRIIA polypeptide, an ActRIIB polypeptide, or a pan-specific TGFp antibody separately, decreased tumor burden and increased survival time a cancer model.
- an ActRII antagonist in combination with a TGFP antagonist can be used to synergistically increase antitumor activity compared to the effects observed with either agent alone. While the data indicate that the antitumor effects associated with inhibition of TGFP signaling is due to TGFP2 antagonism, it has been shown herein that an inhibitor of all three isoforms of TGFP (TGFpi, TGFP2, and TGFP3) has antitumor activities.
- TGFP antagonists to be used in accordance with the methods and uses of the disclosure inhibit TGFP2, it is expected that TGFp antagonists that inhibit TGFpi and/or TGFP3 will also be useful in promoting antitumor responses.
- the disclosure provides, in part, methods of using an ActRII antagonist, a TGFp antagonist, or a combination of an ActRII antagonist and a TGFp antagonist, alone or in combination with one or more supportive therapies and/or additional active agents, to treat cancer, particularly treating or preventing one or more complications of a cancer (e.g., reducing tumor burden).
- the data indicate that efficacy of ActRII and TGFp antagonist therapy is dependent on the immune system. Therefore, in part, the instant disclosure relates to the discovery that ActRII and TGFp antagonists may be used as immunotherapeutics, particularly to treat a wide variety of cancers (e.g., cancers associated with immunosuppression and/or immune exhaustion).
- an ActRII and TGFP antagonist may have broader therapeutic implications outside the cancer field.
- immune potentiating agents may be useful in treating a wide variety of infectious diseases, particularly pathogenic agents which promote
- the disclosure provides various ActRII and TGFp antagonists that can be used, alone or in combination, to increase immune responses in a subject in need thereof, treat cancer, treat infectious diseases, and/or increase immunization efficacy, optionally in combination with one or more supportive therapies and/or additional active agents.
- the terms used in this specification generally have their ordinary meanings in the art, within the context of this disclosure and in the specific context where each term is used. Certain terms are discussed below or elsewhere in the specification to provide additional guidance to the practitioner in describing the compositions and methods of the disclosure and how to make and use them. The scope or meaning of any use of a term will be apparent from the specific context in which it is used.
- heteromer or “heteromultimer” as used herein refer to a complex comprising at least a first polypeptide chain and a second polypeptide chain, wherein the second polypeptide chain differs in amino acid sequence from the first polypeptide chain by at least one amino acid residue.
- the heteromer can comprise a "heterodimer” formed by the first and second polypeptide chains or can form higher order structures where one or more polypeptide chains in addition to the first and second polypeptide chains are present.
- heteromultimer examples include heterodimers, heterotrimers, heterotetramers and further oligomeric structures.
- Heterodimers are designated herein as X: Y or equivalently as X-Y, where X represents a first polypeptide chain and Y represents a second polypeptide chain.
- Higher-order heteromers and oligomeric structures are designated herein in a corresponding manner.
- the term “homologous,” when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- Percent (%) sequence identity with respect to a reference polypeptide (or nucleotide) sequence is defined as the percentage of amino acid residues (or nucleic acids) in a candidate sequence that are identical to the amino acid residues (or nucleic acids) in the reference polypeptide (nucleotide) sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
- ALIGN-2 sequence comparison computer program
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U. S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif, or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- Alternize in all its grammatical forms, refers to the process of activating a protein and/or gene (e.g., by activating or amplifying that protein' s gene expression or by inducing an inactive protein to enter an active state) or increasing a protein' s and/or gene' s activity.
- “Antagonize”, in all its grammatical forms, refers to the process of inhibiting a protein and/or gene (e.g., by inhibiting or decreasing that protein' s gene expression or by inducing an active protein to enter an inactive state) or decreasing a protein's and/or gene' s activity.
- the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably ⁇ 5-fold and more preferably ⁇ 2-fold of a given value.
- the disclosure relates ActRII polypeptides and uses thereof (e.g., increasing an immune response in a subject in need thereof and treatment of cancer or pathogens).
- ActRII refers to the family of type II activin receptors. This family includes activin receptor type IIA (ActRIIA) and activin receptor type IIB (ActRIIB).
- the disclosure relates to heteromultimers comprising at least one ActRIIB polypeptide and at least one ALK4 polypeptide, which are generally referred to herein as “ALK4:ActRIIB heteromultimers” or “ALK4:ActRIIB heteromultimer complexes” and uses thereof (e.g., increasing an immune response in a subject in need thereof and treatment of cancer or pathogens).
- ALK4:ActRIIB heteromultimers or “ALK4:ActRIIB heteromultimer complexes” and uses thereof (e.g., increasing an immune response in a subject in need thereof and treatment of cancer or pathogens).
- ActRIIB refers to a family of activin receptor type IIB
- ActRIIB proteins from any species and variants derived from such ActRIIB proteins by mutagenesis or other modification.
- Reference to ActRIIB herein is understood to be a reference to any one of the currently identified forms.
- Members of the ActRIIB family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- the term "ActRIIB polypeptide” includes polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof
- the signal peptide is indicated with a single underline; the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated with a double underline.
- the processed extracellular ActRIIB polypeptide sequence is as follows:
- the protein may be produced with an "SGR" sequence at the N-terminus.
- the C-terminal "tail" of the extracellular domain is indicated by a single underline.
- the sequence with the "tail” deleted is as follows: GRGEAETREC I YYNANWELERTNQSGLERCEGEQDKRLHCYASWRNS SGT IELVKKGCWLDD FNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEA (SEQ ID NO: 3).
- a form of ActRIIB with an alanine at position 64 of SEQ ID NO: 1 (A64) is also reported in the literature. See, e.g., Hilden et al. (1994) Blood, 83(8): 2163-2170. It has been ascertained that an ActRIIB-Fc fusion protein comprising an extracellular domain of ActRIIB with the A64 substitution has a relatively low affinity for activin and GDF11. By contrast, the same ActRIIB-Fc fusion protein with an arginine at position 64 (R64) has an affinity for activin and GDF11 in the low nanomolar to high picomolar range. Therefore, sequences with an R64 are used as the "wild-type" reference sequence for human ActRIIB in this disclosure.
- the form of ActRIIB with an alanine at position 64 is as follows:
- the signal peptide is indicated by single underline and the extracellular domain is indicated by bold font.
- the processed extracellular ActRIIB polypeptide sequence of the alternative A64 form is as follows:
- the protein may be produced with an "SGR" sequence at the N-terminus.
- the C-terminal "tail" of the extracellular domain is indicated by single underline.
- the sequence with the "tail” deleted is as follows: GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTIELVKKGCWLDD FNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEA (SEQ ID NO: 6)
- a nucleic acid sequence encoding the human ActRIIB precursor protein is shown below (SEQ ID NO: 7), representing nucleotides 25-1560 of Genbank Reference Sequence NM OOl 106.3, which encode amino acids 1-513 of the ActRIIB precursor.
- the sequence as shown provides an arginine at position 64 and may be modified to provide an alanine instead.
- the signal sequence is underlined.
- polypeptide is as follows (SEQ ID NO: 8). The sequence as shown provides an arginine at position 64, and may be modified to provide an alanine instead.
- FIG. 1 An alignment of the amino acid sequences of human ActRIIB extracellular domain and human ActRIIA extracellular domain are illustrated in Figure 1. This alignment indicates amino acid residues within both receptors that are believed to directly contact ActRII ligands.
- the composite ActRII structures indicated that the ActRIIB -ligand binding pocket is defined, in part, by residues Y31, N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through F101. At these positions, it is expected that conservative mutations will be tolerated.
- ActRIIB is well-conserved among vertebrates, with large stretches of the extracellular domain completely conserved.
- Figure 2 depicts a multi-sequence alignment of a human ActRIIB extracellular domain compared to various ActRIIB orthologs. Many of the ligands that bind to ActRIIB are also highly conserved. Accordingly, from these alignments, it is possible to predict key amino acid positions within the ligand-binding domain that are important for normal ActRIIB -ligand binding activities as well as to predict amino acid positions that are likely to be tolerant to substitution without significantly altering normal ActRIIB -ligand binding activities. Therefore, an active, human ActRIIB variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate
- ActRIIB may include a residue that is similar to that in the human or other vertebrate sequences. Without meaning to be limiting, the following examples illustrate this approach to defining an active ActRIIB variant.
- L46 in the human extracellular domain (SEQ ID NO: 103) is a valine in Xenopus ActRIIB (SEQ ID NO: 105), and so this position may be altered, and optionally may be altered to another hydrophobic residue, such as V, I or F, or a non- polar residue such as A.
- E52 in the human extracellular domain is a K in Xenopus, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y and probably A.
- T93 in the human extracellular domain is a K in Xenopus, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, K, R, E, D, H, G, P, G and Y.
- F108 in the human extracellular domain is a Y in Xenopus, and therefore Y or other hydrophobic group, such as I, V or L should be tolerated.
- El 11 in the human extracellular domain is K in Xenopus, indicating that charged residues will be tolerated at this position, including D, R, K and H, as well as Q and N.
- Rl 12 in the human extracellular domain is K in Xenopus, indicating that basic residues are tolerated at this position, including R and H.
- a at position 119 in the human extracellular domain is relatively poorly conserved, and appears as P in rodents and V in Xenopus, thus essentially any amino acid should be tolerated at this position.
- ActRII proteins have been characterized in the art in terms of structural and functional characteristics, particularly with respect to ligand binding [Attisano et al. (1992) Cell 68(1):97-108; Greenwald et al. (1999) Nature Structural Biology 6(1): 18-22; Allendorph et al. (2006) PNAS 103(20: 7643-7648; Thompson et al. (2003) The EMBO
- the core ligand-binding domains of human ActRIIB corresponds to positions 29-109 of SEQ ID NO: 1 (ActRIIB precursor).
- the structurally less-ordered amino acids flanking these cysteine-demarcated core sequences can be truncated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 residues at the N-terminus and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 residues a the C-terminus without necessarily altering ligand binding.
- Exemplary ActRIIB extracellular domains for N-terminal and/or C-terminal truncation include SEQ ID NOs: 2, 3, 5, and 6. Attisano et al. showed that a deletion of the proline knot at the C-terminus of the extracellular domain of ActRIIB reduced the affinity of the receptor for activin.
- an ActRIIB(20-129)-Fc protein retains similar, but somewhat reduced activity, relative to the wild-type, even though the proline knot region is disrupted.
- ActRIIB extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 are all expected to be active, but constructs stopping at 134 or 133 may be most active.
- mutations at any of residues 129-134 are not expected to alter ligand-binding affinity by large margins.
- mutations of P129 and P130 do not substantially decrease ligand binding.
- an ActRIIB polypeptide of the present disclosure may end as early as amino acid 109 (the final cysteine), however, forms ending at or between 109 and 119 (e.g., 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, or 119) are expected to have reduced ligand binding.
- Amino acid 119 (with respect to present SEQ ID NO: 1) is poorly conserved and so is readily altered or truncated.
- ActRIIB polypeptides and ActRIIB-based GDF traps ending at 128 (with respect to SEQ ID NO: 1) or later should retain ligand-binding activity.
- ActRIIB polypeptides and ActRIIB-based GDF traps ending at or between 119 and 127 will have an intermediate binding ability. Any of these forms may be desirable to use, depending on the clinical or experimental setting.
- ActRIIB polypeptides and ActRIIB-based GDF traps beginning at position 20, 21, 22, 23, and 24 should retain general ligand-biding activity
- ActRIIB polypeptides and ActRIIB-based GDF traps beginning at positions 25, 26, 27, 28, and 29 are also expected to retain ligand-biding activity. It has been demonstrated, e.g., U.S. Patent No. 7,842,663, that, surprisingly, an ActRIIB construct beginning at 22, 23, 24, or 25 will have the most activity.
- ActRIIB a general formula for an active portion (e.g., ligand-binding portion) of ActRIIB comprises amino acids 29-109 of SEQ ID NO: 1. Therefore ActRIIB
- polypeptides may, for example, comprise, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to any one of amino acids 20-29 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to any one amino acids 109-134 (e.g., ending at any one of amino acids 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) of SEQ ID NO: 1.
- Other examples include
- polypeptides that begin at a position from 20-29 (e.g., any one of positions 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) or 21-29 (e.g., any one of positions 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and end at a position from 1 19-134 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 1 19-133 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, or 133), 129-134 (e.g., any one of positions 129, 130, 131, 132, 133, or 134), or 129-133 (e.g., any one of positions 129, 130, 131, 132, 133, or 133)
- constructs that begin at a position from 20-24 (e.g., any one of positions 20, 21, 22, 23, or 24), 21-24 (e.g., any one of positions 21, 22, 23, or 24), or 22-25 (e.g., any one of positions 22, 22, 23, or 25) of SEQ ID NO: 1 and end at a position from 109-134 (e.g., any one of positions 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134), 1 19-134 (e.g., any one of positions 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) or 129-134 (e.g., any one of positions 129, 130, 131, 132, 133, or 134) of SEQ ID
- Variants within these ranges are also contemplated, particularly those comprising, consisting essentially of, or consisting of an amino acid sequence that has at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the corresponding portion of SEQ ID NO: 1.
- ActRIIB variants comprise no more than 1, 2, 5, 6, 7, 8, 9, 10 or 15
- conservative amino acid changes in the ligand-binding pocket optionally zero, one or more non-conservative alterations at positions 40, 53, 55, 74, 79 and/or 82 in the ligand-binding pocket.
- Sites outside the binding pocket include the amino and carboxy termini of the extracellular domain (as noted above), and positions 42-46 and 65-73 (with respect to SEQ ID NO: 1).
- An asparagine-to- alanine alteration at position 65 (N65 A) does not appear to decrease ligand binding in the
- R64 background [U.S. Patent No. 7,842,663]. This change probably eliminates glycosylation at N65 in the A64 background, thus demonstrating that a significant change in this region is likely to be tolerated. While an R64A change is poorly tolerated, R64K is well -tolerated, and thus another basic residue, such as H may be tolerated at position 64 [U.S. Patent No.
- positions that may be desirable to conserve are as follows: position 52 (acidic amino acid), position 55 (basic amino acid), position 81 (acidic), 98 (polar or charged, particularly E, D, R or K), all with respect to SEQ ID NO: 1. It has been previously demonstrated that the addition of a further N-linked amino acid (acidic amino acid), position 55 (basic amino acid), position 81 (acidic), 98 (polar or charged, particularly E, D, R or K), all with respect to SEQ ID NO: 1. It has been previously demonstrated that the addition of a further N-linked
- N-X-S/T glycosylation site
- N-X-S/T sequences may be generally introduced at positions outside the ligand binding pocket defined, for example, in Figure 1 in ActRIIB polypeptide of the present disclosure.
- Particularly suitable sites for the introduction of non- endogenous N-X-S/T sequences include amino acids 20-29, 20-24, 22-25, 109-134, 120-134 or 129-134 (with respect to SEQ ID NO: 1).
- N-X-S/T sequences may also be introduced into the linker between the ActRIIB sequence and an Fc domain or other fusion component as well as optionally into the fusion component itself.
- Such a site may be introduced with minimal effort by introducing an N in the correct position with respect to a pre-existing S or T, or by introducing an S or T at a position corresponding to a pre-existing N.
- desirable alterations that would create an N-linked glycosylation site are: A24N, R64N, S67N (possibly combined with an N65A alteration), E105N, Rl 12N, G120N, E123N, P129N, A132N, Rl 12S and Rl 12T (with respect to SEQ ID NO: 1).
- Any S that is predicted to be glycosylated may be altered to a T without creating an immunogenic site, because of the protection afforded by the glycosylation.
- any T that is predicted to be glycosylated may be altered to an S.
- S67T and S44T are contemplated.
- S26T alteration may be used.
- an ActRIIB polypeptide of the present disclosure may be a variant having one or more additional, non-endogenous N-linked glycosylation consensus sequences as described above.
- the disclosure relates to ActRII antagonists (inhibitors) that comprise at least one ActRIIB polypeptide, which includes fragments, functional variants, and modified forms thereof as well as uses thereof (e.g., increasing an immune response in a patient in need thereof and treating cancer).
- ActRIIB polypeptides are soluble (e.g., an extracellular domain of ActRIIB).
- ActRIIB polypeptides antagonize activity (e.g., Smad signaling) of one or more TGFP superfamily ligands [e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9]. Therefore, in some embodiments, ActRIIB polypeptides bind to one or more TGFP superfamily ligands [e.g., GDF 1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- TGFP superfamily ligands e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- ActRIIB polypeptides of the disclosure comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIB beginning at a residue corresponding to amino acids 20-29 (e.g., beginning at any one of amino acids 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29) of SEQ ID NO: 1 and ending at a position corresponding to amino acids 109-134 (e.g., ending at any one of amino acids 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 134) of SEQ ID NO: 1.
- ActRIIB polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 29-109 of SEQ ID NO: 1.
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 29-109 of SEQ ID NO: 1, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid (naturally occurring acidic amino acids D and E or an artificial acidic amino acid).
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 25-131 of SEQ ID NO: 1.
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 25-131 of SEQ ID NO: 1, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid.
- ActRIIB polypeptide of disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 58, 59, 60, 63, 64, 65, 66, 68, 69, 70, 73, 77, 78, 128, 131, 132, and 133.
- ActRIIB polypeptide of disclosure comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 58, 59, 60, 63, 64, 65, 66, 68, 69, 70, 73, 77, 78, 128, 131, 132, and 133, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid.
- ActRIIB polypeptides of the disclosure comprise, consist, or consist essentially of, at least one ActRIIB polypeptide wherein the position corresponding to L79 of SEQ ID NO: 1 is not an acidic amino acid (i.e., is not naturally occurring acid amino acids D or E or an artificial acidic amino acid residue).
- ActRIIA refers to a family of activin receptor type IIA (ActRIIA) proteins from any species and variants derived from such ActRIIA proteins by mutagenesis or other modification. Reference to ActRIIA herein is understood to be a reference to any one of the currently identified forms.
- ActRIIA family are generally transmembrane proteins, composed of a ligand-binding extracellular domain comprising a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIA polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIA family member as well as any variants thereof
- the human ActRIIA precursor protein sequence is as follows:
- the signal peptide is indicated by a single underline; the extracellular domain is indicated in bold font; and the potential, endogenous N-linked glycosylation sites are indicated by a double underline.
- a processed extracellular human ActRIIA polypeptide sequence is as follows:
- a nucleic acid sequence encoding human ActRIIA precursor protein is shown below (SEQ ID NO: 12), as follows nucleotides 159-1700 of Genbank Reference Sequence NM_001616.4. The signal sequence is underlined.
- a nucleic acid sequence encoding processed human ActRIIA polypeptide is as follows:
- ActRIIA is well-conserved among vertebrates, with large stretches of the extracellular domain completely conserved.
- Figure 3 depicts a multi- sequence alignment of a human ActRIIA extracellular domain compared to various ActRIIA orthologs. Many of the ligands that bind to ActRIIA are also highly conserved. Accordingly, from these alignments, it is possible to predict key amino acid positions within the ligand-binding domain that are important for normal ActRIIA-ligand binding activities as well as to predict amino acid positions that are likely to be tolerant to substitution without significantly altering normal ActRIIA-ligand binding activities.
- an active, human ActRIIA variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate ActRIIA, or may include a residue that is similar to that in the human or other vertebrate sequences.
- F 13 in the human extracellular domain is Y in Ovis aries (SEQ ID NO: 108), Gallus gallus (SEQ ID NO: 111), Bos Taurus (SEQ ID NO: 112), Tyto alba (SEQ ID NO: 113), and Myotis davidii (SEQ ID NO: 114) ActRIIA, indicating that aromatic residues are tolerated at this position, including F, W, and Y.
- Q24 in the human extracellular domain is R in Bos Taurus ActRIIA, indicating that charged residues will be tolerated at this position, including D, R, K, H, and E.
- S95 in the human extracellular domain is F in Gallus gallus and Tyto alba ActRIIA, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y, and probably hydrophobic residue such as L, I, or F.
- E52 in the human extracellular domain is D in Ovis aries ActRIIA, indicating that acidic residues are tolerated at this position, including D and E. P29 in the human extracellular domain is relatively poorly conserved, appearing as S in Ovis aries ActRIIA and L in Myotis davidii ActRIIA, thus essentially any amino acid should be tolerated at this position.
- ActRII proteins have been characterized in the art in terms of structural/functional characteristics, particularly with respect to ligand binding
- a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomeric receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586: 1860-1870]. Accordingly, the core ligand-binding domains of human ActRIIA, as demarcated by the outermost of these conserved cysteines, corresponds to positions 30-110 of SEQ ID NO: 9 (ActRIIA precursor).
- the structurally less- ordered amino acids flanking these cysteine-demarcated core sequences can be truncated by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29 residues at the N-terminus and by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues at the C-terminus without necessarily altering ligand binding.
- Exemplary ActRIIA extracellular domains truncations include SEQ ID NOs: 10 and 11.
- a general formula for an active portion ⁇ e.g., ligand binding) of ActRIIA is a polypeptide that comprises, consists essentially of, or consists of amino acids 30-110 of SEQ ID NO: 9. Therefore ActRIIA polypeptides may, for example, comprise, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIA beginning at a residue corresponding to any one of amino acids 21-30 ⁇ e.g., beginning at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30) of SEQ ID NO: 9 and ending at a position corresponding to any one amino acids 110-135 (e.g., ending at any one of amino acids 110, 111, 112, 113, 114, 115, 116, 117,
- constructs that begin at a position selected from 21-30 (e.g., beginning at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30), 22-30 (e.g., beginning at any one of amino acids 22, 23, 24, 25, 26, 27, 28, 29, or 30), 23-30 (e.g., beginning at any one of amino acids 23, 24, 25, 26, 27, 28, 29, or 30), 24-30 (e.g., beginning at any one of amino acids 24, 25, 26, 27, 28, 29, or 30) of SEQ ID NO: 9, and end at a position selected from 111-135 (e.g., ending at any one of amino acids 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134 or 135), 112-135 (e.g., ending at any one of amino acids 112, 113, 114, 115, 116, 117, 118,
- Variants within these ranges are also contemplated, particularly those comprising, consisting essentially of, or consisting of an amino acid sequence that has at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the
- an ActRIIA polypeptide may comprise, consists essentially of, or consist of a polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 30-110 of SEQ ID NO: 9.
- ActRIIA polypeptides comprise a polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 30-1 10 of SEQ ID NO: 9, and comprising no more than 1, 2, 5, 10 or 15 conservative amino acid changes in the ligand-binding pocket.
- the disclosure relates to ActRII antagonists (inhibitors) that comprise at least one ActRIIA polypeptide, which includes fragments, functional variants, and modified forms thereof as well as uses thereof (e.g., increasing an immune response in a patient in need thereof and treating cancer).
- ActRIIA polypeptides are soluble (e.g., an extracellular domain of ActRIIA).
- ActRIIA polypeptides inhibit (e.g., Smad signaling) of one or more TGFP superfamily ligands [e.g., GDF1 1, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9]. In some embodiments, ActRIIA polypeptides bind to one or more TGFP
- polypeptide of the disclosure comprise, consist essentially of, or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ActRIIA beginning at a residue corresponding to amino acids 21-30 (e.g., beginning at any one of amino acids 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30) of SEQ ID NO: 9 and ending at a position corresponding to any one amino acids 1 10-135 (e.g., ending at any one of amino acids 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, or 135) of SEQ ID NO: 9.
- ActRIIA polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%>, 75%>, 80%>, 85%>, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 30-1 10 of SEQ ID NO: 9.
- ActRIIA is at least 70%>, 75%>, 80%>, 85%>, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 30-1 10 of SEQ ID NO: 9.
- polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical amino acids 21-135 of SEQ ID NO: 9.
- ActRIIA polypeptides comprise, consist, or consist essentially of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 9, 10, 1 1, 50, 54, and 57.
- GDF trap polypeptides also referred to as "GDF traps"
- GDF traps of the present disclosure are variant ActRII polypeptides (e.g., ActRIIA and ActRIIB polypeptides) that comprise one or more mutations (e.g., amino acid additions, deletions, substitutions, and combinations thereof) in the extracellular domain (also referred to as the ligand-binding domain) of an ActRII polypeptide (e.g., a "wild-type” or unmodified ActRII polypeptide) such that the variant ActRII polypeptide has one or more altered ligand-binding activities than the corresponding wild-type ActRII polypeptide.
- GDF trap polypeptides of the present disclosure retain at least one similar activity as a corresponding wild-type ActRII polypeptide.
- preferable GDF traps bind to and inhibit (e.g. antagonize) the function of GDFl 1 and/or GDF8.
- GDF traps of the present disclosure further bind to and inhibit one or more of ligand of the TGFP superfamily. Accordingly, the present disclosure provides GDF trap polypeptides that have an altered binding specificity for one or more ActRII ligands.
- one or more mutations may be selected that increase the selectivity of the altered ligand-binding domain for GDF l 1 and/or GDF8 over one or more ActRII-binding ligands such as activins (activin A, activin B, activin AB, activin C, and/or activin E), particularly activin A.
- the altered ligand-binding domain has a ratio of K d for activin binding to K d for GDF l 1 and/or GDF8 binding that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the ratio for the wild-type ligand-binding domain.
- the altered ligand-binding domain has a ratio of IC 50 for inhibiting activin to IC 50 for inhibiting GDFl 1 and/or GDF 8 that is at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-fold greater relative to the wild-type ligand-binding domain.
- the altered ligand- binding domain inhibits GDF l 1 and/or GDF 8 with an IC 50 at least 2-, 5-, 10-, 20-, 50-, 100- or even 1000-times less than the IC 50 for inhibiting activin.
- GDF traps of the present disclosure are designed to preferentially bind to GDFl 1 and/or GDF8 (also known as myostatin).
- GDFl 1 and/or GDF8-binding traps may further bind to activin B.
- GDF l 1 and/or GDF8- binding traps may further bind to BMP6.
- GDFl 1 and/or GDF8-binding traps may further bind to BMP10.
- GDFl 1 and/or GDF8-binding traps may further bind to activin B and BMP6.
- GDF traps of the present disclosure have diminished binding affinity for activins (e.g., activin A, activin A/B, activin B, activin C, activin E ), e.g., in comparison to a wild-type ActRII polypeptide.
- a GDF trap polypeptide of the present disclosure has diminished binding affinity for activin A.
- Amino acid residues of the ActRIIB proteins are in the ActRIIB ligand-binding pocket and help mediated binding to its ligands including, for example, activin A, GDF 1 1, and GDF8.
- GDF trap polypeptides comprising an altered-ligand binding domain (e.g. a GDF8/GDF1 1 -binding domain) of an ActRIIB receptor which comprises one or more mutations at those amino acid residues.
- the positively-charged amino acid residue Asp (D80) of the ligand-binding domain of ActRIIB can be mutated to a different amino acid residue to produce a GDF trap polypeptide that preferentially binds to GDF8, but not activin.
- the D80 residue with respect to SEQ ID NO: 1 is changed to an amino acid residue selected from the group consisting of: an uncharged amino acid residue, a negative amino acid residue, and a hydrophobic amino acid residue.
- the hydrophobic residue L79 of SEQ ID NO: 1 can be altered to confer altered activin- GDF1 1/GDF8 binding properties.
- an L79P substitution reduces GDF1 1 binding to a greater extent than activin binding.
- replacement of L79 with an acidic amino acid an aspartic acid or glutamic acid; an L79D or an L79E substitution] greatly reduces activin A binding affinity while retaining GDF 1 1 binding affinity.
- the methods described herein utilize a GDF trap polypeptide which is a variant ActRIIB polypeptide comprising an acidic amino acid (e.g., D or E) at the position corresponding to position 79 of SEQ ID NO: 1, optionally in combination with one or more additional amino acid substitutions, additions, or deletions.
- a GDF trap polypeptide which is a variant ActRIIB polypeptide comprising an acidic amino acid (e.g., D or E) at the position corresponding to position 79 of SEQ ID NO: 1, optionally in combination with one or more additional amino acid substitutions, additions, or deletions.
- the disclosure relates ALK4 polypeptides and uses thereof (e.g., increasing an immune response in a patient in need thereof and treating cancer or pathogens).
- ALK4 refers to a family of activin receptor-like kinase-4 proteins from any species and variants derived from such ALK4 proteins by mutagenesis or other modification. Reference to ALK4 herein is understood to be a reference to any one of the currently identified forms. Members of the ALK4 family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ALK4 polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ALK4 family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- the signal peptide is indicated by a single underline and the extracellular domain is indicated in bold font.
- a processed extracellular human ALK4 polypeptide sequence is as follows:
- a nucleic acid sequence encoding the ALK4 precursor protein is shown below (SEQ ID NO: 16), corresponding to nucleotides 78-1592 of Genbank Reference Sequence
- NM 004302.4 The signal sequence is underlined and the extracellular domain is indicated in bold font.
- a nucleic acid sequence encoding the extracellular ALK4 polypeptide is as follows: TCCGGGCCCCGGGGGGTCCAGGCTCTGCTGTGTGCGTGCACCAGCTGCCTCCAGGCCAACTA CACGTGTGAGACAGATGGGGCCTGCATGGTTTCCATTTTCAATCTGGATGGGATGGAGCACC ATGTGCACCTGCATCCCCAAAGTGGAGCTGGTCCCTGCCGGGAAGCCCTTCTACTGCCTG AGCTCGGAGGACCTGCGCAACACCCACTGCTGCTACACTGACTACTGCAACAGGATCGACTT GAGGGTGCCCAGTGGTCACCTCAAGGAGCCTGAGCACCCGTCCATGTGGGGCCCGGTGGAG
- isoform B (NCBI Ref Seq P_064732.3)
- the extracellular domain is indicated in bold font.
- a processed extracellular ALK4 polypeptide sequence is as follows:
- a nucleic acid sequence encoding the ALK4 precursor protein (isoform B) is shown below (SEQ ID NO: 20), corresponding to nucleotides 186-1547 of Genbank Reference Sequence NM 020327.3. The nucleotides encoding the extracellular domain are indicated in bold font.
- a nucleic acid sequence encoding the extracellular ALK4 polypeptide (isoform B) is as follows:
- FIG. 4 depicts a multi -sequence alignment of a human ALK4 extracellular domain compared to various ALK4 orthologs. Many of the ligands that bind to ALK4 are also highly conserved. Accordingly, from these alignments, it is possible to predict key amino acid positions within the ligand-binding domain that are important for normal ALK4-ligand binding activities as well as to predict amino acid positions that are likely to be tolerant to substitution without significantly altering normal ALK4-ligand binding activities.
- an active, human ALK4 variant polypeptide useful in accordance with the presently disclosed methods may include one or more amino acids at corresponding positions from the sequence of another vertebrate ALK4, or may include a residue that is similar to that in the human or other vertebrate sequences.
- V6 in the human ALK4 extracellular domain is isoleucine mMus muculus ALK4 (SEQ ID NO: 119), and so the position may be altered, and optionally may be altered to another hydrophobic residue such as L, I, or F, or a non-polar residue such as A, as is observed in Gallus gallus ALK4 (SEQ ID NO: 118).
- E40 in the human extracellular domain is K in Gallus gallus ALK4, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y, and probably a non-polar residue such as A.
- SI 5 in the human extracellular domain is D in Gallus gallus ALK4, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, T, R, E, K, H, G, P, G and Y.
- E40 in the human extracellular domain is K in Gallus gallus ALK4, indicating that charged residues will be tolerated at this position, including D, R, K, H, as well as Q and N.
- R80 in the human extracellular domain is K in Condylura cristata ALK4 (SEQ ID NO: 116), indicating that basic residues are tolerated at this position, including R, K, and H.
- Y77 in the human extracellular domain is F in Sus scrofa ALK4 (SEQ ID NO: 120), indicating that aromatic residues are tolerated at this position, including F, W, and Y.
- P93 in the human extracellular domain is relatively poorly conserved, appearing as S in Erinaceus europaeus ALK4 (SEQ ID NO: 117) and N in Gallus gallus ALK4, thus essentially any amino acid should be tolerated at this position.
- ALK4 proteins have been characterized in the art in terms of structural and functional characteristics, particularly with respect to ligand binding [e.g., Harrison et al. (2003) J Biol Chem 278(23):21129-21135; Romano et al. (2012) J Mol Model 18(8):3617- 3625; and Calvanese et al. (2009) 15(3): 175-183].
- these references provide amply guidance for how to generate ALK4 variants that retain one or more normal activities (e.g., ligand-binding activity).
- a defining structural motif known as a three-finger toxin fold is important for ligand binding by type I and type II receptors and is formed by conserved cysteine residues located at varying positions within the extracellular domain of each monomeric receptor [Greenwald et al. (1999) Nat Struct Biol 6: 18-22; and Hinck (2012) FEBS Lett 586: 1860-1870]. Accordingly, the core ligand-binding domains of human ALK4, as demarcated by the outermost of these conserved cysteines, corresponds to positions 34-101 of SEQ ID NO: 14 (ALK4 precursor).
- the structurally less-ordered amino acids flanking these cysteine-demarcated core sequences can be truncated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33 residues at the N-terminus and/or by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 residues at the C-terminus without necessarily altering ligand binding.
- Exemplary ALK4 extracellular domains for N-terminal and/or C-terminal truncation include SEQ ID NOs: 15 and 19.
- ALK4 polypeptides may, for example, comprise, consists essentially of, or consists of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a portion of ALK4 beginning at a residue corresponding to any one of amino acids 24-34 ⁇ e.g., beginning at any one of amino acids 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, or 34) of SEQ ID NO: 14 and ending at a position corresponding to any one amino acids 101-126 ⁇ e.g., ending at any one of amino acids 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 11
- SEQ ID NO: 14 Other examples include constructs that begin at a position from 24-34 ⁇ e.g., any one of positions 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, or 34), 25-34 ⁇ e.g., any one of positions 25, 26, 27, 28, 29, 30, 31, 32, 33, or 34), or 26-34 (e.g., any one of positions 26, 27, 28, 29, 30, 31, 32, 33, or 34) of SEQ ID NO: 14 and end at a position from 101-126 (e.g., any one of positions 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, or 126), 102-126 (e.g., any one of positions 102, 103, 104, 105, 106, 107,
- Variants within these ranges are also contemplated, particularly those having at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the
- ALK4 variants comprise no more than 1, 2, 5, 6, 7, 8, 9, 10 or 15 conservative amino acid changes in the ligand-binding pocket.
- Sites outside the binding pocket, at which variability may be particularly well tolerated, include the amino and carboxy termini of the extracellular domain (as noted above).
- the disclosure relates to ActRII antagonists (inhibitors) that are heteromultimers comprising at least one ALK4 polypeptide, which includes fragments, functional variants, and modified forms thereof as well as uses thereof (e.g., increasing an immune response in a patient in need thereof and treating cancer).
- ALK4 polypeptides are soluble (e.g., an extracellular domain of ALK4).
- heteromultimers comprising an ALK4 polypeptide inhibit (e.g., Smad signaling) of one or more TGFP superfamily ligands [e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP 10, and/or BMP9].
- heteromultimers comprising an ALK4 polypeptide bind to one or more TGFP superfamily ligands [e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- heteromultimers comprise at least one ALK4 polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, 100% identical to amino acids 34-101 with respect to SEQ ID NO: 14.
- heteromultimers comprise at least one ALK4 polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 14, 15, 18, 19, 73, 74, 76, 77, 79, and 80.
- ALK4 polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 14, 15, 18, 19, 73, 74, 76, 77, 79, and 80.
- heteromultimer comprise at least one ALK4 polypeptide that consist or consist essentially of at least one ALK4 polypeptide that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 14, 15, 18, 19, 74, 76, 77, 79, 80, 143, and 145.
- heteromultimer complexes comprising one or more ALK4 receptor polypeptides (e.g., SEQ ID Nos: 14, 15, 18, 19, 74,
- ActRIIB receptor polypeptides e.g., SEQ ID NOs: 1, 2, 3, 4, 5, 6, 58, 59, 60, 63, 64, 65, 66, 68, 69, 70, 71, 73,
- ALK4:ActRIIB heteromultimer complexes or "ALK4:ActRIIB heteromultimers”, including uses thereof (e.g., increasing an immune response in a patient in need thereof and treating cancer).
- ALK4:ActRIIB heteromultimers are soluble [e.g., a
- heteromultimer complex comprises a soluble portion (domain) of an ALK4 receptor and a soluble portion (domain) of an ActRIIB receptor].
- ALK4:ActRIIB heteromultimers comprise an extracellular domain of an ALK4:ActRIIB
- ALK4 receptor and an extracellular domain of an ActRIIB receptor are referred to.
- ALK4 ActRIIB heteromultimers inhibit (e.g., Smad signaling) of one or more TGFP superfamily ligands [e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- TGFP superfamily ligands e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- ALK4 ActRIIB heteromultimers bind to one or more TGFP superfamily ligands [e.g., GDF11, GDF8, activin (activin A, activin B, activin AB, activin C, activin E) BMP6, GDF3, BMP10, and/or BMP9].
- GDF11, GDF8, activin activin A, activin B, activin AB, activin C, activin E
- BMP6 GDF3, BMP10, and/or BMP9
- ALK4 ActRIIB heteromultimers comprise at least one ALK4 polypeptide that comprises, consists essentially of, or consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 14, 15, 18, 19, 74, 76, 77, 79, 80, 143, and 145.
- ALK4:ActRIIB heteromultimer complexes of the disclosure comprise at least one ALK4 polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to a portion of ALK4 beginning at a residue corresponding to any one of amino acids 24-34, 25-34, or 26-34 of SEQ ID NO: 14 and ending at a position from 101-126, 102-126, 101-125, 101-124, 101-121, 111-126, 111-125, 111-124, 121-126, 121-125, 121-124, or 124-126 of SEQ ID NO: 14.
- ALK4:ActRIIB heteromultimers comprise at least one ALK4
- polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100%) identical to amino acids 34-101 with respect to SEQ ID NO: 14.
- ALK4-ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 58, 59, 60, 63, 64, 65, 66, 68, 69, 70, 71, 73, 77, 78, 131, 132, 133, 139, 141.
- ALK4:ActRIIB heteromultimer complexes of the disclosure comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100%) identical to a portion of ActRIIB beginning at a residue corresponding to any one of amino acids 20-29, 20-24, 21-24, 22-25, or 21-29 and end at a position from 109-134, 119- 134, 119-133, 129-134, or 129-133 of SEQ ID NO: 1.
- ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%,
- ALK4:ActRIIB heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to amino acids 29-109 of SEQ ID NO: 1.
- heteromultimers comprise at least one ActRIIB polypeptide that comprises, consists essentially of, consists of a sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94% 95%, 97%, 98%, 99%, or 100% identical to amino acids 25-131 of SEQ ID NO: 1.
- ALK4: ActRIIB heteromultimer complexes of the disclosure comprise at least one ActRIIB polypeptide wherein the position corresponding to L79 of SEQ ID NO: 1 is not an acidic amino acid (i.e., not naturally occurring D or E amino acid residues or an artificial acidic amino acid residue).
- ALK4:ActRIIB heteromultimers of the disclosure include, e.g., heterodimers, heterotrimers, heterotetramers and further higher order oligomeric structures. See, e.g., Figures 21-23.
- heteromultimer complexes of the disclosure are
- Naturally occurring TGFpRII proteins are transmembrane proteins, with a portion of the protein positioned outside the cell (the extracellular portion) and a portion of the protein positioned inside the cell (the intracellular portion). Aspects of the present disclosure encompass variant TGFpRII polypeptides comprising mutations within the extracellular domain and/or truncated portions of the extracellular domain of TGFpRII.
- human TGFpRII occurs naturally in at least two isoforms - A (long) and B (short) - generated by alternative splicing in the extracellular domain (ECD) ( Figures 11 and 10 and SEQ ID NOS: 35 and 34).
- SEQ ID NO: 148 which corresponds to residues 23-184 of SEQ ID NO: 35, depicts the native full-length extracellular domain of the long isoform of
- amino acid position numbering with regard to variants based on the TGFpRII short and long isoforms refers to the corresponding position in the native precursors, SEQ ID NO: 34 and SEQ ID NO: 35, respectively.
- the disclosure provides variant TGFpRII polypeptides.
- a TGFpRII polypeptide of the disclosure may bind to and inhibit the function of a TGFP superfamily member, such as but not limited to, TGFpi or TGFP3.
- TGFpRII polypeptides may include a polypeptide consisting of, or comprising, an amino acid sequence at least 80% identical, and optionally at least 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%), or 100%) identical to a truncated ECD domain of a naturally occurring TGFpRII polypeptide, whose C-terminus occurs at any of amino acids 153-159 (e.g., 153, 154, 155, 156, 157, 158, or 159) of SEQ ID NO: 34.
- amino acids 153-159 e.g., 153, 154, 155, 156, 157, 158, or 159
- TGFpRII polypeptides may include a polypeptide consisting of, or comprising, an amino acid sequence at least 80%> identical, and optionally at least 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identical to a truncated ECD domain of a naturally occurring TGFpRII polypeptide, whose C-terminus occurs at any of amino acids 178-184 (e.g., 178, 179, 180, 181, 182, 183, or 184) of SEQ ID NO: 35.
- amino acids 178-184 e.g., 178, 179, 180, 181, 182, 183, or 184 of SEQ ID NO: 35.
- a TGFpRII polypeptide does not include more than 5 consecutive amino acids, or more than 10, 20, 30, 40, 50, 52, 60, 70, 80, 90, 100, 150 or 200 or more consecutive amino acids from a sequence consisting of amino acids 160-567 of SEQ ID NO: 34 or from a sequence consisting of amino acids 185-592 of SEQ ID NO: 35.
- the unprocessed TGFpRII polypeptide may either include or exclude any signal sequence, as well as any sequence N- terminal to the signal sequence. As elaborated herein, the N-terminus of the mature TGFpRII polypeptide.
- TGFpRII polypeptide may occur at any of amino acids 23-35 of SEQ ID NO: 34 or 23-60 of SEQ ID NO: 35. It will be understood by one of skill in the art that
- TGFpRII polypeptides accordingly may include isolated extracellular portions of TGFpRII polypeptides, including both the short and the long isoforms, variants thereof (including variants that comprise, for example, no more than 2, 3, 4, 5, 10, 15, 20, 25, 30, or 35 amino acid substitutions in the sequence corresponding to amino acids 23-159 of SEQ ID NO: 34 or amino acids 23-184 of SEQ ID NO: 35), fragments thereof, and fusion proteins comprising any of the foregoing, but in each case preferably any of the foregoing TGFpRII polypeptides will retain substantial affinity for at least one of TGFpi or TGFP3.
- a TGFpRII polypeptide will be designed to be soluble in aqueous solutions at biologically relevant temperatures, pH
- an active portion of a TGFpRII polypeptide may comprise amino acid sequences 23-153, 23-154, 23-155, 23-156, 23-157, or 23-158 of SEQ ID NO: 34, as well as variants of these sequences starting at any of amino acids 24-35 of SEQ ID NO: 34.
- an active portion of a TGFpRII polypeptide may comprise amino acid sequences 23-178, 23-179, 23-180, 23-181, 23-182, or 23-183 of SEQ ID NO: 35, as well as variants of these sequences starting at any of amino acids 24-60 of SEQ ID NO: 35.
- TGFpRII polypeptides comprise amino acid sequences 29-159, 35-159, 23-153, 29-153 and 35-153 of SEQ ID NO: 34 or amino acid sequences 29-184, 60-184, 23-178, 29-178 and 60- 178 of SEQ ID NO: 35. Variants within these ranges are also contemplated, particularly those having at least 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, 99%, or 100% identity to the corresponding portion of SEQ ID NO: 34 or SEQ ID NO: 35.
- a TGFpRII polypeptide may be selected that does not include the sequence consisting of amino acids 160-567 of SEQ ID NO: 34 or amino acids 185-592 of SEQ ID NO: 35.
- TGFpRII polypeptides may additionally include any of various leader sequences at the N-terminus. Such a sequence would allow the peptides to be expressed and targeted to the secretion pathway in a eukaryotic system. See, e.g., Ernst et al., U.S. Pat. No. 5,082,783 (1992).
- a native TGFpRII signal sequence may be used to effect extrusion from the cell.
- Possible leader sequences include native leaders, tissue plasminogen activator (TP A) and honeybee mellitin.
- TGFpRII- Fc fusion proteins include SEQ ID NOs: 148 and 150, as shown herein with the TGFpRII polypeptide portion underlined. It will be understood by one of skill in the art that corresponding variants based on the long isoform of TGFpRII will include the 25-amino acid insertion along with a conservative Val-Ile substitution at the flanking position C-terminal to the insertion.
- the disclosure relates to a TGFpRII polypeptide that comprises amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 150 as well as uses thereof in accordance with the methods described herein.
- the disclosure relates to a TGFpRII polypeptide that comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 148 as well as uses thereof in accordance with the methods described herein.
- the disclosure relates to a TGFpRII polypeptide that comprises amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%), 96%), 97%), 98%), 99%, or 100% identical to an amino acid sequence that begins at any one of amino acids 25-46 (e.g., 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, or 46) of SEQ ID NO: 148 and ends and any one of amino acids 170-186 (e.g., 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, or 186) of SEQ ID NO: 148 as well as uses thereof in accordance with the methods described herein.
- amino acids 25-46 e.g., 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
- the present disclosure contemplates making functional variants by modifying the structure of an ALK4 polypeptide, an ActRII polypeptide, and/or a
- TGFpRII polypeptide for such purposes as enhancing therapeutic efficacy or stability (e.g., shelf-life and resistance to proteolytic degradation in vivo).
- Variants can be produced by amino acid substitution, deletion, addition, or combinations thereof. For instance, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid ⁇ e.g., conservative mutations) will not have a major effect on the biological activity of the resulting molecule.
- Conservative replacements are those that take place within a family of amino acids that are related in their side chains.
- Whether a change in the amino acid sequence of a polypeptide of the disclosure results in a functional homolog can be readily determined by assessing the ability of the variant polypeptide to produce a response in cells in a fashion similar to the wild-type polypeptide, or to bind to one or more ligands including, for example, BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5,
- GDF6/BMP13 GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGFpl, TGFP2, TGFP3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS, and Lefty.
- GD F glial cell-derived neurotrophic factor
- the present disclosure contemplates specific mutations of an ALK4 polypeptide, an ActRII polypeptide, and/or a TGFpRII polypeptide so as to alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine or asparagine-X-serine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on a polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on a polypeptide may be accomplished chemically and/or enzymatically.
- Chemical deglycosylation may involve, for example, exposure of a polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N- acetylgalactosamine), while leaving the amino acid sequence intact.
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. [Meth. Enzymol. (1987) 138:350].
- the sequence of a polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect, and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides, and heteromultimers of the present disclosure for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- the disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ALK4, ActRII, and/or TGFpRII polypeptide as well as truncation mutants. Pools of combinatorial mutants are especially useful for identifying functionally active (e.g., TGFP superfamily ligand binding) ALK4, ActRII, and/or TGFpRII sequences. The purpose of screening such combinatorial libraries may be to generate, for example, polypeptides variants which have altered properties, such as altered
- ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide and ALK4:ActRIIB heteromultimer variants may be screened for ability to bind to one or more ligands ⁇ e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5,
- GD F glial cell-derived neurotrophic factor
- ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides or ALK4:ActRIIB heteromultimers also may be tested in a cell-based assay or in vivo.
- the effect of an ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptide or ALK4:ActRIIB heteromultimers on the expression of genes involved in cancer growth in a cancer cell may be assessed.
- This may, as needed, be performed in the presence of one or more recombinant ligand proteins ⁇ e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDFl l/BMPl l, GDF15/MIC1, TGFpl, TGFp2, TGFp3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GDNF), neurturin, artemin, persephin, MIS, and Lefty), and cells may be transfected so as to produce an ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide, or ALK4:ActRIIB heteromultimes, and optional
- heteromultimer heteromultimer may be administered to a mouse or other animal, and one or more measurements, such as muscle formation and strength may be assessed using art- recognized methods.
- the activity of an ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide, or ALK4: ActRIIB heteromultimer or variants thereof may be tested in cancer cells for any effect on growth of these cells, for example, by the assays as described herein and those of common knowledge in the art.
- a SMAD-responsive reporter gene may be used in such cell lines to monitor effects on downstream signaling.
- Combinatorial -derived variants can be generated which have increased selectivity or generally increased potency relative to a reference ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide, or ALK4:ActRIIB heteromultimer.
- Such variants when expressed from recombinant DNA constructs, can be used in gene therapy protocols.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding unmodified ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide, or ALK4:ActRIIB heteromultimer.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction, or otherwise inactivation, of an unmodified
- polypeptide Such variants, and the genes which encode them, can be utilized to alter polypeptide complex levels by modulating the half-life of the polypeptide. For instance, a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant polypeptide complex levels within the cell.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide, or ALK4: ActRIIB heteromultimer.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ALK4
- TGFpRII, and/or ActRII sequences For instance, a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ALK4, TGFpRII, and/or ActRII encoding nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence.
- Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression.
- the synthesis of degenerate oligonucleotides is well known in the art [Narang, SA (1983) Tetrahedron 39:3; Itakura et al. (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al. (1984) Annu. Rev. Biochem.
- ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptide or ALK4:ActRIIB heteromultimers of the disclosure can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis [Ruf et al. (1994) Biochemistry 33 : 1565-1572; Wang et al. (1994) J. Biol. Chem. 269:3095-3099; Balint et al. (1993) Gene 137: 109-118; Grodberg et al. (1993) Eur. J. Biochem. 218:597-601; Nagashima et al.
- a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides or ALK4: ActRIIB heteromultimers.
- the most widely used techniques for screening large gene libraries typically comprise cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Preferred assays include ligand (e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF1 1/BMP1 1, GDF 15/MIC1, TGFpl, TGFp2, TGFp3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GD F), neurturin, artemin, persephin, MIS, and Lefty) binding assays and/or ligand-mediated cell signaling assays.
- ligand e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b,
- ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides, or ALK4:ActRIIB heteromultimers may further comprise post-translational modifications in addition to any that are naturally present in the ALK4, TGFpRII, and/or ActRII polypeptide.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides or ALK4:ActRIIB heteromultimers may comprise non-amino acid elements, such as polyethylene glycols, lipids, polysaccharide or monosaccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a ActRII polypeptide, ALK4 polypeptide, TGFpRII polypeptide, or
- ALK4:ActRIIB heteromultimer may be tested as described herein for other heteromultimer complex variants.
- post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells e.g., CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ALK4, TGFpRII, and/or ActRII polypeptide.
- ActRII polypeptides, TGFpRII polypeptides, and/or ALK4 polypeptides of the disclosure are fusion proteins comprising at least a portion (domain) of an ActRII polypeptide (e.g., an ActRIIA or ActRIIB polypeptide), TGFpRII, or ALK4 polypeptide and one or more heterologous portions (domains).
- an ActRII polypeptide e.g., an ActRIIA or ActRIIB polypeptide
- TGFpRII e.g., an ActRIIA or ActRIIB polypeptide
- ALK4 polypeptide e.g., a portion of an ActRII polypeptide
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S- transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy-chain constant region (Fc), maltose binding protein (MBP), or human
- fusion domain may be selected so as to facilitate detection of the ActRII polypeptide.
- detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- the fusion domains have a protease cleavage site, such as for Factor Xa or thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function) including, for example constant domains from immunoglobulins (e.g., Fc domains).
- multimerizing e.g., dimerizing, tetramerizing
- functional domains that confer an additional biological function
- constant domains from immunoglobulins e.g., Fc domains
- preferred multimerization domains are modified Fc domains that promote asymmetrical pairing to form heteromultimer structures (e.g.,
- ActRII polypeptides, TGFpRII polypeptides, and/or ALK4 polypeptides of the present disclosure contain one or more modifications that are capable of "stabilizing” the polypeptides.
- stabilizing is meant anything that increases the in vitro half-life, serum half-life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect of the agent.
- such modifications enhance the shelf-life of the polypeptides, enhance circulatory half-life of the polypeptides, and/or reduce proteolytic degradation of the polypeptides.
- Such stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRII polypeptide, TGFpRII polypeptide, or ALK4 polypeptide domain and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to a polypeptide of the disclosure), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a polypeptide of the disclosure).
- fusion proteins including, for example, fusion proteins comprising an ActRII polypeptide, TGFpRII polypeptide, or ALK4 polypeptide domain and a stabilizer domain
- modifications of a glycosylation site including, for example, addition of a glycosylation site to a polypeptide of the disclosure
- modifications of carbohydrate moiety including, for example, removal of carbohydrate moieties from a polypeptide of the disclosure.
- stabilizer domain not only refers to a fusion domain (e.g., an immunoglobulin Fc domain) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous moiety, such as polyethylene glycol.
- an ActRII polypeptide, TGFpRII polypeptide, and/or ALK4 polypeptide is fused with a heterologous domain that stabilizes the polypeptide (a "stabilizer” domain), preferably a heterologous domain that increases stability of the polypeptide in vivo. Fusions with a constant domain of an immunoglobulin (e.g., an Fc domain) are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable stabilizing properties.
- ALK4, TGFpRII, and/or ActRII polypeptides of the disclosure are Fc fusion proteins.
- An example of a native amino acid sequence that may be used for the Fc portion of human IgGl (GIFc) is shown below (SEQ ID NO: 22). Dotted underline indicates the hinge region, and solid underline indicates positions with naturally occurring variants.
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 22.
- Naturally occurring variants in GIFc would include E134D and M136L according to the numbering system used in SEQ ID NO: 22 (see Uniprot P01857).
- the IgGl Fc domain has one or more mutations at residues such as Asp- 265, lysine 322, and Asn-434.
- the mutant IgGl Fc domain having one or more of these mutations ⁇ e.g., Asp-265 mutation
- the mutant Fc domain having one or more of these mutations ⁇ e.g., Asn-434 mutation
- SEQ ID NO: 23 An example of a native amino acid sequence that may be used for the Fc portion of human IgG2 (G2Fc) is shown below (SEQ ID NO: 23). Dotted underline indicates the hinge region and double underline indicates positions where there are data base conflicts in the sequence (according to UniProt P01859).
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 23.
- G3Fc Two examples of amino acid sequences that may be used for the Fc portion of human IgG3 (G3Fc) are shown below.
- the hinge region in G3Fc can be up to four times as long as in other Fc chains and contains three identical 15-residue segments preceded by a similar 17-residue segment.
- the first G3Fc sequence shown below (SEQ ID NO: 24) contains a short hinge region consisting of a single 15-residue segment, whereas the second G3Fc sequence (SEQ ID NO: 25) contains a full-length hinge region.
- dotted underline indicates the hinge region
- solid underline indicates positions with naturally occurring variants according to UniProt P01859.
- polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NOs: 24 or 25.
- G3Fc for example, see Uniprot P01860
- Naturally occurring variants in G3Fc include E68Q, P76L, E79Q, Y81F, D97N, N100D, T124A, S169N, S169del, F221Y when converted to the numbering system used in SEQ ID NO: 24, and the present disclosure provides fusion proteins comprising G3Fc domains containing one or more of these variations.
- the human immunoglobulin IgG3 gene (IGHG3) shows a structural polymorphism characterized by different hinge lengths [see Uniprot P01859].
- variant WIS is lacking most of the V region and all of the CHI region. It has an extra interchain disulfide bond at position 7 in addition to the 11 normally present in the hinge region.
- Variant ZUC lacks most of the V region, all of the CHI region, and part of the hinge.
- Variant OMM may represent an allelic form or another gamma chain subclass.
- the present disclosure provides additional fusion proteins comprising G3Fc domains containing one or more of these variants.
- G4Fc human IgG4
- SEQ ID NO: 26 An example of a native amino acid sequence that may be used for the Fc portion of human IgG4 (G4Fc) is shown below (SEQ ID NO: 26). Dotted underline indicates the hinge region.
- the disclosure provides polypeptides comprising, consisting essential of, or consisting of amino acid sequences with 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 26.
- a given amino acid position in an immunoglobulin sequence consisting of hinge, CH2, and CH3 regions will be identified by a different number than the same position when numbering encompasses the entire IgGl heavy-chain constant domain (consisting of the CHI, hinge, CH2, and CH3 regions) as in the Uniprot database.
- correspondence between selected CH3 positions in a human GlFc sequence (SEQ ID NO: 22), the human IgGl heavy chain constant domain (Uniprot P01857), and the human IgGl heavy chain is as follows.
- polypeptides disclosed herein may form protein complexes comprising at least one ALK4 polypeptide associated, covalently or non-covalently, with at least one ActRIIB polypeptide.
- polypeptides disclosed herein form heterodimeric complexes, although higher order heteromultimeric complexes (heteromultimers) are also included such as, but not limited to, heterotrimers, heterotetramers, and further oligomeric structures (see, e.g., Figure 21-23).
- ALK4 and/or ActRIIB are also included such as, but not limited to, heterotrimers, heterotetramers, and further oligomeric structures.
- polypeptides comprise at least one multimerization domain.
- multimerization domain refers to an amino acid or sequence of amino acids that promote covalent or non-covalent interaction between at least a first polypeptide and at least a second polypeptide.
- Polypeptides disclosed herein may be joined covalently or non-covalently to a multimerization domain.
- a multimerization domain promotes interaction between a first polypeptide (e.g., an ALK4 polypeptide) and a second polypeptide (e.g., an ActRIIB polypeptide) to promote heteromultimer formation (e.g., heterodimer formation), and optionally hinders or otherwise disfavors homomultimer formation (e.g., homodimer formation), thereby increasing the yield of desired heteromultimer (see, e.g., Figure 22).
- a first polypeptide e.g., an ALK4 polypeptide
- a second polypeptide e.g., an ActRIIB polypeptide
- heteromultimer formation e.g., heterodimer formation
- optionally hinders or otherwise disfavors homomultimer formation e.g., homodimer formation
- non-naturally occurring disulfide bonds may be constructed by replacing on a first polypeptide (e.g., an ALK4 polypeptide) a naturally occurring amino acid with a free thiol-containing residue, such as cysteine, such that the free thiol interacts with another free thiol-containing residue on a second polypeptide (e.g., an ActRIIB polypeptide) such that a disulfide bond is formed between the first and second polypeptides.
- a first polypeptide e.g., an ALK4 polypeptide
- a naturally occurring amino acid with a free thiol-containing residue, such as cysteine, such that the free thiol interacts with another free thiol-containing residue on a second polypeptide (e.g., an ActRIIB polypeptide) such that a disulfide bond is formed between the first and second polypeptides.
- a second polypeptide e.g., an ActRIIB polypeptid
- a multimerization domain may comprise one component of an interaction pair.
- the polypeptides disclosed herein may form protein complexes comprising a first polypeptide covalently or non-covalently associated with a second polypeptide, wherein the first polypeptide comprises the amino acid sequence of an ALK4 polypeptide and the amino acid sequence of a first member of an interaction pair; and the second polypeptide comprises the amino acid sequence of an ActRIIB polypeptide and the amino acid sequence of a second member of an interaction pair.
- the interaction pair may be any two polypeptide sequences that interact to form a complex, particularly a
- heterodimeric complex although operative embodiments may also employ an interaction pair that can form a homodimeric complex.
- One member of the interaction pair may be fused to an ALK4 or ActRIIB polypeptide as described herein, including for example, a polypeptide sequence comprising, consisting essentially of, or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of any one of SEQ ID NOs: 2, 3, 5, 6, 15, and 19.
- An interaction pair may be selected to confer an improved property/activity such as increased serum half-life, or to act as an adaptor on to which another moiety is attached to provide an improved property/activity.
- a polyethylene glycol moiety may be attached to one or both components of an interaction pair to provide an improved property/activity such as improved serum half-life.
- the first and second members of the interaction pair may be an asymmetric pair, meaning that the members of the pair preferentially associate with each other rather than self- associate. Accordingly, first and second members of an asymmetric interaction pair may associate to form a heterodimeric complex (see, e.g., Figure 22).
- the interaction pair may be unguided, meaning that the members of the pair may associate with each other or self-associate without substantial preference and thus may have the same or different amino acid sequences. Accordingly, first and second members of an unguided interaction pair may associate to form a homodimer complex or a heterodimeric complex.
- the first member of the interaction pair (e.g., an asymmetric pair or an unguided interaction pair) associates covalently with the second member of the interaction pair.
- the first member of the interaction pair (e.g., an asymmetric pair or an unguided interaction pair) associates non-covalently with the second member of the interaction pair.
- the present disclosure provides fusion proteins comprising
- immunoglobulin such as a CHI, CH2, or CH3 domain derived from human IgGl, IgG2, IgG3, and/or IgG4, that has been modified to promote heteromultimer formation.
- a problem that arises in large-scale production of asymmetric immunoglobulin-based proteins from a single cell line is known as the "chain association issue”.
- the chain association issue concerns the challenge of efficiently producing a desired multi-chain protein from among the multiple combinations that inherently result when different heavy chains and/or light chains are produced in a single cell line [Klein et al (2012) mAbs 4:653-663].
- Methods to obtain desired pairing of Fc-containing chains include, but are not limited to, charge-based pairing (electrostatic steering), "knobs- into-holes” steric pairing, SEEDbody pairing, and leucine zipper-based pairing [Ridgway et al (1996) Protein Eng 9:617-621 ; Merchant et al (1998) Nat Biotech 16:677-681 ; Davis et al (2010) Protein Eng Des Sel 23 : 195-202; Gunasekaran et al (2010); 285 : 19637-19646;
- ALK4:ActRIIB heteromul timers and method of making such heteromul timers have been previously disclosed. See, for example, WO 2016/164497, the entire teachings of which are incorporated by reference herein.
- fusion proteins e.g., immunoglobulin Fc fusion proteins
- elements of the fusion proteins may be arranged in any manner that is consistent with desired
- an ActRII polypeptide domain, ALK4 polypeptide domain, or TGFpRII polypeptide domain may be placed C-terminal to a heterologous domain, or alternatively, a heterologous domain may be placed C-terminal to an ActRII polypeptide domain, ALK4 polypeptide domain, or TGFpRII polypeptide domain.
- the ActRII polypeptide domain, ALK4 polypeptide domain, or TGFpRII polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- an ActRII (or ALK4 or TGFpRII) receptor fusion protein may comprise an amino acid sequence as set forth in the formula A-B-C.
- the B portion corresponds to an ActRII (or ALK4 or TGFpRII) polypeptide domain.
- the A and C portions may be independently zero, one, or more than one amino acid, and both the A and C portions when present are heterologous to B.
- the A and/or C portions may be attached to the B portion via a linker sequence.
- a linker may be rich in glycine (e.g., 2-10, 2-5, 2-4, 2-3 glycine residues) or glycine and proline residues and may, for example, contain a single sequence of threonine/serine and glycines or repeating sequences of threonine/serine and/or glycines, e.g., GGG (SEQ ID NO: 27), GGGG (SEQ ID NO: 28), TGGGG (SEQ ID NO: 29), SGGGG (SEQ ID NO: 30), TGGG (SEQ ID NO: 31), SGGG (SEQ ID NO: 32), or GGGGS (SEQ ID NO: 33) singlets, or repeats.
- GGG SEQ ID NO: 27
- GGGG SEQ ID NO: 28
- TGGGG SEQ ID NO: 29
- SGGGG SEQ ID NO: 30
- TGGG SEQ ID NO: 31
- SGGG SEQ ID NO: 32
- an ActRII (or ALK4 or TGFpRII) fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a leader (signal) sequence, B consists of an ActRII (or ALK4 or TGFpRII) polypeptide domain, and C is a polypeptide portion that enhances one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- an ActRII (or ALK4 or TGFpRII) fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a TPA leader sequence, B consists of an ActRII (or ALK4 or TGFpRII) receptor polypeptide domain, and C is an immunoglobulin Fc domain.
- Preferred fusion proteins comprise the amino acid sequence set forth in any one of SEQ ID NOs: 50, 54 57, 58, 60, 63, 64, 66, 70, 71, 73, 74, 76, 77, 78, 79, 80, 123, 131, 132, 139, 141, 143, 145, 148, and 150.
- ActRII antagonists may comprise one or more single-chain ligand traps, optionally which may be covalently or non-covalently associated with one or more ALK4 or ActRIIB polypeptides as well as additional ALK4: ActRIIB single chain ligand traps [US 2011/0236309 and US2009/0010879].
- single-chain ligand traps do not require fusion to any multimerization domain such as coiled-coil Fc domains to be
- single-chain ligand traps of the present disclosure comprise at least one ALK4 polypeptide domain and one ActRIIB polypeptide domain.
- the ALK4 and ActRIIB polypeptide domains generally referred to herein as binding domains (BD), optionally may be joined by a linker region.
- ALK4: ActRIIB single-chain ligand traps have been previously described. See, e.g., WO 2016/164497, the entire teachings of each which are incorporated by reference herein.
- TGFpRII polypeptides, and ALK4:ActRIIB heteromultimers to be used in accordance with the methods described herein are isolated complexes.
- an isolated protein (or protein complex) or polypeptide (or polypeptide complex) is one which has been separated from a component of its natural environment.
- a polypeptide or heteromultimer of the disclosure is purified to greater than 95%, 96%, 97%, 98%, or 99% purity as determined by, for example, electrophoretic ⁇ e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic ⁇ e.g., ion exchange or reverse phase HPLC).
- ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides, and ALK4: ActRIIB heteromultimers of the disclosure can be produced by a variety of art-known techniques.
- polypeptides of the disclosure can be synthesized using standard protein chemistry techniques such as those described in
- polypeptides and complexes of the disclosure may be recombinantly produced using various expression systems [E. coli, Chinese Hamster Ovary (CHO) cells, COS cells, baculovirus] as is well known in the art.
- the modified or unmodified polypeptides of the disclosure may be produced by digestion of recombinantly produced full-length ALK4, TGFpRII, and/or ActRIIB polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- a protease e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- PACE paired basic amino acid converting enzyme
- Computer analysis using commercially available software, e.g., Mac Vector, Omega, PCGene, Molecular Simulation, Inc. can be used to identify proteolytic cleavage sites.
- the present disclosure provides isolated and/or recombinant nucleic acids encoding ActRII, ALK4, and/or TGFpRII polypeptides (including fragments, functional variants, and fusion proteins thereof) disclosed herein.
- SEQ ID NO: 16 encodes a naturally occurring human ALK4 precursor polypeptide
- SEQ ID NO: 17 encodes a processed extracellular domain of ALK4.
- the subject nucleic acids may be single- stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRII polypeptides, ALK4 polypeptides, TGFpRII polypeptides, and ALK4:ActRIIB heteromultimers as described herein.
- isolated nucleic acid(s) refers to a nucleic acid molecule that has been separated from a component of its natural environment.
- An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- nucleic acids encoding ALK4, ActRII, or TGFpRII polypeptides of the present disclosure are understood to include any one of SEQ ID NOs: 7, 8, 12, 13, 16, 17, 20, 21, 55, 61, 67, 72, 75, 124, 125, 126, 127, 134, 135, 136, 137, 138, 140, 142, 144, 146, and 149 as well as variants thereof.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions, or deletions including allelic variants, and therefore, will include coding sequences that differ from the nucleotide sequence designated in any one of SEQ ID NOs: 7, 8, 12, 13, 16, 17, 20, 21, 55, 61, 67, 72, 75, 124, 125, 126, 127, 134, 135, 136, 137, 138, 140, 142, 144, 146, and 149.
- ALK4, ActRII, TGFpRII polypeptides of the present disclosure are encoded by isolated or recombinant nucleic acid sequences that comprise, consist essentially of, or consists of a sequence that is least 70%, 75%>, 80%>, 85%>, 86%>, 87%>, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NOs: 7, 8, 12, 13, 16, 17, 20, 21, 55, 61, 67, 72, 75, 124, 125, 126, 127, 134, 135, 136, 137, 138, 140, 142, 144, 146, and 149.
- nucleic acid sequences that comprise, consist essentially of, or consists of a sequence complementary to a sequence that is least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NOs: 7, 8, 12, 13, 16, 17, 20, 21, 55, 61, 67, 72, 75, 124, 125, 126, 127, 134, 135, 136, 137, 138, 140, 142, 144, 146, and 149 also within the scope of the present disclosure.
- nucleic acid sequences of the disclosure can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence or in a DNA library.
- nucleic acids of the present disclosure also include nucleotide sequences that hybridize under stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 7, 8, 12, 13, 16, 17, 20, 21, 55, 61, 67, 72, 75, 124, 125, 126, 127, 134, 135, 136, 137, 138, 140, 142, 144, 146, and 149, or fragments thereof.
- the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C.
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 7, 8, 12, 13, 16, 17, 20, 21, 55, 61, 67, 72, 75, 124, 125, 126, 127, 134, 135, 136, 137, 138, 140, 142, 144, 146, and 149 to degeneracy in the genetic code are also within the scope of the disclosure.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells.
- these variations in one or more nucleotides (up to about 3-5% of the nucleotides) of the nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
- the recombinant nucleic acids of the present disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression.
- suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ALK4, ActRII, and/or TGFpRII polypeptide and operably linked to at least one regulatory sequence.
- Regulatory sequences are art-recognized and are selected to direct expression of ALK4, ActRII, and/or TGFpRII polypeptide.
- the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990).
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ALK4, ActRIIB, and/or TGFpRII polypeptides.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid of the present disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant TGFP superfamily type I and/or type II receptor polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the following types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells. Some of these vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- viruses such as the bovine papilloma virus (BPV-1), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-1 bovine papilloma virus
- pHEBo Epstein- Barr virus
- pREP-derived and p205 Epstein- Barr virus
- retroviral retroviral expression systems
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- suitable expression systems for both prokaryotic and eukaryotic cells as well as general recombinant procedures [Molecular Cloning A Laboratory Manual, 3rd Ed., ed. by Sambrook, Fritsch and Maniatis Cold Spring Harbor Laboratory Press, 2001].
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the B-gal containing pBlueBac III).
- a vector will be designed for production of the subject ALK4 and/or ActRII polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors
- the subject gene constructs can be used to cause expression of the subject ALK4 and/or ActRII polypeptide in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for
- This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence for one or more of the subject ALK4, ActRIIB, and/or TGFpRII polypeptides.
- the host cell may be any prokaryotic or eukaryotic cell. For example, an
- ALK4, ActRIIB, and/or TGFpRII polypeptide may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line].
- bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells [e.g. a Chinese hamster ovary (CHO) cell line].
- insect cells e.g., using a baculovirus expression system
- yeast e.g., using a baculovirus expression system
- mammalian cells e.g. a Chinese hamster ovary (CHO) cell line.
- Other suitable host cells are known to those skilled in the art.
- the present disclosure further pertains to methods of producing the subject ALK4, ActRIIB, and/or TGFpRII polypeptides.
- a host cell transfected with an expression vector encoding an ALK4, ActRIIB, and/or TGFpRII polypeptide can be cultured under appropriate conditions to allow expression of the ALK4, ActRIIB, and/or TGFpRII polypeptide to occur.
- the polypeptide may be secreted and isolated from a mixture of cells and medium containing the polypeptide.
- ALK4, ActRIIB, and/or TGFpRII polypeptide may be isolated from a cytoplasmic or membrane fraction obtained from harvested and lysed cells.
- a cell culture includes host cells, media and other byproducts.
- Suitable media for cell culture are well known in the art.
- the subject polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of ALK4, ActRIIB, and/or TGFpRII polypeptides and affinity purification with an agent that binds to a domain fused to ALK4, ActRIIB, and/or TGFpRII polypeptide (e.g., a protein A column may be used to purify ALK4-Fc, ActRIIB-Fc, and/or TGFpRII-Fc fusion proteins).
- the ALK4 and/or ActRII polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion chromatography, and cation exchange chromatography. The purification could be completed with viral filtration and buffer exchange.
- An ALK4-Fc, ActRIIB-Fc, and/or TGFpRII-Fc fusion protein, as well as heteromeric complexes thereof, may be purified to a purity of >90%, >95%, >96%, >98%, or >99% as determined by size exclusion
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ALK4, ActRIIB, and/or TGFpRII polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin. The purification leader sequence can then be subsequently removed by treatment with
- enterokinase to provide the purified ALK4, ActRIIB, and/or TGFpRII polypeptide, as well as heteromeric complexes thereof [Hochuli et al. (1987) J. Chromatography 411 : 177; and Janknecht et al. (1991) PNAS USA 88:8972].
- Techniques for making fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence. See, e.g., Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992.
- the present disclosure relates to an ActRII antagonist (inhibitor) that is antibody, or combination of antibodies.
- ActRII antagonist antibody, or combination of antibodies may bind to one or more ActRII ligands [e.g., GDFl 1, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, and BMP9] or one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, and ALK4).
- ActRII ligands e.g., GDFl 1, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, and BMP9] or one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, and ALK4).
- an ActRII antagonist antibody or combination of ActRII antagonist antibodies, alone or in combination with one or more additional supportive therapies and/or active agents, to achieve a desired effect in a subject in need thereof (e.g., increase an immune response in a subject in need thereof and treat cancer or a pathogen).
- an ActRII antagonist antibody may be used in combination with a TGFpRII antagonist.
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least GDF l 1. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least GDFl 1.
- a GDFl 1 antibody generally refers to an antibody that binds to GDFl 1 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDFl 1.
- the extent of binding of an anti-GDFl 1 antibody to an unrelated, non-GDFl 1 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDFl 1 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- an anti-GDFl 1 antibody binds to an epitope of GDF11 that is conserved among GDF11 from different species. In certain preferred embodiments, an anti-GDFl 1 antibody binds to human GDF11. In other preferred embodiments, an anti-GDFl 1 antibody may inhibit GDF11 from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit GDF11- mediated signaling (e.g., Smad signaling) via these receptors. It should be noted that GDF11 has high sequence homology to GDF8 and therefore antibodies that bind to GDF11, in some cases, may also bind to and/or inhibit GDF8.
- a cognate type I and/or type II receptor e.g., ActRIIA, ActRIIB, and ALK4
- GDF11- mediated signaling e.g., Smad signaling
- an anti-GDFl 1 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 e.g., BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3
- type I and/or type II receptors e.g., ActRIIA, ActRII
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-GDFl 1 antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or bind to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 e.g., BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3
- type I and/or type II receptors e.g
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least GDF8. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least GDF8.
- a GDF8 antibody (anti-GDF8 antibody) generally refers to an antibody that binds to GDF8 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF8.
- the extent of binding of an anti-GDF8 antibody to an unrelated, non-GDF8 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDF8 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-GDF8 antibody binds to an epitope of GDF8 that is conserved among GDF8 from different species.
- an anti-GDF8 antibody binds to human GDF8.
- an anti-GDF8 antibody may inhibit GDF8 from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit GDF8-mediated signaling (e.g., Smad signaling) via these receptors.
- a cognate type I and/or type II receptor e.g., ActRIIA, ActRIIB, and ALK4
- GDF8-mediated signaling e.g., Smad signaling
- an anti-GDF8 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF11, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-GDF8 antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF11, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC). Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least activin.
- an activin antibody anti-activin antibody generally refers to an antibody that binds to activin with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting activin.
- the extent of binding of an anti-activin antibody to an unrelated, non-activin protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to activin as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-activin antibody binds to an epitope of activin that is conserved among activin from different species.
- an anti- activin antibody binds to human activin.
- an anti-activin antibody may inhibit activin from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit activin-mediated signaling (e.g., Smad signaling) via these receptors.
- activins share sequence homology and therefore antibodies that bind to one activin (e.g., activin A) may bind to one or more additional activins (e.g., activin B, activin AB, activin C, activin E, activin AC).
- an anti-activin antibody binds to at least activin A and activin B.
- an anti-activin antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF11, GDF8, GDF3, BMP6, BMP10, BMP9, TGFpi, TGFP2, and TGFP3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- additional ligands e.g., GDF11, GDF8, GDF3, BMP6, BMP10, BMP9, TGFpi, TGFP2, and TGFP3
- type I and/or type II receptors e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-activin antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF8, GDF11, GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or bind to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- an antibody, or combination of antibodies, to be used in accordance with the methods and uses of the disclosure binds to activin and TGFp.
- an antibody, or combination of antibodies, to be used in accordance with the methods and uses of the disclosure binds to activin A and TGFP2.
- an antibody, or combination of antibodies to be used in accordance with the methods and uses of the disclosure binds to activin A and TGFP2.
- an antibody, or any additional antibodies that bind
- an antibody, or combination of antibodies, to be used in accordance with the methods and uses of the disclosure binds to ActRII (ActRIIA and/or ActRIIB) and TGFp.
- an antibody, or combination of antibodies, to be used in accordance with the methods and uses of the disclosure binds to ActRII (ActRIIA and/or ActRIIB) and TGFp2.
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least GDF3. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least GDF3.
- a GDF3 antibody (anti-GDF3 antibody) generally refers to an antibody that binds to GDF3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting GDF3.
- the extent of binding of an anti-GDF3 antibody to an unrelated, non-GDF3 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to GDF3 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-GDF3 antibody binds to an epitope of GDF3 that is conserved among GDF3 from different species.
- an anti-GDF3 antibody binds to human GDF3.
- an anti-GDF3 antibody may inhibit GDF3 from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit GDF3 -mediated signaling (e.g., Smad signaling) via these receptors.
- a cognate type I and/or type II receptor e.g., ActRIIA, ActRIIB, and ALK4
- GDF3 -mediated signaling e.g., Smad signaling
- an anti-GDF3 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- additional ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti- GDF3 antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or bind to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- type I and/or type II receptors e.g., ActRIIA
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least BMP6. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least BMP6.
- a BMP6 antibody (anti-BMP6 antibody) generally refers to an antibody that binds to BMP6 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMP6.
- the extent of binding of an anti-BMP6 antibody to an unrelated, non-BMP6 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP6 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-BMP6 antibody binds to an epitope of BMP6 that is conserved among BMP6 from different species.
- an anti-BMP6 antibody binds to human BMP6.
- an anti-BMP6 antibody may inhibit BMP6 from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit BMP6-mediated signaling (e.g., Smad signaling) via these receptors.
- a cognate type I and/or type II receptor e.g., ActRIIA, ActRIIB, and ALK4
- BMP6-mediated signaling e.g., Smad signaling
- an anti-BMP6 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- additional ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti- BMP6 antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3] and/or bind to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 e.g., BMP 10, BMP9, TGFpl, TGFp2, and TGFp3
- type I and/or type II receptors e.
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least BMP9. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least BMP9.
- a BMP9 antibody (anti-BMP9 antibody) generally refers to an antibody that binds to BMP9 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMP9.
- the extent of binding of an anti-BMP9 antibody to an unrelated, non-BMP9 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP9 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-BMP9 antibody binds to an epitope of BMP9 that is conserved among BMP9 from different species.
- an anti-BMP9 antibody binds to human BMP9.
- an anti-BMP9 antibody may inhibit BMP9 from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit BMP9-mediated signaling (e.g., Smad signaling) via these receptors.
- a cognate type I and/or type II receptor e.g., ActRIIA, ActRIIB, and ALK4
- BMP9-mediated signaling e.g., Smad signaling
- an anti-BMP9 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP10, BMP6, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpPJI, ALK5, and ALK4).
- additional ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP10, BMP6, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti- BMP9 antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP10, BMP6, TGFpl, TGFp2, and TGFp3] and/or bind to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 e.g., BMP10, BMP6, TGFpl, TGFp2, and TGFp3
- type I and/or type II receptors e.
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least BMPIO. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least BMPIO.
- a BMPIO antibody (anti-BMPIO antibody) generally refers to an antibody that binds to BMPIO with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BMPIO.
- the extent of binding of an anti-BMPIO antibody to an unrelated, non-BMP10 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to BMP10 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-BMPlO antibody binds to an epitope of BMPIO that is conserved among BMPIO from different species.
- an anti-BMPlO antibody binds to human BMPIO.
- an anti-BMPlO antibody may inhibit BMPIO from binding to a cognate type I and/or type II receptor (e.g., ActRIIA, ActRIIB, and ALK4) and thus inhibit BMP 10- mediated signaling (e.g., Smad signaling) via these receptors.
- a cognate type I and/or type II receptor e.g., ActRIIA, ActRIIB, and ALK4
- BMP 10- mediated signaling e.g., Smad signaling
- an anti- BMP10 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more additional ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB,
- additional ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP9, TGFpl, TGFp2, and TGFp3] and/or binds to one or more type I and/or type II receptors (e.g., ActRIIA, ActRI
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-BMPlO antibody and one or more additional antibodies that bind to, for example, different ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP9, TGFpl, TGFp2, and TGFp3] and/or bind to one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK5, and ALK4).
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- type I and/or type II receptors e.g., ActRII
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least an ActRII receptor (e.g., ActRIIA and/or
- an ActRII antagonist antibody binds to at least ActRIIA, but does not bind or does not substantially bind to ActRIIB (e.g., binds to ActRIIB with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- an ActRII antagonist antibody, or combination of antibodies binds to at least ActRIIB, but does not bind or does not substantially bind to ActRIIA (e.g., binds to ActRIIA with a K D of greater than 1 x 10 "7 M or has relatively modest binding, e.g., about 1 x 10 "8 M or about 1 x 10 "9 M).
- an ActRII antagonist antibody, or combination of antibodies binds to at least ActRIIA and ActRIIB.
- an ActRII antibody generally refers to an antibody that binds to ActRII (e.g., ActRIIA and/or ActRIIB) with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ActRII.
- the extent of binding of an anti-ActRII antibody to an unrelated, non- ActRII protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ActRII as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- an anti-ActRII antibody binds to an epitope of ActRII (e.g., ActRIIA and/or ActRIIB) that is conserved among ActRII from different species. In certain preferred embodiments, an anti-ActRII antibody binds to human ActRII (e.g., ActRIIA and/or ActRIIB).
- an anti-ActRII antibody may inhibit one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, and BMP9] from binding to ActRII (e.g., ActRIIA and/or ActRIIB).
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3, BMP6, BMP 10, and BMP9 e.g., ligands
- ActRIIA has sequence homology to ActRIIB and therefore antibodies that bind to ActRIIA, in some cases, may also bind to and/or inhibit ActRIIB, the reverse is also true.
- an anti-ActRII antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ActRII (e.g., ActRIIA and/or ActRIIB) and one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpi, TGFP2, and TGFP3].
- an anti-ActRII antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ActRIIA and ActRIIB.
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises at least an anti-ActRIIA antibody and at least an ActRIIB antibody.
- the disclosure relates to
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFP3
- TGFpRII e.g., TGFpRII, ALK4, and/or ALK5.
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-ActRIIB antibody and one or more additional antibodies that bind to, for example, one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFP3], TGFpRII, ALK4, and/or ALK5.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFP3
- TGFpRII e.g., TGFpRII, ALK4, and/or ALK5.
- the disclosure relates to combinations of antibodies, as well as uses thereof (e.g., increasing an immune response in a subject in need thereof and treating cancer), wherein the combination of antibodies comprises an anti-ActRIIA antibody, an anti-ActRIIB antibody, and at least one or more additional antibodies that bind to, for example, one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ALK4, and/or ALK5.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3
- TGFpRII e.g., ALK
- an ActRII antagonist antibody, or combination of antibodies, of the disclosure is an antibody that inhibits at least ALK4. Therefore, in some embodiments, an ActRII antagonist antibody, or combination of antibodies, binds to at least ALK4.
- an ALK4 antibody (anti-ALK4 antibody) generally refers to an antibody that binds to ALK4 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ALK4.
- the extent of binding of an anti-ALK4 antibody to an unrelated, non-ALK4 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ALK4 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ALK4 antibody binds to an epitope of ALK4 that is conserved among ALK4 from different species.
- an anti-ALK4 antibody binds to human ALK4.
- an anti-ALK4 antibody may inhibit one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9] from binding to ALK4.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- an anti-ALK4 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to ALK4 and one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ActRII (ActRIIA and/or ActRIIB) and/or ALK5.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3
- TGFpRII ActRIIA and/or ActRIIB
- ActRIIA and/or ActRIIB ActRIIA and/or ActRIIB
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-ALK4 antibody and one or more additional antibodies that bind to, for example, one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, and BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ActRII (ActRIIA and/or ActRIIB) and/or ALK5.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP 10, and BMP9, TGFpl, TGFp2, and TGFp3
- TGFpRII ActRIIA and/or ActRIIB
- ActRIIA and/or ActRIIB ActRII
- a TGFpRII antagonist to be used in accordance with the methods and uses disclosed herein is a TGFpRII antagonist antibody or combination of antibodies.
- a TGFpRII antagonist antibody, or combination of antibodies may inhibit and/or bind to, for example, one or more TGFpRII ligands (e.g., TGFpl, TGFp2, and TGFp3), TGFpRII receptor, TGFpRII-associated type I receptor (e.g., ALK5), and/or TGFpRII co-receptor (e.g., betaglycan).
- TGFpRII ligands e.g., TGFpl, TGFp2, and TGFp3
- TGFpRII receptor e.g., TGFpRII-associated type I receptor
- TGFpRII co-receptor e.g., betaglycan.
- the ability for a TGFpRII antagonist antibody, or combination of antibody, to inhibit signaling (e.g., Smad signaling) and/or bind to a target is determined in an in vitro or cell-based assay including, for example, those described herein.
- a TGFpRII antagonist antibody, or combination of antagonist antibodies may be used alone or in combination with one or more additional supportive therapies or active agents (e.g., an ActRII antagonists) to treat or prevent a disorder or condition as described herein.
- a TGFpRII antagonist antibody, or combination of antibodies is an antibody that inhibits at least TGFpi . Therefore, in some embodiments, a TGFpRII antagonist antibody, or combination of antibodies, binds to at least TGFpi .
- a TGFpi antibody (anti-TGFpi antibody) generally refers to an antibody that binds to TGFpi with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting TGFpi .
- the extent of binding of an anti-TGFpi antibody to an unrelated, non-TGFpi protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than 1% of the binding of the antibody to TGFpl as measured, for example, by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an anti- TGFpi antibody binds to an epitope of TGFpi that is conserved among TGFpi from different species.
- an anti-TGFpi antibody binds to human TGFpi .
- a TGFpi antibody may inhibit TGFpi from binding to a type I, type II, and/or co-receptor (e.g., TGFpRII, ALK5, and/or betaglycan) and thus inhibit TGFpi signaling (e.g., Smad signaling).
- TGFpi shares some sequence homology to TGFP2 and TGFP3. Therefore antibodies that bind TGFpi, in some embodiments, may also bind to TGFP2 and/or TGFP3.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to TGFpi and further binds to, for example, one or more additional TGFpRII ligands (e.g., TGFP2, TGFP3, or TGFP2 and TGFP3), one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), and/or one or more co-receptors (e.g., betaglycan).
- TGFpRII ligands e.g., TGFP2, TGFP3, or TGFP2 and TGFP3
- type I and/or type II receptors e.g., TGFpRII and ALK5
- co-receptors e.g., betaglycan.
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a TGFpi antibody and one or more additional antibodies that bind to, for example, one or more additional TGFpRII ligands (e.g., TGFP2, TGFP3, or TGFP2 and TGFP3), one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), and/or one or more co-receptors (e.g., betaglycan).
- additional TGFpRII ligands e.g., TGFP2, TGFP3, or TGFP2 and TGFP3
- type I and/or type II receptors e.g., TGFpRII and ALK5
- co-receptors e.g., betaglycan
- an anti- TGFpi antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more ActRII ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], TGFpRII, ActRII (ActRIIA and/or ActRIIB), ALK4, ALK5, and/or betaglycan.
- ActRII ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- TGFpRII, ActRII ActRIIA and/or ActRIIB
- ALK4 ALK5
- betaglycan e.g., betaglycan.
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti- TGFpi antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], TGFpRII, ActRII (ActRIIA and/or ActRIIB) ALK4, ALK5, and/or betaglycan.
- ActRIIB ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- TGFpRII TGFpRII
- ActRIIA and/or ActRIIB ALK4, ALK5, and/or betaglycan.
- a TGFpRII antagonist antibody, or combination of antibodies is an antibody that inhibits at least TGFP2. Therefore, in some embodiments, a TGFpRII antagonist antibody, or combination of antibodies, binds to at least TGFP2.
- a TGFP2 antibody (anti-TGFp2 antibody) generally refers to an antibody that is capable of binding to TGFP2 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting TGFP2.
- the extent of binding of an anti-TGFp2 antibody to an unrelated, non-TGFp2 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than 1% of the binding of the antibody to TGFP2 as measured, for example, by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an anti-TGFp2 antibody binds to an epitope of TGFP2 that is conserved among TGFP2 from different species.
- an anti-TGFp2 antibody binds to human TGFP2.
- a TGFP2 antibody may inhibit TGFP2 from binding to a type I, type II, and/or co-receptor (e.g., TGFpRII, ALK5, and/or betaglycan) and thus inhibit TGFP2 signaling (e.g., Smad signaling).
- TGFP2 shares some sequence homology to TGFpi and TGFP3. Therefore antibodies that bind TGFP2, in some embodiments, may also bind to TGFpi and/or TGFP3.
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to TGFP2 and further binds to, for example, one or more additional TGFpRII ligands (e.g., TGFpi, TGFP3, or TGFpi and TGFP3), one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), and/or one or more co-receptors (e.g., betaglycan)
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises a TGFP2 antibody and one or more additional antibodies that bind to, for example, one or more additional TGFpRII ligands (e.g., TGFpi, TGFP3, or TGFpi and TGFP3), one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), and/or
- an anti-TGFp2 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more ActRII ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], TGFpRII, ActRII (ActRIIA and/or ActRIIB), ALK4, ALK5, and/or betaglycan.
- ActRII ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-TGFp2 antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], TGFpRII, ActRII (ActRIIA and/or ActRIIB) ALK4, ALK5, and/or betaglycan.
- ActRIIB ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- a TGFpRII antagonist antibody, or combination of antibodies is an antibody that inhibits at least TGFP3. Therefore, in some embodiments, a TGFpRII antagonist antibody, or combination of antibodies, binds to at least TGFP3.
- a TGFP3 antibody (anti-TGFp3 antibody) generally refers to an antibody that is capable of binding to TGFP3 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting TGFP3.
- the extent of binding of an anti-TGFp3 antibody to an unrelated, non-TGFp3 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than 1% of the binding of the antibody to TGFP3 as measured, for example, by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an anti-TGFp3 antibody binds to an epitope of TGFP3 that is conserved among TGFP3 from different species.
- an anti-TGFp3 antibody binds to human TGFP3.
- a TGFP3 antibody may inhibit TGFP3 from binding to a type I, type II, and/or co-receptor (e.g., TGFpRII, ALK5, and/or betaglycan) and thus inhibit TGFP3 signaling (e.g., Smad signaling).
- TGFP3 shares some sequence homology to TGFP2 and TGFpi . Therefore antibodies that bind TGFP3, in some embodiments, may also bind to TGFP2 and/or TGFpi .
- the disclosure relates to a multispecific antibody (e.g., bi-specific antibody), and uses thereof, that binds to TGFP3 and further binds to, for example, one or more additional TGFpRII ligands (e.g., TGFP2, TGFpi, or TGFP2 and TGFpi), one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), and/or one or more co-receptors (e.g., betaglycan).
- TGFpRII ligands e.g., TGFP2, TGFpi, or TGFP2 and TGFpi
- type I and/or type II receptors e.g., TGFpRII and ALK5
- co-receptors e.g., betaglycan
- an anti-TGFp3 antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to one or more ActRII ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], TGFpRII, ActRII (ActRIIA and/or ActRIIB), ALK4, ALK5, and/or betaglycan.
- ActRII ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- the disclosure relates to combinations of antibodies, as well as uses thereof, wherein the combination of antibodies comprises an anti-TGFp3 antibody and one or more additional antibodies that bind to, for example, one or more ActRIIB ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, and BMP9], TGFpRII, ActRII (ActRIIA and/or ActRIIB) ALK4, ALK5, and/or betaglycan.
- ActRIIB ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, and BMP9]
- a TGFpRII antagonist antibody, or combination of antibodies is an antibody that inhibits at least TGFpRII. Therefore, in some embodiments, a TGFpRII antagonist antibody, or combination of antibodies, binds to at least TGFpRII.
- a TGFpRII antibody (anti-TGFpRII antibody) generally refers to an antibody that binds to TGFpRII with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting TGFpRII.
- the extent of binding of an anti -TGFpRII antibody to an unrelated, non-TGFpRII protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to TGFpRII as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein- protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-TGFpRII antibody binds to an epitope of TGFpRII that is conserved among TGFpRII from different species.
- an anti-TGFpRII antibody binds to human TGFpRII.
- an anti-TGFpRII antibody may inhibit one or more TGFpRII ligands [e.g., TGFpl; TGFp2; TGFp3; TGFpl and TGFp3; TGFpl and TGFp2; TGFp2 and TGFp3; or TGFpl, TGFp2, and TGFp3] from binding to TGFpRII.
- TGFpRII ligands e.g., TGFpl; TGFp2; TGFp3; TGFpl and TGFp3; TGFpl and TGFp2; TGFp2 and TGFp3; or TGFpl, TGFp2, and TGFp3
- an anti-TGFpRII antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to TGFpRII and one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRII (ActRIIA and/or ActRIIB) ALK5 and/or betaglycan.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3
- ActRII ActRIIA and/or ActRIIB
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-TGFpRII antibody and one or more additional antibodies that bind to, for example, one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3], ActRII (ActRIIA and/or ActRIIB) ALK5 and/or betaglycan.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3
- ActRII ActRIIA and/or ActRIIB
- a TGFpRII antagonist antibody, or combination of antibodies is an antibody that inhibits at least ALK5. Therefore, in some embodiments, a TGFpRII antagonist antibody, or combination of antibodies, binds to at least ALK5.
- an ALK5 antibody (anti-ALK5antibody) generally refers to an antibody that binds to ALK5 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting ALK5.
- the extent of binding of an anti-ALK5 antibody to an unrelated, non-ALK5 protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to ALK5 as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-ALK5 antibody binds to an epitope of ALK5 that is conserved among ALK5 from different species.
- an anti- ALK5 antibody binds to human ALK5.
- an anti-ALK5 antibody may inhibit one or more TGFpRII ligands [e.g., TGFpl; TGFp2; TGFp3; TGFpl and TGFp3; TGFpl and TGFp2; TGFp2 and TGFp3; or TGFpl, TGFp2, and TGFp3] from binding to ALK5.
- TGFpRII ligands e.g., TGFpl; TGFp2; TGFp3; TGFpl and TGFp3; TGFpl and TGFp2; TGFp2 and TGFp3; or TGFpl, TGFp2, and TGFp3
- an anti-ALK5 antibody is a multispecific antibody (e.g., bi- specific antibody) that binds to ALK5 and one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ActRII (ActRIIA and/or ActRIIB) and/or betaglycan.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3
- TGFpRII ActRIIA and/or ActRIIB
- ActRIIA and/or ActRIIB ActRIIA and/or ActRIIB
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-ALK5 antibody and one or more additional antibodies that bind to, for example, one or more TGFpRII ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ActRII (ActRIIA and/or ActRIIB) and/or betaglycan.
- a TGFpRII antagonist antibody, or combination of antibodies is an antibody that inhibits at least betaglycan.
- a TGFpRII antagonist antibody binds to at least betaglycan.
- a betaglycan antibody generally refers to an antibody that binds to betaglycan with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting betaglycan.
- the extent of binding of an anti -betaglycan antibody to an unrelated, non-betaglycan protein is less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or less than about 1% of the binding of the antibody to betaglycan as measured, for example, by a radioimmunoassay (RIA), Biacore, or other protein-protein interaction or binding affinity assay.
- RIA radioimmunoassay
- Biacore Biacore
- an anti-betaglycan antibody binds to an epitope of betaglycan that is conserved among betaglycan from different species.
- an anti-betaglycan antibody binds to human betaglycan.
- an anti-betaglycan antibody may inhibit one or more TGFpRII ligands [e.g., TGFpl; TGFp2; TGFp3; TGFpl and TGFp3; TGFpl and TGFp2; TGFp2 and TGFp3; or TGFpl, TGFp2, and TGFp3] from binding to betaglycan.
- TGFpRII ligands e.g., TGFpl; TGFp2; TGFp3; TGFpl and TGFp3; TGFpl and TGFp2; TGFp2 and TGFp3; or TGFpl, TGFp2, and TGFp3
- an anti -betaglycan antibody is a multispecific antibody (e.g., bi-specific antibody) that binds to betaglycan and one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ActRII (ActRIIA and/or ActRIIB) and/or ALK5.
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3
- TGFpRII ActRIIA and/or ActRIIB
- ActRIIA and/or ActRIIB ActRIIA and/or ActRIIB
- the disclosure relates to combinations of antibodies, and uses thereof, wherein the combination of antibodies comprises an anti-betaglycan antibody and one or more additional antibodies that bind to, for example, one or more TGFpRII ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], TGFpRII, ActRII (ActRIIA and/or ActRIIB) and/or ALK5.
- TGFpRII ligands e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3]
- TGFpRII ActRIIA and/or ActRIIB
- antibody is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
- An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments. See, e.g., Hudson et al.
- Antibodies disclosed herein may be polyclonal antibodies or monoclonal antibodies.
- the antibodies of the present disclosure comprise a label attached thereto and able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme, or enzyme co-factor).
- the antibodies of the present disclosure are isolated antibodies.
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, e.g., EP 404,097; WO 1993/01161; Hudson et al. (2003) Nat. Med. 9: 129- 134 (2003); and Hollinger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448.
- Triabodies and tetrabodies are also described in Hudson et al. (2003) Nat. Med. 9: 129-134.
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy-chain variable domain or all or a portion of the light-chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody. See, e.g., U.S. Pat. No. 6,248,516.
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
- recombinant host cells e.g., E. coli or phage
- the antibodies herein may be of any class.
- the class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu.
- an antibody for use in the methods disclosed herein specifically binds to its target antigen, preferably with high binding affinity.
- Affinity may be expressed as a K D value and reflects the intrinsic binding affinity (e.g., with minimized avidity effects).
- binding affinity is measured in vitro, whether in a cell-free or cell-associated setting. Any of a number of assays known in the art, including those disclosed herein, can be used to obtain binding affinity measurements including, for example, surface plasmon resonance (BiacoreTM assay), radiolabeled antigen binding assay (RIA), and ELISA.
- BiacoreTM assay surface plasmon resonance
- RIA radiolabeled antigen binding assay
- ELISA ELISA
- antibodies of the present disclosure bind to their target antigens [e.g., ActRIIB, ActRIIA, ALK4, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan] with at least a K D of lx 10 "7 or stronger, lxlO "8 or stronger, lxlO "9 or stronger, lxlO "10 or stronger, lxlO "11 or stronger, lxlO "12 or stronger, lxlO "13 or stronger, or lxlO "14 or stronger.
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 BMP6, BMP10, BMP9, TGFpl
- K D is measured by RIA performed with the Fab version of an antibody of interest and its target antigen as described by the following assay.
- Solution binding affinity of Fabs for the antigen is measured by equilibrating Fab with a minimal concentration of radiolabeled antigen ⁇ e.g., 125 I-labeled) in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate [see, e.g., Chen et al. (1999) J. Mol. Biol. 293 :865-881].
- multi-well plates e.g., MICROTITER ® from Thermo Scientific
- a capturing anti-Fab antibody e.g., from Cappel Labs
- bovine serum albumin preferably at room temperature (e.g., approximately 23°C).
- radiolabeled antigen are mixed with serial dilutions of a Fab of interest [e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al, (1997) Cancer Res. 57:4593-4599].
- the Fab of interest is then incubated, preferably overnight but the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation, preferably at room temperature for about one hour. The solution is then removed and the plate is washed times several times, preferably with polysorbate 20 and PBS mixture. When the plates have dried, scintillant (e.g., MICROSCINT ® from Packard) is added, and the plates are counted on a gamma counter (e.g., TOPCOUNT ® from Packard).
- K D is measured using surface plasmon resonance assays using, for example a BIACORE ® 2000 or a BIACORE ® 3000 (Biacore, Inc.,
- CM5 carboxymethylated dextran biosensor chips
- EDC N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N- hydroxysuccinimide
- an antigen can be diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml (about 0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10 response units (RU) of coupled protein.
- a fluorescent quenching technique measures
- nucleic acid and amino acid sequences of human ActRIIB, ActRIIA, ALK4, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan are well known in the art and thus antibody antagonists for use in accordance with this disclosure may be routinely made by the skilled artisan based on the knowledge in the art and teachings provided herein.
- an antibody provided herein is a chimeric antibody.
- a chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species. Certain chimeric antibodies are described, for example, in U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. Acad. Sci. USA, 81 :6851-6855.
- a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non- human primate, such as a monkey) and a human constant region.
- a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody.
- chimeric antibodies include antigen- binding fragments thereof.
- a chimeric antibody provided herein is a humanized antibody.
- a humanized antibody refers to a chimeric antibody comprising amino acid residues from non-human hypervariable regions (HVRs) and amino acid residues from human framework regions (FRs).
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
- Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit” method [see, e.g., Sims et al.
- an antibody provided herein is a human antibody.
- Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel (2001) Curr. Opin. Pharmacol. 5: 368-74 and Lonberg (2008) Curr. Opin. Immunol. 20:450-459.
- Human antibodies may be prepared by administering an immunogen [e.g., ActRIIB, ActRIIA, ALK4, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan] to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
- an immunogen e.g., ActRIIB, ActRIIA, ALK4, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan]
- an immunogen e.g., ActRI
- Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes.
- the endogenous immunoglobulin loci have generally been inactivated.
- Human variable regions from intact antibodies generated by such animals may be further modified, for example, by combining with a different human constant region.
- Human antibodies provided herein can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described [see, e.g., Kozbor J.
- Human antibodies provided herein may also be generated by isolating Fv clone variable-domain sequences selected from human-derived phage display libraries. Such variable-domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described herein.
- antibodies of the present disclosure may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities.
- a variety of methods are known in the art for generating phage-display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, for example, in Hoogenboom et al. (2001) in Methods in Molecular Biology 178: 1- 37, O'Brien et al, ed., Human Press, Totowa, N.J. and further described, for example, in the McCafferty et al. (1991) Nature 348:552-554; Clackson et al, (1991) Nature 352: 624-628; Marks et al. (1992) J. Mol. Biol.
- Libraries from immunized sources provide high-affinity antibodies to the immunogen [e.g., ActRIIB, ActRIIA, ALK4, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan] without the requirement of constructing hybridomas.
- the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies directed against a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al.
- naive libraries can also be made synthetically by cloning un-rearranged V-gene segments from stem cells and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish
- Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and U.S. Patent Publication Nos. 2005/0079574,
- an antibody provided herein is a multispecific antibody, for example, a bispecific antibody.
- Multispecific antibodies typically monoclonal antibodies
- octopus antibodies are also included herein (see, e.g., US 2006/0025576A1).
- the antibodies disclosed herein are monoclonal antibodies.
- Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations which typically include different antibodies directed against different epitopes
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present methods may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols [see, e.g., Antibodies: A Laboratory Manual (1988) ed. by Harlow and Lane, Cold Spring Harbor Press].
- a mammal such as a mouse, hamster, or rabbit can be immunized with an immunogenic form of the GDF11 polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of a GDF11 polypeptide can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibody production and/or level of binding affinity.
- antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
- immortalizing cells such as myeloma cells.
- Hybridoma cells can be screened for human monoclonal antibodies.
- the Fc-region variant may comprise a human Fc-region sequence ⁇ e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution, deletion, and/or addition) at one or more amino acid positions.
- the present disclosure contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet for which certain effector functions [e.g., complement-dependent cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (CDC) and antibody-dependent cellular cytotoxicity (CDC) and antibody-dependent cellular .
- CDC complement-dependent cytotoxicity
- cytotoxicity are unnecessary or deleterious.
- In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- the primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
- FcR expression on hematopoietic cells is summarized in, for example, Ravetch and Kinet (1991) Annu. Rev. Immunol. 9:457-492.
- Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Pat. No. 5,500,362; Hellstrom, I. et al. (1986) Proc. Nat'l Acad. Sci. USA 83 :7059-7063; Hellstrom, I et al. (1985) Proc. Nat'l Acad. Sci. USA 82: 1499-1502; U.S. Pat. No. 5,821,337; and Bruggemann, M. et al. (1987) J. Exp. Med. 166: 1351-1361.
- nonradioactive assay methods may be employed ⁇ e.g., ACTITM, non-radioactive cytotoxicity assay for flow cytometry; CellTechnology, Inc. Mountain View, Calif; and CytoTox 96 ® non-radioactive cytotoxicity assay, Promega, Madison, Wis.).
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and natural killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK natural killer
- ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. (1998) Proc. Nat'l Acad. Sci. USA 95:652-656.
- Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity [see, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402].
- a CDC assay may be performed [see, e.g., Gazzano-Santoro et al. (1996) J.
- Antibodies of the present disclosure with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056).
- Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
- cysteine-engineered antibodies e.g., "thioMAbs”
- one or more residues of an antibody are substituted with cysteine residues.
- the substituted residues occur at accessible sites of the antibody.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
- any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy-chain Fc region.
- Cysteine engineered antibodies may be generated as described, for example., in U.S. Pat. No. 7,521,541.
- the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding. A variety of different techniques are available for testing interaction between antibodies and antigens to identify particularly desirable antibodies.
- Such techniques include ELISAs, surface plasmon resonance binding assays (e.g., the BiacoreTM binding assay, Biacore AB, Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN
- amino acid sequence variants of the antibodies and/or the binding polypeptides provided herein are contemplated.
- Amino acid sequence variants of an antibody and/or binding polypeptides may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody and/or binding polypeptide, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into, and/or substitutions of residues within, the amino acid sequences of the antibody and/or binding polypeptide.
- any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., target- binding (ActRIIB, ActRIIA, ALK4, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan binding).
- target- binding ActRIIB, ActRIIA, ALK4, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, TGFp3, TGFpRII, ALK5 and/or betaglycan binding).
- Alterations may be made in HVRs, for example, to improve antibody affinity.
- Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury (2008) Methods Mol. Biol. 207: 179-196 (2008)), and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity.
- affinity maturation by constructing and reselecting from secondary libraries has been described in the art [see, e.g., Hoogenboom et al, in Methods in Molecular Biology 178: 1-37, O'Brien et al., ed., Human Press, Totowa, N.J., (2001)].
- diversity is introduced into the variable genes chosen for maturation by any of a variety of methods ⁇ e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
- a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
- HVR-directed approaches in which several HVR residues ⁇ e.g., 4-6 residues at a time) are randomized.
- HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling.
- CDR-H3 and CDR-L3 in particular are often targeted.
- substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind to the antigen.
- conservative alterations ⁇ e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs.
- Such alterations may be outside of HVR "hotspots" or SDRs.
- each HVR either is unaltered, or contains no more than one, two, or three amino acid substitutions.
- a useful method for identification of residues or regions of the antibody and/or the binding polypeptide that may be targeted for mutagenesis is called “alanine scanning mutagenesis", as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
- a residue or group of target residues ⁇ e.g., charged residues such as arg, asp, his, lys, and glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- a crystal structure of an antigen-antibody complex can be used to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
- Amino-acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue.
- Other insertional variants of the antibody molecule include fusion of the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- an antibody and/or binding polypeptide provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody and/or binding polypeptide include but are not limited to water-soluble polymers.
- Non-limiting examples of water-soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l,3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, proly propylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
- PEG polyethylene glycol
- copolymers of ethylene glycol/propylene glycol carboxymethylcellulose
- dextran polyvinyl alcohol
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody and/or binding polypeptide may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody and/or binding
- polypeptide to be improved whether the antibody derivative and/or binding polypeptide derivative will be used in a therapy under defined conditions.
- ActRII antagonist that is small molecule, or combination of small molecules.
- ActRII antagonist small molecules may inhibit to one or more ActRII ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, and ALK4), or one or more ActRII downstream signaling components (e.g., Smads 2 and/or 3).
- ActRII ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- type I and/or type II receptors e.g., ActRIIA, ActRIIB,
- the disclosure provides methods of using an ActRII antagonist small molecules, or combination of ActRII antagonist small molecules, alone or in combination with one or more additional supportive therapies and/or active agents (e.g., TGFp antagonists), to achieve a desired effect in a subject in need thereof (e.g., increase an immune response in a subject in need thereof and treat cancer or a pathogen).
- additional supportive therapies and/or active agents e.g., TGFp antagonists
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least GDF11.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits GDF11 further inhibits one or more ligand [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least GDF8.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits GDF8 further inhibits one or more ligand [e.g., GDF11, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- GDF11 activin
- activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan e.g., ligand
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least activin (e.g., activin A, activin B, activin C, activin E, activin AB, and activin AE).
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits activin further inhibits one or more ligand [e.g., GDF11, GDF8, GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least GDF3.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits GDF3 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), BMP6, BMP 10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least BMP6.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits BMP6 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least BMP 10.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits BMPIO further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least BMP9.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits BMP9 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least ActRIIA.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits ActRIIA further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least ActRIIB.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits ActRIIB further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least ALK4.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits ALK4 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpi, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- the present disclosure relates to a TGFp antagonist (inhibitor) that is small molecule, or combination of small molecules.
- TGFp antagonist small molecules may inhibit to one or more TGFP ligands [e.g., TGFpi, TGFP2, and TGFP3], one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), one or more co-receptor (e.g., betaglycan) and/or one or more TGFP downstream signaling components (e.g., Smads 2 and/or 3).
- TGFP ligands e.g., TGFpi, TGFP2, and TGFP3
- type I and/or type II receptors e.g., TGFpRII and ALK5
- co-receptor e.g., betaglycan
- TGFP downstream signaling components e.g., Smads 2 and/or 3
- a TGFP antagonist small molecules or combination of TGFP antagonist small molecules, alone or in combination with one or more additional supportive therapies and/or active agents (e.g., ActRII antagonists), to achieve a desired effect in a subject in need thereof (e.g., increase an immune response in a subject in need thereof and treat cancer or a pathogen).
- a TGFP antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least TGFpi .
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits TGFpi further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least TGFP2.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits TGFP2 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpi, and TGFp3], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least TGFP3.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits TGFP3 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpi, and TGFp2], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least TGFP3.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits TGFP3 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP 10, BMP9, TGFpl, and TGFp2], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFp antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least TGFpRII.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits TGFpRII further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, and/or betaglycan.
- a TGFp antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least ALK5.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits ALK5 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a small molecule antagonist, or combination of small molecule antagonists, that inhibits at least betaglycan.
- a small molecule antagonist, or combination of small molecule antagonists, that inhibits betaglycan further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, and/or TGFpRII.
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- ActRIIA ActRIIB
- ALK5 a small molecule antagonist, or combination of small molecule antagonists, that inhibits betaglycan
- Small molecule antagonists can be direct or indirect inhibitors.
- an indirect small molecule antagonist, or combination of small molecule antagonists may inhibit the expression (e.g., transcription, translation, cellular secretion, or combinations thereof) of at least one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, abd TGFp3], one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK4, and ALK5), one or more co-receptors (betaglycan) or one or more ActRII downstream signaling components (e.g., Smads 2 and/or 3).
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin
- a direct small molecule ActRII antagonist may directly bind to, for example, one or more of one or more ligands [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, abd TGFP3], one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, TGFpRII, ALK4, and ALK5), one or more co-receptors (betaglycan) or one or more ActRII
- GDF8 activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3 GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, abd TGFP3
- type I and/or type II receptors e.g., ActRI
- downstream signaling components e.g., Smads 2 and/or 3
- Combinations of one or more indirect and one or more direct small molecule antagonists may be used in accordance with the methods disclosed herein.
- Binding organic small molecule antagonists of the present disclosure may be identified and chemically synthesized using known methodology (see, e.g., PCT Publication Nos. WO 00/00823 and WO 00/39585).
- small molecule antagonists of the disclosure are usually less than about 2000 daltons in size, alternatively less than about 1500, 750, 500, 250 or 200 daltons in size, wherein such organic small molecules that are capable of binding, preferably specifically, to a polypeptide as described herein.
- Such small molecule antagonists may be identified without undue experimentation using well-known techniques.
- Binding organic small molecules of the present disclosure may be, for example, aldehydes, ketones, oximes, hydrazones, semicarbazones, carbazides, primary amines, secondary amines, tertiary amines, N-substituted hydrazines, hydrazides, alcohols, ethers, thiols, thioethers, disulfides, carboxylic acids, esters, amides, ureas, carbamates, carbonates, ketals, thioketals, acetals, thioacetals, aryl halides, aryl sulfonates, alkyl halides, alkyl sulfonates, aromatic compounds, heterocyclic compounds, anilines, alkenes, alkynes, diols, amino alcohols, oxazolidines, oxazolines, thiazolidines, thiazolines, enamines, sulfonamide
- ActRII antagonist that is a polynucleotide, or combination of polynucleotides.
- ActRII antagonist polynucleotides may inhibit to one or more ActRII ligands [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9], one or more type I and/or type II receptors (e.g., ActRIIA, ActRIIB, and ALK4), or one or more ActRII downstream signaling components (e.g., Smads 2 and/or 3).
- ActRII ligands e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, and BMP9]
- type I and/or type II receptors
- the disclosure provides methods of using an ActRII antagonist polynucleotide, or combination of ActRII antagonist polynucleotides, alone or in combination with one or more additional supportive therapies and/or active agents (e.g., TGFpPJI antagonists), to achieve a desired effect in a subject in need thereof (e.g., increase an immune response in a subject in need thereof and treat cancer or pathogen).
- additional supportive therapies and/or active agents e.g., TGFpPJI antagonists
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least GDF11.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits GDF11 further inhibits one or more ligand [e.g., GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least GDF8.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits GDF8 further inhibits one or more ligand [e.g., GDF11, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- GDF11 e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3 e.g., ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least activin (e.g., activin A, activin B, activin C, activin E, activin AB, and activin AE).
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits activin further inhibits one or more ligand [e.g., GDF11, GDF8, GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII polynucleotide is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least GDF3.
- a polynucleotide, or combination of polynucleotide antagonists, that inhibits GDF3 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least BMP6.
- a ligand e.g., GDF11, GDF8, activin (e.g.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least BMPIO.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits BMPIO further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least BMP9.
- a ligand e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP9, TGFpl, TGFp2, and T
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least ActRIIA.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits ActRIIA further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMPIO, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIB, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least ActRIIB.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits ActRIIB further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMPIO, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ALK4, ALK5, TGFpRII, and/or betaglycan.
- an ActRII antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least ALK4.
- a ligand e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMPIO, BMP9, TGFpl, TGF
- polynucleotide antagonist or combination of polynucleotide antagonists, that inhibits ALK4 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMPIO, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- the present disclosure relates to a TGFp antagonist (inhibitor) that is polynucleotide, or combination of polynucleotides.
- TGFP antagonist polynucleotides may inhibit to one or more TGFP ligands [e.g., TGFpi, TGFP2, and TGFP3], one or more type I and/or type II receptors (e.g., TGFpRII and ALK5), one or more co-receptor (e.g., betaglycan) and/or one or more TGFP downstream signaling components (e.g., Smads 2 and/or 3).
- TGFP ligands e.g., TGFpi, TGFP2, and TGFP3
- type I and/or type II receptors e.g., TGFpRII and ALK5
- co-receptor e.g., betaglycan
- TGFP downstream signaling components e.g., Smads 2 and/or 3
- the disclosure provides methods of using an TGFP antagonist polynucleotide, or combination of TGFP antagonist polynucleotides, alone or in combination with one or more additional supportive therapies and/or active agents (e.g., ActRII antagonists), to achieve a desired effect in a subject in need thereof (e.g., increase an immune response in a subject in need thereof and treat cancer or a pathogen).
- additional supportive therapies and/or active agents e.g., ActRII antagonists
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least TGFpi .
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits TGFpi further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least TGFP2.
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least TGFP2.
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists,
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits TGFP2 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpi, and TGFp3], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits TGFP3 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpi, and TGFp2], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3, BMP6, BMP10, BMP9, TGFpi, and TGFp2 e.g., ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least TGFP3. In some embodiments, a polynucleotide antagonist, or combination of
- polynucleotide antagonists that inhibits TGFP3 further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpi, and TGFp2], ActRIIA, ActRIIB, ALK5, TGFpRII, and/or betaglycan.
- a TGFp antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least TGFpRII.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits TGFpRII further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, and/or betaglycan.
- a TGFp antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least ALK5.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits ALK5 further inhibits one or more ligand [e.g., GDF1 1, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, TGFpRII, and/or betaglycan.
- a TGFP antagonist is a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits at least betaglycan.
- a polynucleotide antagonist, or combination of polynucleotide antagonists, that inhibits betaglycan further inhibits one or more ligand [e.g., GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC), GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3], ActRIIA, ActRIIB, ALK5, and/or TGFpRII.
- GDF11, GDF8, activin e.g., activin A, activin B, activin C, activin E, activin AB, activin AC
- GDF3, BMP6, BMP10, BMP9, TGFpl, TGFp2, and TGFp3 e.g., ActRIIA, ActRIIB, ALK5, and/or TGFpRII.
- the polynucleotide antagonists of the present disclosure may be an antisense nucleic acid, an RNAi molecule [e.g., small interfering RNA (siRNA), small-hairpin RNA (shRNA), microRNA (miRNA)], an aptamer and/or a ribozyme.
- RNAi molecule e.g., small interfering RNA (siRNA), small-hairpin RNA (shRNA), microRNA (miRNA)
- siRNA small interfering RNA
- shRNA small-hairpin RNA
- miRNA microRNA
- nucleic acid and amino acid sequences of human ALK4, ALK5, ActRIIA, ActRIIB, TGFpRII, betaglycan, GDF11, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP 10, BMP9, TGFpl, TGFp2, TGFp3, and betaglycan, are known in the art and thus polynucleotide antagonists for use in accordance with methods of the present disclosure may be routinely made by the skilled artisan based on the knowledge in the art and teachings provided herein.
- antisense technology can be used to control gene expression through antisense DNA or RNA, or through triple-helix formation.
- Antisense techniques are discussed, for example, in Okano (1991) J. Neurochem. 56:560; Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988).
- Triple helix formation is discussed in, for instance, Cooney et al. (1988) Science 241 :456; and Dervan et al., (1991)Science 251 : 1300.
- the methods are based on binding of a polynucleotide to a complementary DNA or RNA.
- the antisense nucleic acids comprise a single-stranded RNA or DNA sequence that is complementary to at least a portion of an RNA transcript of a desired gene.
- absolute complementarity although preferred, is not required.
- a sequence "complementary to at least a portion of an RNA,” referred to herein, means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double-stranded antisense nucleic acids of a gene disclosed herein, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed.
- the ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid.
- the larger the hybridizing nucleic acid the more base mismatches with an RNA it may contain and still form a stable duplex (or triplex as the case may be).
- One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
- Polynucleotides that are complementary to the 5' end of the message should work most efficiently at inhibiting translation.
- sequences complementary to the 3'- untranslated sequences of mRNAs have been shown to be effective at inhibiting translation of mRNAs as well [see, e.g., Wagner, R., (1994) Nature 372:333-335].
- oligonucleotides complementary to either the 5'- or 3 '-untranslated, noncoding regions of a gene of the disclosure could be used in an antisense approach to inhibit translation of an endogenous mRNA.
- Polynucleotides complementary to the 5'-untranslated region of the mRNA should include the complement of the AUG start codon.
- Antisense polynucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could be used in accordance with the methods of the present disclosure. Whether designed to hybridize to the 5'-untranslated, 3 '-untranslated, or coding regions of an mRNA of the disclosure, antisense nucleic acids should be at least six nucleotides in length, and are preferably oligonucleotides ranging from 6 to about 50 nucleotides in length. In specific aspects, the oligonucleotide is at least 10 nucleotides, at least 17 nucleotides, at least 25 nucleotides, or at least 50 nucleotides.
- the antisense nucleic acid of the present disclosure is produced intracellularly by transcription from an exogenous sequence.
- a vector or a portion thereof is transcribed, producing an antisense nucleic acid (RNA) of a gene of the disclosure.
- RNA antisense nucleic acid
- Such a vector would contain a sequence encoding the desired antisense nucleic acid.
- Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA.
- Such vectors can be constructed by recombinant DNA technology methods standard in the art. Vectors can be plasmid, viral, or others known in the art, used for replication and expression in vertebrate cells.
- Expression of the sequence encoding desired genes of the instant disclosure, or fragments thereof, can be by any promoter known in the art to act in vertebrate, preferably human cells.
- Such promoters can be inducible or constitutive.
- Such promoters include, but are not limited to, the SV40 early promoter region [see, e.g., Benoist and Chambon (1981) Nature 29:304-310], the promoter contained in the 3' long terminal repeat of Rous sarcoma virus [see, e.g., Yamamoto et al. (1980) Cell 22:787-797], the herpes thymidine promoter [see, e.g., Wagner et al. (1981) Proc. Natl. Acad. Sci. U.S.A. 78: 1441-1445], and the regulatory sequences of the SV40 early promoter region [see, e.g., Benoist and Chambon (1981) Nature 29:304-310], the promoter contained in the 3' long terminal
- the polynucleotide antagonists are interfering RNA or RNAi molecules that target the expression of one or more genes.
- RNAi refers to the expression of an RNA which interferes with the expression of the targeted mRNA.
- siRNA small interfering RNA
- the ds RNA complex is then targeted for degradation by the cell.
- An siRNA molecule is a double-stranded RNA duplex of 10 to 50 nucleotides in length, which interferes with the expression of a target gene which is sufficiently complementary ⁇ e.g. at least 80% identity to the gene).
- the siRNA molecule comprises a nucleotide sequence that is at least 85, 90, 95, 96, 97, 98, 99, or 100% identical to the nucleotide sequence of the target gene.
- RNAi molecules include short-hairpin RNA (shRNA); also short- interfering hairpin and microRNA (miRNA).
- shRNA short-hairpin RNA
- miRNA microRNA
- the shRNA molecule contains sense and antisense sequences from a target gene connected by a loop. The shRNA is transported from the nucleus into the cytoplasm, and it is degraded along with the mRNA.
- Pol III or U6 promoters can be used to express RNAs for RNAi.
- Paddison et al. [Genes & Dev. (2002) 16:948-958, 2002] have used small RNA molecules folded into hairpins as a means to effect RNAi. Accordingly, such short hairpin RNA (shRNA) molecules are also advantageously used in the methods described herein.
- stem lengths can range anywhere from about 25 to about 30 nt, and loop size can range between 4 to about 25 nt without affecting silencing activity. While not wishing to be bound by any particular theory, it is believed that these shRNAs resemble the double- stranded RNA (dsRNA) products of the DICER RNase and, in any event, have the same capacity for inhibiting expression of a specific gene.
- the shRNA can be expressed from a lentiviral vector.
- An miRNA is a single-stranded RNA of about 10 to 70 nucleotides in length that are initially transcribed as pre-miRNA characterized by a "stem-loop" structure and which are subsequently processed into mature miRNA after further processing through the RISC.
- RNAi molecules that mediate RNAi, including without limitation siRNA
- chemical synthesis Hohjoh, FEBS Lett 521 : 195-199, 2002
- hydrolysis of dsRNA Yang et al, Proc Natl Acad Sci USA 99:9942-9947, 2002
- T7 RNA polymerase Trigger RNA polymerase
- hydrolysis of double-stranded RNA using a nuclease such as E. coli RNase III
- the disclosure provides polynucleotide antagonists including but not limited to, a decoy DNA, a double-stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
- a decoy DNA including but not limited to, a decoy DNA, a double-stranded DNA, a single-stranded DNA, a complexed DNA, an encapsulated DNA, a viral DNA, a plasmid DNA, a naked RNA, an encapsulated RNA, a viral RNA, a double-stranded RNA, a molecule capable of generating RNA interference, or combinations thereof.
- the polynucleotide antagonists of the disclosure are aptamers.
- Aptamers are nucleic acid molecules, including double-stranded DNA and single-stranded RNA molecules, which bind to and form tertiary structures that specifically bind to a target molecule, such as a ALK4, ALK5, ActRIIB, ActRIIA, TGFpRII, betaglycan, GDFl l, GDF8, activin (e.g., activin A, activin B, activin C, activin E, activin AB, activin AC) GDF3, BMP6, BMP10, BMP9 TGFpl, TGFp2, TGFp3, TGFpRII and/or betaglycan polypeptide.
- a target molecule such as a ALK4, ALK5, ActRIIB, ActRIIA, TGFpRII, betaglycan, GDFl l, GDF8, activin (e.g., activin A, activin B, activin C,
- Nucleic acid aptamers are selected using methods known in the art, for example via the Systematic Evolution of Ligands by Exponential Enrichment (SELEX) process.
- SELEX is a method for the in vitro evolution of nucleic acid molecules with highly specific binding to target molecules as described in, e.g., U.S. Pat. Nos.
- the SELEX method involves selection from a mixture of candidate oligonucleotides and step-wise iterations of binding, partitioning and amplification, using the same general selection scheme, to achieve desired binding affinity and selectivity.
- the SELEX method includes steps of contacting the mixture with the target under conditions favorable for binding; partitioning unbound nucleic acids from those nucleic acids which have bound specifically to target molecules; dissociating the nucleic acid-target complexes; amplifying the nucleic acids dissociated from the nucleic acid-target complexes to yield a ligand enriched mixture of nucleic acids.
- the steps of binding, partitioning, dissociating and amplifying are repeated through as many cycles as desired to yield highly specific high affinity nucleic acid ligands to the target molecule.
- binding molecules are separately administered to the animal [see, e.g., O'Connor (1991) J. Neurochem. 56:560], but such binding molecules can also be expressed in vivo from polynucleotides taken up by a host cell and expressed in vivo [see, e.g.,
- an ActRII antagonist for use in accordance with the methods disclosed herein is a follistatin or FLRG polypeptide, which may be used alone or in combination with one or more additional supportive therapies and/or active agents as disclosed herein to achieve a desired effect (e.g., increase an immune response in a subject in need thereof and treat cancer of pathogen).
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
- follistatin polypeptide includes polypeptides comprising any naturally occurring polypeptide of follistatin as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, and further includes any functional monomer or multimer of follistatin.
- follistatin polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A.
- Variants of follistatin polypeptides that retain activin binding properties can be identified based on previous studies involving follistatin and activin interactions.
- WO2008/030367 discloses specific follistatin domains ("FSDs") that are shown to be important for activin binding.
- FSDs specific follistatin domains
- SEQ ID NOs: 46-48 the follistatin N-terminal domain
- FSD2 SEQ ID NO: 48
- FSD1 SEQ ID NO: 47
- Follistatin polypeptides include polypeptides derived from the sequence of any known follistatin having a sequence at least about 80% identical to the sequence of a follistatin polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- follistatin polypeptides include the mature follistatin polypeptide or shorter isoforms or other variants of the human follistatin precursor polypeptide (SEQ ID NO: 44) as described, for example, in
- the human follistatin precursor polypeptide isoform FST344 is as follows:
- the signal peptide is underlined; also underlined above are the last 27 residues which represent the C-terminal extension distinguishing this follistatin isoform from the shorter follistatin isoform FST317 shown below.
- the human follistatin precursor polypeptide isoform FST317 is as follows:
- FSND follistatin N-terminal domain
- the FSD1 and FSD2 sequences are as follows:
- an ActRII antagonist for use in accordance with the methods disclosed herein is a folli statin-like related gene (FLRG), also known as follistatin-related protein 3 (FSTL3).
- FLRG polypeptide includes polypeptides comprising any naturally occurring polypeptide of FLRG as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- FLRG polypeptides of the disclosure bind to and/or inhibit activin activity, particularly activin A.
- Variants of FLRG polypeptides that retain activin binding properties can be identified using routine methods to assay FLRG and activin interactions (see, e.g., US 6,537,966).
- FLRG polypeptides are described above in the context of ActRII polypeptides and such methods also pertain to making and testing variants of FLRG.
- FLRG polypeptides include
- polypeptides derived from the sequence of any known FLRG having a sequence at least about 80% identical to the sequence of an FLRG polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- the human FLRG precursor (follistatin-related protein 3 precursor) polypeptide is as follows:
- the signal peptide is underlined.
- follistatin polypeptides and FLRG polypeptides include fusion proteins having at least a portion of the follistatin polypeptide or FLRG polypeptide and one or more fusion domains, such as, for example, domains that facilitate isolation, detection, stabilization or multimerization of the polypeptide. Suitable fusion domains are discussed in detail above with reference to the ActRII polypeptides.
- an antagonist agent of the disclosure is a fusion protein comprising an activin-binding portion of a follistatin polypeptide fused to an Fc domain.
- an antagonist agent of the disclosure is a fusion protein comprising an activin binding portion of an FLRG polypeptide fused to an Fc domain.
- the present disclosure relates to the use of ActRII polypeptides, ALK4 polypeptides and/or ALK4:ActRIIB heteromultimers to identify compounds (agents) which are ActRII antagonists.
- the present disclosure relates to the use of TGFpRII polypeptides, ALK5 polypeptides and/or betaglycan polypeptides to identify compounds (agents) which are TGFP antagonists.
- Compounds identified through this screening can be tested to assess their ability to modulate tissues such as bone, cartilage, muscle, fat, and/or neurons, to assess their ability to modulate tissue growth in vivo or in vitro. These compounds can be tested, for example, in animal models.
- high-throughput screening of compounds can be carried out to identify agents that perturb TGFp superfamily receptor-mediated effects on a selected cell line.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRII polypeptide, ALK4 polypeptide, ALK4:ActRIIB heteromultimer, TGFpRII polypeptides, ALK5 polypeptides and/or betaglycan to a binding partner including for example, BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5,
- the assay can be used to identify compounds that enhance binding of an ActRII polypeptide, ALK4 polypeptide, ALK4:ActRIIB heteromultimer, TGFpRII polypeptides, ALK5 polypeptides and/or betaglycan to a binding partner such as a ligand.
- a binding partner such as a ligand.
- the compounds can be identified by their ability to interact with an ActRII polypeptide, ALK4 polypeptide, ALK4:ActRIIB heteromultimer, TGFpRII polypeptides, ALK5 polypeptides and/or betaglycan.
- test compounds (agents) of the invention may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms ⁇ e.g., natural products), produced chemically ⁇ e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
- the test compounds of the disclosure can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry. These libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds. Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S-transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- GST glutathione S-transferase
- Assays which are performed in cell-free systems such as may be derived with purified or semi-purified proteins, are often preferred as "primary" screens in that they can be generated to permit rapid development and relatively easy detection of an alteration in a molecular target which is mediated by a test compound.
- the effects of cellular toxicity or bioavailability of the test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ActRII polypeptide, ALK4 polypeptide, ALK4:ActRIIB heteromultimer, TGFpRII polypeptides, ALK5 polypeptides and/or betaglycan to a binding partner including for example, BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP 5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGFpl, TGFp2, TGFp3, activin A, activin B, activin AB, activin AC, nodal, glial cell-derived neurotroph
- the compound of interest is contacted with an isolated and purified ALK4: ActRIIB
- ALK4:ActRIIB heteromultimer is then added to a composition containing the appropriate ligand (e.g., BMP2, BMP2/7, BMP3, BMP4, BMP4/7, BMP5, BMP6, BMP7, BMP8a, BMP8b, BMP9, BMP10, GDF3, GDF5, GDF6/BMP13, GDF7, GDF8, GDF9b/BMP15, GDF11/BMP11, GDF15/MIC1, TGFpl, TGFp2, TGFp3, activin A, activin B, activin C, activin E, activin AB, activin AC, nodal, glial cell-derived neurotrophic factor (GDNF), neurturin, artemin, persephin, MIS, and Lefty).
- GDNF glial cell-derived neurotrophic factor
- heteromultimer-superfamily ligand complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the
- ALK4:ActRIIB heteromultimer and its binding protein The efficacy of the compound can be assessed by generating dose-response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison. For example, in a control assay, isolated and purified ligand is added to a composition containing the ALK4:ActRIIB heteromultimer, and the formation of
- heteromultimer-ligand complex is quantitated in the absence of the test compound. It will be understood that, in general, the order in which the reactants may be admixed can be varied, and can be admixed simultaneously. Moreover, in place of purified proteins, cellular extracts and lysates may be used to render a suitable cell-free assay system.
- TGFpPJI polypeptides may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins
- TGFpPJI polypeptides TGFpPJI polypeptides
- ALK5 polypeptides ALK5 polypeptides
- betaglycan a binding protein
- the present disclosure contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRII polypeptide, ALK4 polypeptide, ALK4:ActRIIB heteromultimer, TGFpRII polypeptides, ALK5 polypeptides and/or betaglycan and a binding protein.
- FRET fluorescence resonance energy transfer
- an interaction trap assay also known as the "two-hybrid assay," for identifying agents that disrupt or potentiate interaction between an ActRII polypeptide, ALK4 polypeptide, ALK4:ActRIIB
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Endocrinology (AREA)
- Wood Science & Technology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2018214979A AU2018214979A1 (en) | 2017-02-01 | 2018-01-31 | TGFβ and actrii antagonists for use in increasing immune activity |
| KR1020197025689A KR20190115037A (ko) | 2017-02-01 | 2018-01-31 | 면역 활성을 증가시키는데 이용되는 TGFβ 및 ActRII |
| CN201880023489.0A CN110494155A (zh) | 2017-02-01 | 2018-01-31 | 用于提高免疫活性的TGFβ和ActRII拮抗剂 |
| JP2019562229A JP7246617B2 (ja) | 2017-02-01 | 2018-01-31 | 免疫活性の増加における使用のためのTGFβおよびACTRIIアンタゴニスト |
| CA3051696A CA3051696A1 (en) | 2017-02-01 | 2018-01-31 | Tgf.beta. and actrii antagonists for use in increasing immune activity |
| US16/482,869 US20200306340A1 (en) | 2017-02-01 | 2018-01-31 | Tgfbeta and actrii antagonists for use in increasing immune activity |
| EP18747362.4A EP3576773B1 (en) | 2017-02-01 | 2018-01-31 | Tgf beta and actrii antagonists for use in treating leukemia |
| JP2022181719A JP2023012552A (ja) | 2017-02-01 | 2022-11-14 | 免疫活性の増加における使用のためのTGFβおよびACTRIIアンタゴニスト |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762453413P | 2017-02-01 | 2017-02-01 | |
| US62/453,413 | 2017-02-01 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018144542A1 true WO2018144542A1 (en) | 2018-08-09 |
Family
ID=63041217
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/016148 Ceased WO2018144542A1 (en) | 2017-02-01 | 2018-01-31 | TGFβ AND ACTRII ANTAGONISTS FOR USE IN INCREASING IMMUNE ACTIVITY |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20200306340A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3576773B1 (cg-RX-API-DMAC7.html) |
| JP (2) | JP7246617B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20190115037A (cg-RX-API-DMAC7.html) |
| CN (1) | CN110494155A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2018214979A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3051696A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2018144542A1 (cg-RX-API-DMAC7.html) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019241625A1 (en) * | 2018-06-15 | 2019-12-19 | Acceleron Pharma Inc. | Bi-and tri-functional fusion proteins and uses thereof |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| TWI815184B (zh) * | 2020-09-23 | 2023-09-11 | 大陸商海正生物製藥有限公司 | Tgfbr2-ecd突變體及包含其的融合蛋白與應用 |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3196443A1 (en) * | 2020-11-04 | 2022-05-12 | Hq Han | Novel bifunctional multispecific antagonists capable of inhibiting multiple ligands of tgf-beta family and uses thereof |
| CN118109416B (zh) * | 2023-03-30 | 2024-11-22 | 广州百吉生物制药有限公司 | 功能增强型工程化免疫细胞及其制备和应用 |
| CN117721131A (zh) * | 2023-12-19 | 2024-03-19 | 吉林大学 | 一种重组骨形态发生蛋白突变体的制备方法和应用 |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1486560A2 (en) * | 1999-04-30 | 2004-12-15 | Cambridge Antibody Technology LTD | Specific antibodies and antibody fragments for TGFBETA1 |
| US20100047289A1 (en) * | 2006-12-20 | 2010-02-25 | Habib Fakhrai | Universal tumor cell vaccine for anti cancer therapeutic and prophylactic utilization |
| CN101780272A (zh) * | 2009-12-24 | 2010-07-21 | 湖南农业大学 | 一种含有TGF β1自体疫苗制剂的应用 |
| WO2011109789A2 (en) * | 2010-03-05 | 2011-09-09 | The Johns Hopkins University | Compositions and methods for targeted immunomodulatory antibodies and fusion proteins |
| WO2012167143A1 (en) * | 2011-06-03 | 2012-12-06 | Xoma Technology Ltd. | Antibodies specific for tgf-beta |
| WO2016164089A2 (en) * | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
| WO2016164501A1 (en) * | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Single-arm type i and type ii receptor fusion proteins and uses thereof |
| WO2016201282A2 (en) * | 2015-06-12 | 2016-12-15 | Ludwig Institute For Cancer Research Ltd | TGF-β3 SPECIFIC ANTIBODIES AND METHODS AND USES THEREOF |
| WO2017147182A1 (en) * | 2016-02-22 | 2017-08-31 | Acceleron Pharma Inc. | Actrii antagonists for use in increasing immune activity |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0209893D0 (en) * | 2002-04-30 | 2002-06-05 | Molmed Spa | Conjugate |
| MX2009008222A (es) * | 2007-02-01 | 2009-10-12 | Acceleron Pharma Inc | Antagonistas de activina-actriia y usos para tratar o prevenir cancer de mama. |
| TW201803890A (zh) * | 2007-02-02 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 衍生自ActRIIB的變體與其用途 |
| EA018221B1 (ru) * | 2007-02-09 | 2013-06-28 | Акселерон Фарма Инк. | АНТАГОНИСТЫ АКТИВИНА-ActRIIa И ПРИМЕНЕНИЕ ДЛЯ СТИМУЛЯЦИИ РОСТА КОСТИ У БОЛЬНЫХ РАКОМ |
-
2018
- 2018-01-31 EP EP18747362.4A patent/EP3576773B1/en active Active
- 2018-01-31 US US16/482,869 patent/US20200306340A1/en not_active Abandoned
- 2018-01-31 JP JP2019562229A patent/JP7246617B2/ja active Active
- 2018-01-31 CA CA3051696A patent/CA3051696A1/en active Pending
- 2018-01-31 CN CN201880023489.0A patent/CN110494155A/zh active Pending
- 2018-01-31 WO PCT/US2018/016148 patent/WO2018144542A1/en not_active Ceased
- 2018-01-31 KR KR1020197025689A patent/KR20190115037A/ko not_active Ceased
- 2018-01-31 AU AU2018214979A patent/AU2018214979A1/en not_active Abandoned
-
2022
- 2022-11-14 JP JP2022181719A patent/JP2023012552A/ja active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1486560A2 (en) * | 1999-04-30 | 2004-12-15 | Cambridge Antibody Technology LTD | Specific antibodies and antibody fragments for TGFBETA1 |
| US20100047289A1 (en) * | 2006-12-20 | 2010-02-25 | Habib Fakhrai | Universal tumor cell vaccine for anti cancer therapeutic and prophylactic utilization |
| CN101780272A (zh) * | 2009-12-24 | 2010-07-21 | 湖南农业大学 | 一种含有TGF β1自体疫苗制剂的应用 |
| WO2011109789A2 (en) * | 2010-03-05 | 2011-09-09 | The Johns Hopkins University | Compositions and methods for targeted immunomodulatory antibodies and fusion proteins |
| WO2012167143A1 (en) * | 2011-06-03 | 2012-12-06 | Xoma Technology Ltd. | Antibodies specific for tgf-beta |
| WO2016164089A2 (en) * | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Tgf-beta superfamily type i and type ii receptor heteromultimers and uses thereof |
| WO2016164501A1 (en) * | 2015-04-06 | 2016-10-13 | Acceleron Pharma Inc. | Single-arm type i and type ii receptor fusion proteins and uses thereof |
| WO2016201282A2 (en) * | 2015-06-12 | 2016-12-15 | Ludwig Institute For Cancer Research Ltd | TGF-β3 SPECIFIC ANTIBODIES AND METHODS AND USES THEREOF |
| WO2017147182A1 (en) * | 2016-02-22 | 2017-08-31 | Acceleron Pharma Inc. | Actrii antagonists for use in increasing immune activity |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11090361B2 (en) | 2016-11-10 | 2021-08-17 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| US12582700B2 (en) | 2016-11-10 | 2026-03-24 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| WO2019241625A1 (en) * | 2018-06-15 | 2019-12-19 | Acceleron Pharma Inc. | Bi-and tri-functional fusion proteins and uses thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
| TWI815184B (zh) * | 2020-09-23 | 2023-09-11 | 大陸商海正生物製藥有限公司 | Tgfbr2-ecd突變體及包含其的融合蛋白與應用 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3576773B1 (en) | 2023-10-18 |
| JP2023012552A (ja) | 2023-01-25 |
| AU2018214979A1 (en) | 2019-08-15 |
| KR20190115037A (ko) | 2019-10-10 |
| EP3576773A4 (en) | 2020-08-12 |
| CN110494155A (zh) | 2019-11-22 |
| JP7246617B2 (ja) | 2023-03-28 |
| CA3051696A1 (en) | 2018-08-09 |
| EP3576773A1 (en) | 2019-12-11 |
| JP2020505475A (ja) | 2020-02-20 |
| US20200306340A1 (en) | 2020-10-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12343378B2 (en) | Compositions and methods for treating pulmonary hypertension | |
| US20170240639A1 (en) | Actrii antagonists for use in increasing immune activity | |
| US20200306340A1 (en) | Tgfbeta and actrii antagonists for use in increasing immune activity | |
| US11857599B2 (en) | Compositions and methods for treating spinal muscular atrophy | |
| US20220089683A1 (en) | Bi-and tri-functional fusion proteins and uses thereof | |
| BR122024015924A2 (pt) | Uso de um polipeptídeo para a preparação de um medicamento tratarhipertensão arterial pulmonar, hipertensão venosa pulmonar ou hipertensãopulmonar com doença pulmonar e/ou hipoxemia |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18747362 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3051696 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019562229 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018214979 Country of ref document: AU Date of ref document: 20180131 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197025689 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018747362 Country of ref document: EP Effective date: 20190902 |