WO2018124398A1 - 먹장어 유래 vlrb 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체 - Google Patents

먹장어 유래 vlrb 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체 Download PDF

Info

Publication number
WO2018124398A1
WO2018124398A1 PCT/KR2017/003937 KR2017003937W WO2018124398A1 WO 2018124398 A1 WO2018124398 A1 WO 2018124398A1 KR 2017003937 W KR2017003937 W KR 2017003937W WO 2018124398 A1 WO2018124398 A1 WO 2018124398A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
vlrb
multivalent polymer
hydrophobic tail
tail domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2017/003937
Other languages
English (en)
French (fr)
Inventor
정태성
이정석
임세평
김재성
김영림
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Gyeongsang National University GNU
Original Assignee
Gyeongsang National University GNU
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Gyeongsang National University GNU filed Critical Gyeongsang National University GNU
Publication of WO2018124398A1 publication Critical patent/WO2018124398A1/ko
Priority to US16/456,204 priority Critical patent/US12037373B2/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/461Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/543Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
    • G01N33/54313Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
    • G01N33/54346Nanoparticles
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B82NANOTECHNOLOGY
    • B82YSPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
    • B82Y5/00Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to multimeric multivalent polymers comprising a hydrophobic tail domain of a blackfish derived VLRB protein.
  • the protein probe may be washed away by intense washing conditions during the detection process or transferred to other molecules having a higher affinity for the substrate surface.
  • the protein probe may be washed away by intense washing conditions during the detection process or transferred to other molecules having a higher affinity for the substrate surface.
  • protein nanoparticles are nanomaterials synthesized by self-assembly in living cells, and have a uniform particle size distribution and stability. It is a material that can be economically mass produced easily even in microbial cells.
  • protein nanoparticles with various characteristics / functions through genetic engineering surface modification.
  • a disease marker detecting peptide or protein probe for detecting disease markers
  • it has a constant orientation, high directness and structural stability. It is used as a probe material for high-sensitivity diagnostic systems because it has the advantage of ensuring high accuracy.
  • VLRs variable lymphocyte receptors identified in the lowermost vertebrates, lamprey and hagfish, were rearranged from 1 to 12 leucine-rich repeat (LRR) modules.
  • LRR leucine-rich repeat
  • the polypeptide is made to function like an antibody. It is the only antigen receptor that does not use the immunoglobulin structure found to date as a single polypeptide that is small in size compared to a large-molecule-derived antigen receptor formed from multi-domain conjugates (about 150 kDa for immunoglobulins). May be an antibody substitute for.
  • Korean Patent Publication No. 2015-0037959 discloses 'method of producing monomers and multimer molecules and uses thereof
  • Korean Patent No. 1587386 discloses 'recombinant fluorescent protein nanoparticles for in vivo imaging'
  • the present invention was derived by the above-mentioned requirements, and the present inventors confirmed that monomers of the mutated lymphocyte receptor B (VLRB) protein aggregated together to form a multimer having a size of about 1,700 to 650 kDa.
  • the present invention was completed by confirming that the carboxy-terminal partial hydrophobic tail (hydrophobic cluster, HC) of the protein forms a core at the center to form an antibody having a spherical multimer structure.
  • the present invention comprises a hydrophobic tail domain and a target protein of a fish-derived variable lymphocyte receptor B (VLRB) protein, and provides a multivalent polymer characterized in that to form spherical nanoparticles by self-assembly. do.
  • VLRB variable lymphocyte receptor B
  • the present invention also provides a nucleic acid encoding the polyvalent polymer.
  • the present invention also provides a recombinant expression vector comprising the nucleic acid.
  • the present invention also provides a host cell transformed with the recombinant expression vector.
  • the present invention provides a method for producing a multivalent polymer for forming spherical nanoparticles, comprising the step of obtaining a multivalent polymer for forming spherical nanoparticles from a host cell transformed with the recombinant expression vector.
  • the present invention also provides a method of expressing a multivalent polymer on a cell surface, comprising expressing the polyvalent polymer on a cell surface from a host cell transformed with the recombinant expression vector.
  • the present invention also provides a composition for producing spherical nanoparticles of a multivalent polymer containing a hydrophobic tail domain of a fish-derived VLRB protein as an active ingredient.
  • the multivalent polymer including the hydrophobic tail domain of the fish-derived VLRB protein of the present invention forms a nano-sized spherical shape by self-assembly, and thus can be usefully used for developing a sensitive protein nanochip and a diagnostic kit.
  • VLRB protein (A) is a result of comparing the structure of the VLRB protein (A) and the VLRB protein (B) of hagfish (lamprey).
  • SP signal peptide
  • LRRNT N-terminal capped LRR
  • LRR leucine-rich repeat
  • LRRVs variable LRR modules
  • CP connecting peptide
  • LRRCT C-terminal capped LRR
  • LC seven-growth carboxy terminus
  • HC eel carboxy terminus
  • Gray hydrophobic amino acids in amino acid sequence.
  • Figure 2 shows the results of confirming the VLRB protein in the plasma of the eel.
  • Western blotting results of VLRB protein via A, native-PAGE or SDS-PAGE;
  • B Western blotting results of VLRB protein from plasma proteins treated with various concentrations of SDS;
  • C dot blotting result of the VLRB protein separated from each fraction and fractions according to the protein size of the eel plasma sample;
  • D Western blotting results of VLRB protein isolated from each fraction.
  • Figure 3 is a result (B) showing the molecular weight curve (A) of the fraction standard sample of the eel plasma sample and the estimated number of monomers of the VLRB complex eluted in each fraction.
  • FIG. 4 shows the results of analyzing the actual VLRB image by Negatively stained TEM of 16-minute and 17-minute fractions separated into major populations of VLRB fractions separated in size through FPLC (A) and VLRB-specific antibody 11G5. This is the result obtained by detecting VLRB with a gold labeled secondary antibody and verifying it (B).
  • FIG. 5 is a fusion of C-terminal fragments (30 amino acids) at the ends of RFP-stalk by size (5, 6, 7, 8, 9, 10, 15, 20, 25, 30) and expressed in 293-F cell line.
  • Figure 6 shows the results confirmed by flow cytometry the location of recombinant protein expression in the extracellular membrane expressing RFP, RFP-stalk or RFP-stalk-HC.
  • Figure 7 shows the expression of RFP-stalk or RFP-stalk-HC in the 293-F cell line after phospholipase C (PLC) enzyme treatment by 1 unit / ml, 3 unit / ml concentration outside the cell membrane
  • PLC phospholipase C
  • Figure 8 shows the results confirmed by immunocytochemical analysis of recombinant protein expression in the cell expressing RFP-stalk or RFP-stalk-HC.
  • Figure 9 shows a flexible relationship comparing the structure of the blackfish VLRB, seven growth fish VLRB and immunoglobulin antibody.
  • the present invention comprises a hydrophobic tail domain of the mutant lymphocyte receptor B (VLRB) protein and the protein of interest, characterized in that to form spherical nanoparticles by self-assembly To provide.
  • VLRB lymphocyte receptor B
  • the hydrophobic tail domain of the eel-derived VLRB protein comprises a polypeptide having the amino acid sequence of SEQ ID NO: 1 and a functional equivalent thereof.
  • “Functional equivalent” means at least 70%, preferably at least 80%, more preferably at least 90%, even more preferably at least 95% of the amino acid sequence of SEQ ID NO: 1 as a result of the addition, substitution or deletion of the amino acid It refers to a protein having a sequence homology of% or more and exhibiting substantially homogeneous activity with the protein represented by SEQ ID NO: 1.
  • “Substantially homogeneous activity” refers to the activity of forming spherical nanoparticles by self-assembly.
  • the 'target protein' refers to any protein that can be expressed in a transformant by inserting a polynucleotide encoding the protein into a recombinant expression vector.
  • the protein of interest in the present invention can be any protein desired by those skilled in the art, for example, VLR, enzymes, antibodies, antigens or portions thereof, short chain antibodies, cell receptors, binding proteins, binding domains, peptides, adhesion proteins, structural proteins, modulation Various foreign proteins having biological activities selected from the group consisting of proteins, toxin proteins, cytokines, transcriptional regulators, coagulation factors, and plant biodefense inducing proteins may be used as target proteins, but are not limited thereto.
  • the spherical nanoparticles are characterized in that the hydrophobic tail domain of the fish-derived VLRB protein is located therein and the target protein protrudes to the outside.
  • the multivalent polymer of the present invention forms spherical nanoparticles by self-assembly and may have 16 to 42 target proteins per nanoparticle through size exclusion chromatography and quantitative analysis.
  • electron microscopic observation confirmed that the multivalent polymer of the present invention forms spherical nanoparticles having a diameter of 22-25 nm.
  • the 'polyvalent polymer' refers to a protein in which another protein is linked to the amino terminus (N-terminus) or the carboxy terminus (C-terminus) of the original target protein or is added as another amino acid to be expressed as a polypeptide. it means.
  • the hydrophobic tail domain of the eel-derived VLRB protein may be fused directly or indirectly to the C-terminus of the target protein, but is not limited thereto.
  • the hydrophobic tail domain of the eel-derived VLRB protein may be fused to the C-terminus of the protein of interest.
  • the present invention also provides a nucleic acid encoding the polyvalent polymer.
  • the present invention also provides a recombinant expression vector comprising a nucleic acid encoding the multivalent polymer and a host cell transformed with the recombinant expression vector.
  • recombinant refers to a cell in which a cell replicates a heterologous nucleic acid, expresses the nucleic acid, or expresses a protein encoded by a peptide, a heterologous peptide, or a heterologous nucleic acid.
  • Recombinant cells can express genes or gene fragments that are not found in their natural form in either the sense or antisense form.
  • Recombinant cells can also express genes found in natural cells, but the genes are modified and reintroduced into cells by artificial means.
  • recombinant expression vector means a bacterial plasmid, phage, yeast plasmid, plant cell virus, mammalian cell virus, or other vector. In principle, any plasmid and vector can be used as long as it can replicate and stabilize in the host.
  • An important feature of the expression vector is that it has an origin of replication, a promoter, a marker gene and a translation control element.
  • Expression vectors comprising gene sequences encoding multivalent polymers of the invention and appropriate transcriptional / translational control signals can be constructed by methods well known to those skilled in the art. Such methods include in vitro recombinant DNA techniques, DNA synthesis techniques, in vivo recombinant techniques, and the like. The DNA sequence can be effectively linked to a suitable promoter in the expression vector to drive mRNA synthesis. Expression vectors may also include ribosomal binding sites and transcription terminators as translation initiation sites.
  • a host cell capable of continuously cloning and expressing the vector of the present invention in a prokaryotic cell while being stable may be used in any host cell known in the art, for example, E. coli Rosetta, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli D ⁇ , E. coli W3110, Bacillus sp. And strains.
  • yeast Saccharomyce
  • insect cells eg, human hamster ovary (CHO), W138, BHK, COS-7, 293, HepG2, 3T3, RIN and MDCK cell lines
  • plant cells and the like can be used.
  • the present invention also provides a composition for producing spherical nanoparticles of a multivalent polymer containing a hydrophobic tail domain of a fish-derived VLRB protein as an active ingredient.
  • the composition for producing spherical nanoparticles of the multivalent polymer of the present invention contains the hydrophobic tail domain of the fish-derived VLRB protein as an active ingredient, and binds the target protein to the hydrophobic tail domain to form spherical nanoparticles of the target protein. will be.
  • Inshore hagfish Eptatretus ( Eptatretus) burgeri ) was purchased from a local fisherman and stored in an aquarium at 14-15 ° C. The eel was immersed in 0.1 g / l ethyl 3-aminobenzoate methanesulfonic acid, anesthetized, and then collected in whole blood and in 0.67x PBS containing the same amount of 10 mM EDTA (ethylenediaminetetraacetic acid). Diluted. Plasma was obtained by centrifugation for 500 xg for 10 minutes. Protein quantification was performed using the Pierce BCA Protein Quantitation Kit (Thermo Scientific, USA). Human embryonic kidney (HEK) 293-F cells were purchased from Gibco (USA) and incubated at 37 ° C using Dulbecco's Modified Eagle's Media (DMEM) medium containing 10% fetal bovine serum (FBS).
  • DMEM Dulbecco's Modified Eagle's Media
  • Blackfish plasma samples (3.5 ⁇ g / lane) were isolated on 8% native-PAGE or 12% SDS-PAGE under non-reducing conditions, transferred to a PVDF membrane, and then mouse anti-recognition of the constant stalk site of the blackfish VLRB. React with VLRB antibody (11G5) to confirm the VLRB protein. To confirm the destruction by the surfactant of the VLRB of the complex, the blackfish plasma samples were treated with sodium dodecyl sulfate (SDS) at 0, 0.003, 0.01, 0.03, 0.1, and 0.3% (v / v) concentrations for 10 minutes at room temperature. After the reaction, the western blot was performed by the method described above.
  • SDS sodium dodecyl sulfate
  • E. coli plasma samples diluted in 600 ⁇ l PBS were filtered through a 0.2 ⁇ m membrane, injected into Superdex 200 10/300 GL (GE Healthcare, UK) and chromatographed.
  • dot blotting was performed using each fraction eluted every minute. Since the eluted fractions showed a weak signal in the dot blotting, the fractions were concentrated 10 times through lyophilization, the dot blotting was performed again using the concentrated sample, and the eluted fraction sample with strong signal was confirmed. Western blots were selected.
  • Fractionated salted eel VLRBs (16-17 min. Elution) samples were diluted 100-fold with PBS and prepared at a final concentration of 50 nM. 5 ⁇ l of the sample was placed on a carbon coated grid and glow-discharged in air for 3 minutes. The grid was then immediately negatively stained using 1% uranyl acetate.
  • 50 nM of fractionated eel VLRBs samples were mixed with mouse anti-VLRB antibody (11G5) at a ratio of 1: 2 and reacted for 1 hour, followed by secondary antibody with gold nanoparticles bound thereto. Was treated. After reacting overnight for ice, it was stained negatively in the same manner as described above. Prepared samples were observed using a Tecnai T10 transmission electron microscope (FEI, USA).
  • the mammalian expression vector pTracer-EF / V5-His (Invitrogen Life Technologies, USA) was partially modified to introduce a murine Ig ⁇ chain leader sequence and two Sfi I sites. Finally, the murine Ig ⁇ chain leader sequence was produced in the two Sfi I place and chloramphenicol resistance gene, ccdB pKINGeo / ccdB gene is introduced.
  • a reporter gene and a serial deletion variant of the hydrophobic carboxy terminal region of the eel VLRB were constructed and cloned into the pKINGeo / ccdB vector.
  • HEK 293-F cells were incubated about 90% cold in 6-well plates, and each plasmid was mixed with lipofectamine 2000 (Invitrogen, USA) according to the manufacturer's manual and then treated with the cells. After 4 hours, the cell cultures were replaced and incubated for 48 more hours. Transduced cells were then harvested, reacted with mouse anti-VLRB antibody (11G5), and cell analysis was performed using FACSCalibur TM (BD Biosciences, USA).
  • HEK 293-F cells were cultured about 70% cold on an 8-chamber slide, and then plasmids were transfected as above.
  • Transduced cells were fixed with 4% paraformaldehyde, blocked with PBS containing 0.1% bovine serum albumin (BSA) for 30 minutes, reacted with mouse anti-VLRB antibody (11G5), and then FITC- Bound anti-mouse IgG antibody was reacted for 30 minutes.
  • the final slide was observed for cell images using a Zeiss Axiovert confocal microscope (Zeiss, Germany).
  • the bacterial GPI (glycosylphosphatidylinositol) -specific phospholipase C was 1 unit / ml, 3 unit / ml Cells were harvested after treatment at concentration and reacted at 30 ° C. for 45 minutes. Cells treated with phospholipase C were reacted with an anti-VLRB antibody (11G5), followed by treatment with an FITC-bound anti-mouse IgG antibody with a secondary antibody, followed by flow cytometry.
  • the VLRB protein structures of hagfish and lamprey are signal peptide (SP), N-terminal capped LRR (LRRNT), LRR1, variable LRR modules (CP), and connecting peptide (CP) as shown in FIG. ), C-terminal capped LRR, stalk, and carboxy terminus (C-terminus).
  • SP signal peptide
  • LRRNT N-terminal capped LRR
  • CP variable LRR modules
  • CP connecting peptide
  • C-terminal capped LRR stalk
  • C-terminus carboxy terminus
  • U-shaped tertiary structure is very similar.
  • the C-terminus of the seven-growth fish has eight cysteine residues, and as previously reported, eight to ten monomers combine to form a VLRB complex of about 400 kDa, which is expressed on the cell surface. Is secreted. However, it was confirmed that the C-terminus of the blackfish VLRB is composed of high hydrophobic amino acids (FIG. 1).
  • VLRB antibody capable of detecting the stalk domain of the eel VLRB developed in the previous study after separating plasma proteins extracted from native-PAGE or SDS-PAGE to identify the natural morphology of VLRB in the eel blood Western blot was performed using When the eel plasma proteins were separated by native-PAGE, it was confirmed that all VLRB proteins were present in the stacking gel. On the other hand, each of the VLRB proteins was separated into monomeric forms and separated to monomeric size of about 40 kDa in blackfish plasma treated with various SDSs (FIGS. 2A and 2B). Based on the above results, it is understood that VLRB protein in natural form forms multimers by hydrophobic interaction in natural state, and is separated into monomer form when treated with a surfactant capable of removing the hydrophobic bond. I could confirm it.
  • VLRB proteins were most frequently identified between 16 and 20 minutes after elution, and the VLRB protein was present in the form of a large protein complex of approximately 600-1700 kDa when the molecular weight of the eluted VLRB proteins was inferred by Ferguson plot. It can be seen that (Fig. 3). Comparing this to the VLRB monomer equivalent to about 40 kDa, the VLRB complex shows that about 16-42 VLRB monomeric proteins are clustered by the C-terminal hydrophobic site and present in the form of multimers. Infer facts.
  • VLRB was detected using a gold-labeled secondary antibody using 11G5, which is a blackfish VLRB-specific antibody, and the results were verified (FIG. 4).
  • Example 2 Eel VLRB Carboxy Including terminal Fluorescent protein Multimer Formation and cell surface expression confirmation
  • RFP-stalk and RFP-stalk-HC fusion proteins designation Signal peptide Reporter Protein Stalk Black eel hydrophobic end (HC) RFP-stalk Ig ⁇ RFP Stalk - RFP-stalk-HC5 YFPSY RFP-stalk-HC6 YFPSYI RFP-stalk-HC7 YFPSYIF RFP-stalk-HC8 YFPSYIFL RFP-stalk-HC9 YFPSYIFLH RFP-stalk-HC10 YFPSYIFLHL RFP-stalk-HC15 YFPSYIFLHLVHGLA RFP-stalk-HC20 YFPSYIFLHLVHGLAAVPLV RFP-stalk-HC25 YFPSYIFLHLVHGLAAVPLVYLICH RFP-stalk-HC YFPSYIFLHLVHGLAAVPLVYLICHASQLL
  • Flow cytometry was performed using specific antibodies that recognize the stalk site of the VLRB protein to observe whether the fusion protein is actually expressed on the cell surface. As a result, in a large number of cells compared to the negative control, it was possible to identify the VLRB protein displayed on the surface (display). Moreover, only the HEK 293-F cells transduced with RFP-stalk-HC containing a hydrophobic terminal (HC) site were found to have proteins on the cell surface (FIG. 6).
  • RFP-stalk-HC produced by linking HC to RFP-stalk gene is expressed in HEK 293-F cell line and secreted out of the cell as a polymer, and is displayed on the outer surface of the outer membrane of the GPI (glycosylphosphatidylinositol). ) Is linked by.
  • GPI glycosylphosphatidylinositol
  • RFP-stalk and RFP-stalk-HC were expressed in the 293-F cell line and then treated with PLC (phospholipase C) enzyme by 1 unit / ml and 3 unit / ml concentrations, RFP-stalk that did not exist outside the cell membrane Although unaffected, RFP-stalk-HC protein connected to GPI outside the cell membrane was confirmed by flow cytometry that its binding was hydrolyzed by PLC (FIG. 7).
  • confocal microscopy is used to ensure that the entire hydrophobic end region of the eel is not only secreted out of the cell but also displayed on the cell surface before it is secreted like IgG, IgM in mammals. Observed by.
  • the expression vector system contained a GFP protein expression site in addition to the RFP. Only 293-F cells transduced with RFP-stalk-HC observed the accumulation of proteins on the cell surface (FIG. 8).
  • the ingested VLRB protein is secreted into the cells, ie, blood, in the form of globular-shaped complex after expression, which is secreted in a completely different form from the pentamer structure of seven-growing fish. This was confirmed (FIG. 9).
  • the blackfish VLRB protein has a unique antibody structure that is not found in mammals or other species at all.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Nanotechnology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medical Informatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체에 관한 것으로, 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함한 다가 중합체를 제조하고 상기 다가 중합체는 자가조립에 의해 나노 크기의 구형을 이루어 탐침 효과를 나타내며 이를 통해 고감도 단백질 나노 칩 개발과 진단 키트 개발에 유용하게 사용될 수 있다.

Description

먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체
본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체에 관한 것이다.
특정 단백질-단백질 상호 작용, 예를 들어, 항원-항체를 기반으로 하는 단백질 검출 기술에 있어서 중요한 요소는 단백질 탐침(probe)의 활성화 및 표적물질과의 특이적 결합 능력을 유지하는 것이다. 다양한 종류의 단백질 칩 고체 기판 표면에 단백질을 접착하는 기존의 방법은 단순 흡착/확산 또는 단백질의 일차 아민 그룹의 공유결합에 의한 고정화 또는 그것을 기반으로 한 방법이 많다. 그러나 단백질은 일반적으로 기판 표면 위에서 무작위적으로 접착되고, 단백질의 구조가 쉽게 변형되므로 단백질의 활성이 저해되며, 이로 인해 표면 물질과의 결합이 불가능해져 특이적 결합이 효율적이지 못한 큰 문제점이 있다. 또한 단순 흡착으로 기판 표면에 단백질 탐침이 고정화된 경우, 검출 과정 중 강도 높은 세척 조건으로 단백질 탐침이 씻겨나가거나 기판 표면에 더 높은 친화력을 가지는 다른 분자로 전이될 수 있으며, 무엇보다도 단백질 칩 기판 표면에 고정화되는 단백질 탐침의 정량적 제어와 활성화 유지가 어렵다는 큰 문제점이 있다.
인위적으로 합성되는 기존의 유·무기 나노입자 (금속 나노입자)와는 달리, 단백질 나노입자는 생명체의 세포내에서 자가조립에 의해 합성되는 나노소재로서, 균일한 입도 분포 및 안정성을 확보하고 있음은 물론, 미생물 세포 내에서도 손쉽게 경제적 대량생산이 가능한 소재이다. 또한 유전공학적 표면 개질을 통해 다양한 특성/기능을 가진 단백질 나노입자로 개발할 수 있으며, 특히 표면에 질환 마커 검출 펩타이드 또는 단백질(질환 마커 검출용 탐침)을 표출시켰을 때 일정한 배향성과 높은 직접도 및 구조적 안정성을 확보할 수 있다는 장점을 가지고 있어 고감도 진단시스템을 위한 탐침(probe) 소재로 활용되고 있다.
그러나 기존에 보고된 단백질 3차원 나노구조체를 만드는 기술은 pH 조건이 산성이거나 제조 온도가 고온이거나 하는 등의 제조 조건이 단백질에는 적합하지 않고, 또한 쌓아올리는 재료물질에 특별한 화학적 처리가 필요하고, 공정시간이 상대적으로 긴 문제점이 있었다.
한편, 제일 하위 척추동물인 무악류인 칠성장어(lamprey)와 먹장어(hagfish)에서 동정된 VLR(Variable lymphocyte receptor)은 LRR(leucine-rich repeat) 모듈을 1~12개를 재배열(somatic rearrangement)하여 만들어진 폴리펩타이드로 항체처럼 적응면역 기능을 한다. 이는 multi-domain 결합체로 형성되는 분자량이 큰(면역글로불린의 경우 약 150 kDa) 유악류 유래 항원 수용체에 비해 크기가 작은 단일 폴리펩타이드로 현재까지 발견된 면역글로불린 구조를 사용하지 않는 유일한 항원 수용체로 기존의 항체 대용물질이 될 수 있다.
근래 들어 VLR 동정 및 분리 이후 기존의 항체 대용 물질로 유용하기 위해서 특정 항원에 결합하는 VLR 단백질을 쉽고 빠르게, 대량으로 만들 수 있는 방법 개발이 이루어지고 있다.
한편, 한국공개특허 제2015-0037959호에는 '단량체 및 다량체 분자의 제조 방법 및 이의 용도'가 개시되어 있고, 한국등록특허 제1587386호에는 '인 비보 이미징을 위한 재조합 형광 단백질 나노입자'가 개시되어 있으나, 본 발명의 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체에 대해서는 기재된 바가 없다.
본 발명은 상기와 같은 요구에 의해 도출된 것으로서, 본 발명자들은 먹장어 VLRB(variable lymphocyte receptor B) 단백질의 단량체가 서로 뭉쳐서 대략 1,700~650 kDa 크기의 다량체를 형성하는 것을 확인하였고, 이러한 현상은 VLRB 단백질의 카복시-말단 부분 소수성 테일(hydrophobic tail, hydrophobic clustering, HC)이 정중앙에 코아를 형성하여 구형의 다량체 구조의 항체를 형성함을 확인함으로써, 본 발명을 완성하였다.
상기 과제를 해결하기 위해, 본 발명은 먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인 및 목적 단백질을 포함하며, 자가조립에 의해 구형의 나노입자를 형성하는 것을 특징으로 하는 다가 중합체를 제공한다.
또한, 본 발명은 상기 다가 중합체를 코딩하는 핵산을 제공한다.
또한, 본 발명은 상기 핵산을 포함하는 재조합 발현 벡터를 제공한다.
또한, 본 발명은 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 제공한다.
또한, 본 발명은 상기 재조합 발현 벡터로 형질전환된 숙주 세포로부터 구형의 나노입자를 형성하는 다가 중합체를 수득하는 단계를 포함하는, 구형의 나노입자를 형성하는 다가 중합체의 제조방법을 제공한다.
또한, 본 발명은 상기 재조합 발현 벡터로 형질전환된 숙주 세포로부터 상기 다가 중합체를 세포 표면에 발현시키는 단계를 포함하는, 다가 중합체를 세포 표면에 발현시키는 방법을 제공한다.
또한, 본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 유효성분으로 함유하는 다가 중합체의 구형의 나노입자 제조용 조성물을 제공한다.
본 발명의 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 포함한 다가 중합체는 자가조립에 의해 나노 크기의 구형을 이루어 탐침 효과를 나타내며 이를 통해 고감도 단백질 나노 칩 개발과 진단 키트 개발에 유용하게 사용될 수 있다.
도 1은 칠성장어(lamprey)의 VLRB 단백질(A) 및 먹장어(hagfish)의 VLRB 단백질(B) 구조를 비교한 결과이다. SP, 시그널 펩타이드; LRRNT, N-terminal capped LRR; LRR, leucine-rich repeat; LRRVs, variable LRR modules; CP, 연결 펩타이드; LRRCT, C-terminal capped LRR; LC, 칠성장어 카복시 말단; HC, 먹장어 카복시 말단; 아미노산 서열 내 회색 표시, 소수성 아미노산.
도 2는 먹장어 혈장에서의 VLRB 단백질을 확인한 결과이다. A, native-PAGE 또는 SDS-PAGE를 통한 VLRB 단백질의 웨스턴 블롯팅 결과; B, 다양한 농도의 SDS로 처리한 혈장 단백질로부터 VLRB 단백질의 웨스턴 블롯팅 결과; C, 먹장어 혈장 시료의 단백질 크기에 따른 분획 및 각 분획물로부터 분리되는 VLRB 단백질의 닷 블롯팅 결과; D, 각 분획물로부터 분리되는 VLRB 단백질의 웨스턴 블롯팅 결과.
도 3은 먹장어 혈장 시료의 분획물 표준 시료의 용출 시간별 분자량 곡선(A) 및 각 분획물 내 용출된 VLRB 복합체의 추정되는 모노머 개수를 나타낸 결과(B)이다.
도 4는 FPLC를 통해 사이즈로 분리된 VLRB 분획물 중 메이저 집단(major population)으로 분리된 16분, 17분 분획물들을 Negatively stained TEM으로 실제 VLRB 이미지를 분석한 결과(A) 및 VLRB 특이 항체인 11G5를 이용하고 금 표지된(gold labeling) 2차 항체로 VLRB를 검출하여 검증한 결과(B)이다.
도 5는 RFP-stalk 말단에 먹장어 C-말단 절편(30개 아미노산)을 크기별로(5, 6, 7, 8, 9, 10, 15, 20, 25, 30) 융합시켜 293-F 세포주에 발현시킨 재조합 단백질의 native-PAGE(A) 또는 SDS-PAGE(B)를 통한 VLRB 단백질의 웨스턴 블롯팅 결과이다.
도 6은 RFP, RFP-stalk 또는 RFP-stalk-HC를 발현하는 세포외막에서의 재조합 단백질 발현 위치 여부를 유세포 분석을 통해 확인한 결과이다.
도 7은 RFP-stalk 또는 RFP-stalk-HC를 293-F 세포주에서 발현시킨 후 포스포리파제 C(phospholipase C, PLC) 효소를 1 unit/ml, 3 unit/ml 농도별로 처리하였을 때 세포막 외부에 GPI linkage로 연결된 RFP-stalk-HC 단백질의 결합이 가수분해되는 것을 유세포 분석을 통해 확인한 결과이다.
도 8은 RFP-stalk 또는 RFP-stalk-HC를 발현하는 세포에서의 재조합 단백질 발현 위치를 면역세포화학분석을 통해 확인한 결과이다.
도 9는 먹장어 VLRB, 칠성장어 VLRB 및 면역글로불린 항체의 구조를 비교한 유연관계를 나타낸다.
본 발명의 목적을 달성하기 위하여, 본 발명은 먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인 및 목적 단백질을 포함하며, 자가조립에 의해 구형의 나노입자를 형성하는 것을 특징으로 하는 다가 중합체를 제공한다.
상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 서열번호 1의 아미노산 서열을 갖는 폴리펩타이드 및 이의 기능적 동등물을 포함한다. "기능적 동등물"이란 아미노산의 부가, 치환 또는 결실의 결과, 상기 서열번호 1의 아미노산 서열과 적어도 70% 이상, 바람직하게는 80% 이상, 더욱 바람직하게는 90% 이상, 더 더욱 바람직하게는 95% 이상의 서열 상동성을 갖는 것으로, 서열번호 1로 표시되는 단백질과 실질적으로 동질의 활성을 나타내는 단백질을 말한다. "실질적으로 동질의 활성"이란 자가조립에 의해 구형의 나노입자를 형성하는 활성을 의미한다.
본 발명에서 '목적 단백질'은 당업자가 생산하고자 하는 단백질로서, 재조합 발현벡터에 상기 단백질을 코딩하는 폴리뉴클레오티드를 삽입하여 형질전환체에서 발현할 수 있는 모든 단백질을 의미한다.
본 발명에서 목적 단백질은 당업자가 원하는 모든 단백질이 가능하며, 예를 들어 VLR, 효소, 항체, 항원 혹은 그 일부분, 단쇄항체, 세포수용체, 결합단백질, 결합도메인, 펩타이드, 부착단백질, 구조단백질, 조절단백질, 독소단백질, 사이토카인, 전사조절인자, 혈액응고인자 및 식물 생체방어 유도 단백질로 이루어진 군에서 선택되는 생물학적 활성을 갖는 다양한 외래단백질을 목적단백질로 할 수 있으나, 이에 제한되지 않는다.
상기 구형의 나노입자는 내부에 먹장어 유래 VLRB 단백질의 소수성 테일 도메인이 위치하고 목적 단백질이 외부로 돌출되는 구조를 갖는 것을 특징으로 한다.
본 발명의 일 구현예에 따르면 본 발명의 다가 중합체는 자가 조립에 의하여 구형 나노입자를 형성하며 크기 배제 크로마토그래피 및 정량분석을 통하여 나노입자 당 16~42개 목적 단백질을 가질 수 있음을 확인하였다. 또한 전자 현미경 관찰을 통해 본 발명의 다가 중합체가 22~25 nm의 직경을 가진 구형 나노입자를 형성함을 확인하였다.
본 발명에서 '다가 중합체'는 원래의 목적 단백질의 서열의 아미노 말단(N-말단) 또는 카복시 말단(C-말단)에 다른 단백질이 연결되거나 다른 아미노산이 부가되어 하나의 폴리펩타이드로 발현되는 단백질을 의미한다.
상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 목적 단백질의 C-말단에 직접적으로 또는 간접적으로 융합될 수 있으나, 이에 제한되지 않는다. 바람직하게는 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 목적 단백질의 C-말단에 융합될 수 있다.
또한, 본 발명은 상기 다가 중합체를 코딩하는 핵산을 제공한다.
또한, 본 발명은 상기 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터 및 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 제공한다.
용어 "재조합"은 세포가 이종의 핵산을 복제하거나, 상기 핵산을 발현하거나 또는 펩티드, 이종의 펩티드 또는 이종의 핵산에 의해 암호된 단백질을 발현하는 세포를 지칭하는 것이다. 재조합 세포는 상기 세포의 천연 형태에서는 발견되지 않는 유전자 또는 유전자 절편을, 센스 또는 안티센스 형태 중 하나로 발현할 수 있다. 또한 재조합 세포는 천연 상태의 세포에서 발견되는 유전자를 발현할 수 있으며, 그러나 상기 유전자는 변형된 것으로서 인위적인 수단에 의해 세포 내 재도입된 것이다.
용어 "재조합 발현 벡터"는 세균 플라스미드, 파아지, 효모 플라스미드, 식물 세포 바이러스, 포유동물 세포 바이러스, 또는 다른 벡터를 의미한다. 대체로, 임의의 플라스미드 및 벡터는 숙주 내에서 복제 및 안정화할 수 있다면 사용될 수 있다. 상기 발현 벡터의 중요한 특성은 복제 원점, 프로모터, 마커 유전자 및 번역 조절 요소(translation control element)를 가지는 것이다.
본 발명의 다가 중합체를 코딩하는 유전자 서열 및 적당한 전사/번역 조절 신호를 포함하는 발현 벡터는 당업자에 주지된 방법에 의해 구축될 수 있다. 상기 방법은 시험관 내 재조합 DNA 기술, DNA 합성 기술 및 생체 내 재조합 기술 등을 포함한다. 상기 DNA 서열은 mRNA 합성을 이끌기 위해 발현 벡터 내의 적당한 프로모터에 효과적으로 연결될 수 있다. 또한 발현 벡터는 번역 개시 부위로서 리보좀 결합 부위 및 전사 터미네이터를 포함할 수 있다.
본 발명의 벡터를 원핵세포에 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주세포는 당업계에 공지된 어떠한 숙주세포도 이용할 수 있으며, 예컨대, 대장균(E. coli) Rosetta, 대장균 JM109, 대장균 BL21, 대장균 RR1, 대장균 LE392, 대장균 B, 대장균 X 1776, 대장균 Dα, 대장균 W3110, 바실러스 서브틸리스, 바실러스 츄린겐시스와 같은 바실러스 속 균주, 살모넬라 티피무리움, 세라티아 마르세슨스 및 다양한 슈도모나스 종과 같은 장내균과 균주 등이 있다.
또한, 본 발명의 벡터를 진핵 세포에 형질전환시키는 경우에는 숙주세포로서, 효모(Saccharomyce cerevisiae), 곤충세포, 사람세포 및 동물세포(예컨대, CHO(Chinese hamster ovary), W138, BHK, COS-7, 293, HepG2, 3T3, RIN 및 MDCK 세포주) 및 식물세포 등이 이용될 수 있다.
또한, 본 발명은
1) 상기 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계;
2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및
3) 상기 배양한 숙주 세포로부터 구형의 나노입자를 형성하는 다가 중합체를 수득하는 단계를 포함하는, 구형의 나노입자를 형성하는 다가 중합체의 제조방법을 제공한다.
또한, 본 발명은
1) 상기 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계;
2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및
3) 상기 배양한 숙주 세포로부터 상기 다가 중합체를 세포 표면에 발현시키는 단계를 포함하는, 상기 다가 중합체를 세포 표면에 발현시키는 방법을 제공한다.
또한, 본 발명은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 유효성분으로 함유하는 다가 중합체의 구형의 나노입자 제조용 조성물을 제공한다. 본 발명의 다가 중합체의 구형의 나노입자 제조용 조성물은 먹장어 유래 VLRB 단백질의 소수성 테일 도메인을 유효성분으로 함유하며, 상기 소수성 테일 도메인에 목적 단백질을 결합시켜 목적 단백질의 구형의 나노입자를 형성할 수 있는 것이다.
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.
재료 및 방법
1. 실험동물 및 세포
20~30cm 크기의 먹장어(inshore hagfish, 학명 Eptatretus burgeri)는 지역의 어부로부터 구매하였으며, 14~15℃의 수족관에 보관하였다. 먹장어를 0.1g/ℓ 에틸 3-아미노벤조에이트 메타네술포닉 애시드(ethyl 3-aminobenzoate methanesulfonic acid)에 침지시켜 마취시킨 후, 전혈을 수집하고 동량의 10mM EDTA(ethylenediaminetetraacetic acid)가 들어있는 0.67x PBS에 희석하였다. 500 x g, 10분 동안 원심분리하여 혈장을 획득하였다. 단백질 정량은 Pierce BCA 단백질 정량 키트(Thermo Scientific, 미국)를 이용하여 수행하였다. HEK(Human embryonic kidney) 293-F 세포는 Gibco(미국)사에서 구매하였고, 10% FBS(fetal bovine serum)가 포함된 DMEM(Dulbecco’s Modified Eagle’s Media) 배지를 사용하여 37℃에서 배양하였다.
2. 웨스턴 블롯팅
먹장어 혈장 시료(3.5㎍/레인)는 비환원 조건하의 8% native-PAGE 또는 12% SDS-PAGE에서 분리하고, PVDF 멤브레인으로 단백질을 트랜스퍼한 후, 먹장어 VLRB의 불변 stalk 부위를 인식하는 마우스 항-VLRB 항체(11G5)와 반응시켜 먹장어 VLRB 단백질을 확인하였다. 복합체의 VLRB의 계면활성제에 의한 파괴를 확인하기 위해, 먹장어 혈장 시료를 0, 0.003, 0.01, 0.03, 0.1 및 0.3%(v/v) 농도의 SDS(Sodium Dodecyl Sulfate)를 처리하고 상온에서 10분 동안 반응시킨 후, 전술한 방법으로 웨스턴 블롯을 수행하였다.
3. 크기 배제 크로마토그래피 및 면역블롯팅
600㎕ PBS에 희석시킨 먹장어 혈장 시료 100㎍을 0.2㎛ 멤브레인으로 여과하고, Superdex 200 10/300 GL(GE Healthcare, 영국)에 주입하고 크로마토그래피를 수행하였다. 먹장어 혈장으로부터 VLRB가 포함되어 있는 분획물을 확인하기 위해, 매 분마다 용출되는 각 분획물을 이용하여 닷 블롯팅(dot blotting)을 수행하였다. 용출된 분획물들이 닷 블롯팅에서 약한 신호를 보여주었기 때문에, 상기 분획물들을 동결건조를 통해 10배 농축하고, 농축된 시료를 이용하여 닷 블롯팅을 재수행하였고, 신호가 강하게 확인된 용출 분획물 시료를 선택하여 웨스턴 블롯을 실시하였다.
4. 투과 전자 현미경 관찰(transmission electron microscopy)
분획된 먹장어 VLRBs(16~17분 용출) 시료를 PBS를 이용하여 100배 희석시키고 최종 농도 50nM로 준비하였다. 상기 시료의 5㎕를 탄소 코팅된 그리드에 올리고 공기 중에서 3분 동안 글로 방전(glow-discharged)시켰다. 그 후, 그리드를 즉시 1% 아세트산우라닐(uranyl acetate)을 사용하여 negatively 염색하였다. 면역-금 표지 전자 현미경 분석을 위해, 50nM의 분획된 먹장어 VLRBs 시료를 마우스 항-VLRB 항체(11G5)와 1:2의 비율로 혼합하고 1시간 동안 반응시킨 후, 금 나노입자가 결합된 이차 항체를 처리하였다. 얼음 위해서 밤새 반응시킨 후, 상기와 같은 방법으로 negatively 염색하였다. 준비된 시료들은 Tecnai T10 transmission electron microscope(FEI, 미국)을 사용하여 관찰하였다.
5. 플라스미드 구축
포유류 발현 벡터 pTracer-EF/V5-His(Invitrogen Life Technologies, 미국)를 뮤린(murine) Ig κ사슬 리더 서열 및 두 개의 SfiⅠ 자리를 도입하기 위해 일부 변형하였다. 최종적으로 뮤린 Ig κ사슬 리더 서열, 두 개의 SfiⅠ 자리 및 클로람페니콜 저항성 유전자인 ccdB 유전자가 도입된 pKINGeo/ccdB를 제작하였다. 먹장어 VLRB 단백질의 소수성 카복시 말단 부위의 특징을 분석하기 위해, 상기 pKINGeo/ccdB 벡터에 리포터 유전자와 먹장어 VLRB의 소수성 카복시 말단 부위의 연속적 결실(serial deletion) 변이체를 제작하여 클로닝하였다.
6. 유세포 분석(flow cytometry ) 및 공초점현미경 관찰
HEK 293-F 세포를 6 웰 플레이트에 90% 정도 차게 배양한 후, 각 플라스미드를 제조사의 매뉴얼에 따라 lipofectamine 2000(Invitrogen, 미국)과 혼합한 후, 세포에 처리하였다. 4시간 후, 세포 배양액을 교체하고, 48시간 더 배양하였다. 그 후, 형질도입된 세포들을 수거하고, 마우스 항-VLRB 항체(11G5)와 반응시킨 후, FACSCalibur™ (BD Biosciences, 미국)을 사용하여 세포 분석을 수행하였다.
또한, HEK 293-F 세포를 8-챔버 슬라이드 위에 70% 정도 차게 배양한 후, 상기와 같이 플라스미드를 형질주입하였다. 형질도입된 세포들은 4% 파라포름알데히드로 고정하고, 30분 동안 0.1% BSA(bovine serum albumin)이 들어있는 PBS로 블롯킹한 후, 마우스 항-VLRB 항체(11G5)와 반응시킨 후, FITC-결합된 항-마우스 IgG 항체를 30분 반응시켰다. 최종 슬라이드는 Zeiss Axiovert 공초점현미경(Zeiss, 독일)을 사용하여 세포 이미지를 관찰하였다.
7. 포스포리파제 C( phospholipase C) 효소 처리
RFP-stalk 또는 RFP-stalk-HC를 발현하는 플라스미드를 HEK 293-F 세포에 형질도입하고 2일 뒤, 박테리아 GPI(glycosylphosphatidylinositol)-특이적 포스포리파제 C를 1 unit/ml, 3 unit/ml의 농도로 처리하고 30℃에서 45분 동안 반응시킨 후, 세포를 수확하였다. 포스포리파제 C를 처리한 세포를 항-VLRB 항체(11G5)와 반응시킨 후, 2차 항체로 FITC-결합된 항-마우스 IgG 항체를 처리하고, 유세포 분석을 실시하였다.
실시예 1. 먹장어 혈장 내 VLRB 다량체 복합체로 존재함을 확인
먹장어(hagfish)와 칠성장어(lamprey)의 VLRB 단백질 구조는 도 1과 같이 시그널 펩타이드(signal peptide, SP), LRRNT(N-terminal capped LRR), LRR1, LRRVs(variable LRR modules), CP(connecting peptide), LRRCT(C-terminal capped LRR), stalk, 그리고 카복시 말단(C-말단)으로 구성되어져 있으며 U자 모양의 3차 구조가 아주 유사하였다. 칠성장어의 C-말단은 시스테인(Cys) 잔기가 8개 존재하여 이미 보고된 바와 같이 8∼10개의 모노머(monomer)가 합쳐져 400 kDa 정도의 VLRB 복합체로 형성되어져 세포 표면에 발현되고, 또한 혈장 속으로 분비된다. 하지만, 먹장어 VLRB의 C-말단은 소수성(hydrophobicity)이 높은 아미노산들로 구성되어져 있음을 확인하였다(도 1).
먹장어 혈액 내 VLRB의 자연적 형태를 확인하기 위하여 추출한 혈장 단백질을 native-PAGE 또는 SDS-PAGE에서 분리한 후, 이전의 연구에서 개발한 먹장어 VLRB의 stalk 도메인을 검출할 수 있는 마우스 항-VLRB 항체(11G5)를 이용하여 웨스턴 블롯을 수행하였다. 먹장어 혈장 단백질들을 native-PAGE로 분리하였을 때 스태킹 겔(stacking gel)에 VLRB 단백질이 모두 존재하는 것을 확인하였다. 반면 다양한 SDS를 처리한 먹장어 혈장에서는 각각의 VLRB 단백질들이 모노머 형태로 분리되어 약 40 kDa의 분자량 크기로 분리되었다(도 2A 및 2B). 상기의 결과를 통해, 먹장어 VLRB 단백질은 자연적인 상태에서는 소수성 결합(hydrophobic interaction)에 의해 다량체를 형성하고 있으며, 상기 소수성 결합을 제거할 수 있는 계면활성제를 처리하였을 때 모노머 형태로 분리된다는 사실을 확인할 수 있었다.
혈장 단백질들을 분자 크기별로 분리하기 위해 사이즈 배제 크로마토그래피(size exclusion chromatography)를 수행하였고, 용출 시간에 따라 획득한 용출 분획물(1~48분, 0.5ml/분)을 시료로 하여 먹장어 VLRB 특이 항체(11G5)를 이용한 닷 블롯팅 수행 결과, 용출 후 15~23분에서 획득한 분획물에서 VLRB 단백질이 확인되었다(도 2C). 또한 획득된 각 분획물을 native-PAGE와 SDS-PAGE에서 11G5 항체를 이용하여 확인한 결과, 먹장어 VLRB 단백질이 확인되었다(도 2D). 특히 용출 후, 16~20분 사이에서 VLRB 단백질들이 가장 많이 확인되었으며, 이를 Ferguson plot으로 용출 VLRB 단백질들의 분자량을 유추해 보았을 때, 대략 600~1,700 kDa의 거대한 단백질 복합체의 형태로 먹장어 VLRB 단백질이 존재한다는 사실을 알 수 있었다(도 3). 이를 약 40 kDa에 상응하는 VLRB 모노머에 대비하여 계산해 보았을 때 VLRB 복합체는 약 16~42개 정도의 VLRB 모노머 단백질들이 C-말단의 소수성 부위로 인해 클로스터링(clustering)되어 다량체의 형태로 존재한다는 사실을 유추할 수 있다.
상기 사이즈 배제 크로마토그래피로 분리된 VLRB 단백질 복합체의 실제 이미지를 투과 전자 현미경(TEM)으로 조사하였다. FPLC(Fast protein liquid chromatography)를 통해 사이즈로 분리된 VLRB 분획물 중 메이저 집단(major population)으로 분리된 16분, 17분 분획물들을 Negatively stained TEM으로 실제 VLRB 이미지를 분석한 결과, 22~25 nm 크기의 구 형태 단백질 덩어리로 존재함이 관찰되었다(도 4). 특히 구형 입자의 중심 코어가 흰색으로 나타나는 것은 소수성 클로스터링이 내부에 위치함을 의미하였다. 또한 먹장어 VLRB 특이 항체인 11G5를 이용하고 금 표지된 2차 항체를 이용하여 VLRB를 검출하여 상기 결과를 검증하였다(도 4).
실시예 2. 먹장어 VLRB 카복시 말단을 포함하는 형광단백질의 다량체 형성 및 세포 표면 발현 확인
먹장어 VLRB 단백질의 소수성 카복시 말단(서열번호 1)이 다량체를 이루기 위한 실제 요소인지 확인하기 위해, VLRB 단백질의 stalk 부위부터 카복시 말단까지의 염기서열을 RFP(red fluorescent protein) 유전자에 연결하여 클로닝하였다. 또한 먹장어 VLRB 단백질의 소수성 말단(HC)의 연속적 결실(serial deletion) 변이체들(표 1)을 제작하여 HEK 293-F 세포주에서 발현시켰다. RFP-stalk 및 RFP-stalk-HC5 단백질들은 모두 모노머 형태로 관찰되었으나, VLRB 단백질의 소수성 말단(HC)이 늘어날수록 모노머 형태의 단백질 함유량은 감소하면서 다량체(multimer) 생성량은 증가하는 것이 관찰되었다(도 5). RFP-stalk-HC8 단백질에서 처음으로 다량체가 생성되었으며, RFP-stalk-HC15에서부터는 완전한 다량체만이 생성되었다.
RFP-stalk 및 RFP-stalk-HC 융합단백질
명칭 신호펩타이드 리포터단백질 Stalk 먹장어 소수성 말단(HC)
RFP-stalk Igκ RFP Stalk -
RFP-stalk-HC5 YFPSY
RFP-stalk-HC6 YFPSYI
RFP-stalk-HC7 YFPSYIF
RFP-stalk-HC8 YFPSYIFL
RFP-stalk-HC9 YFPSYIFLH
RFP-stalk-HC10 YFPSYIFLHL
RFP-stalk-HC15 YFPSYIFLHLVHGLA
RFP-stalk-HC20 YFPSYIFLHLVHGLAAVPLV
RFP-stalk-HC25 YFPSYIFLHLVHGLAAVPLVYLICH
RFP-stalk-HC YFPSYIFLHLVHGLAAVPLVYLICHASQLL
세포 표면에 융합 단백질이 실제로 발현되는지 관찰하기 위해 VLRB 단백질의 stalk 부위를 인식하는 특이 항체를 이용하여 유세포 분석을 수행하였다. 그 결과, 음성대조군 대비 많은 수의 세포에서, 표면에 디스플레이(display)된 VLRB 단백질을 확인할 수 있었다. 더욱이, 소수성 말단(HC) 부위를 함유한 RFP-stalk-HC가 형질도입된 HEK 293-F 세포에서만 세포 표면에 단백질이 존재하는 것이 확인되었다(도 6).
RFP-stalk 유전자에 HC를 연결시켜 제작한 RFP-stalk-HC는 HEK 293-F 세포주에서 발현되고 세포 외부로 중합체 형태로 분비될 뿐만 아니라, 세포 외막 바깥쪽에 디스플레이(display)되는 형태가 GPI(glycosylphosphatidylinositol)에 의해 연결되어 있음을 밝혔다. RFP-stalk, RFP-stalk-HC를 293-F 세포주에서 발현시킨 후 PLC(phospholipase C) 효소를 1 unit/ml, 3 unit/ml 농도별로 처리하였을 때, 세포막 외부에 존재하지 않는 RFP-stalk은 아무런 영향을 받지 않았으나, 세포막 외부에 GPI로 연결된 RFP-stalk-HC 단백질은 PLC에 의해 그 결합이 가수분해되는 것을 유세포 분석을 통해 확인하였다(도 7).
또한 먹장어의 소수성 말단 부위 전체가 연결된 RFP 단백질(RFP-stalk-HC)이 세포외부로 분비될 뿐만 아니라 포유류의 IgG, IgM 처럼 분비되기 전 세포 표면에 디스플레이되는지 확인하기 위해 공초점 현미경(confocal microscopy)으로 관찰하였다. 형질도입(transfection) 여부를 확인하기 위해 발현 벡터 시스템은 RFP 이외에 GFP 단백질 발현 부위를 함유하였다. RFP-stalk-HC로 형질도입된 293-F 세포에서만 세포 표면에 단백질들이 축적된다는 사실을 관찰하였다(도 8).
이상의 결과를 통해, 먹장어 VLRB 단백질은 발현 후 구 모양(globular-shaped)의 복합체 형태로 세포 외부, 즉 혈액으로 분비되며, 이는 칠성장어의 펜타머(pentamer) 구조와는 완전히 다른 형태로 분비된다는 사실이 확인되었다(도 9). 즉, 먹장어 VLRB 단백질은 포유류나 다른 종에서 전혀 발견되지 않은 특이한 형태의 항체구조를 가지고 있음을 보여준 것이다.

Claims (11)

  1. 먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인 및 목적 단백질을 포함하며, 단량체의 자가조립에 의해 구형의 다량체 나노입자를 형성하는 것을 특징으로 하는 다가 중합체.
  2. 제1항에 있어서, 상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 서열번호 1의 아미노산 서열로 이루어진 것을 특징으로 하는 다가 중합체.
  3. 제1항에 있어서, 상기 목적 단백질은 VLR(variable lymphocyte receptor), 항원, 항체, 세포수용체 또는 효소인 것을 특징으로 하는 다가 중합체.
  4. 제1항에 있어서, 상기 구형의 나노입자는 내부에 먹장어 유래 VLRB 단백질의 소수성 테일 도메인이 위치하고 목적 단백질이 외부로 돌출되는 구조를 갖는 것을 특징으로 하는 다가 중합체.
  5. 제1항에 있어서, 상기 먹장어 유래 VLRB 단백질의 소수성 테일 도메인은 목적 단백질의 C-말단에 융합된 것을 특징으로 하는 다가 중합체.
  6. 제1항 내지 제5항 중 어느 한 항의 다가 중합체를 코딩하는 핵산.
  7. 제6항의 핵산을 포함하는 재조합 발현 벡터.
  8. 제7항의 재조합 발현 벡터로 형질전환된 숙주 세포.
  9. 1) 제1항의 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계;
    2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및
    3) 상기 배양한 숙주 세포로부터 구형의 나노입자를 형성하는 다가 중합체를 수득하는 단계를 포함하는, 구형의 나노입자를 형성하는 다가 중합체의 제조방법.
  10. 1) 제1항의 다가 중합체를 코딩하는 핵산을 포함하는 재조합 발현 벡터를 제작하는 단계;
    2) 상기 재조합 발현 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및
    3) 상기 배양한 숙주 세포로부터 상기 다가 중합체를 세포 표면에 발현시키는 단계를 포함하는, 다가 중합체를 세포 표면에 발현시키는 방법.
  11. 먹장어 유래 VLRB(variable lymphocyte receptor B) 단백질의 소수성 테일 도메인을 유효성분으로 함유하는 다가 중합체의 구형의 나노입자 제조용 조성물.
PCT/KR2017/003937 2016-12-30 2017-04-12 먹장어 유래 vlrb 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체 Ceased WO2018124398A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/456,204 US12037373B2 (en) 2016-12-30 2019-06-28 Multimeric and multivalent polymer comprising multimerization peptide domain

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020160183813A KR101955928B1 (ko) 2016-12-30 2016-12-30 먹장어 유래 vlrb 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체
KR10-2016-0183813 2016-12-30

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/456,204 Continuation-In-Part US12037373B2 (en) 2016-12-30 2019-06-28 Multimeric and multivalent polymer comprising multimerization peptide domain

Publications (1)

Publication Number Publication Date
WO2018124398A1 true WO2018124398A1 (ko) 2018-07-05

Family

ID=62709606

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2017/003937 Ceased WO2018124398A1 (ko) 2016-12-30 2017-04-12 먹장어 유래 vlrb 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체

Country Status (3)

Country Link
US (1) US12037373B2 (ko)
KR (1) KR101955928B1 (ko)
WO (1) WO2018124398A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102603699B1 (ko) * 2021-09-13 2023-11-17 주식회사 아윈바이오 소수성 테일 도메인이 제거된 먹장어 유래 vlrb 단백질에 ab5 독소 유래 b 서브유닛이 연결된 융합 단백질 및 이의 용도

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110165584A1 (en) * 2004-05-21 2011-07-07 Uab Research Foundation, The Variable Lymphocyte Receptors, Related Polypeptides and Nucleic Acids and Uses Thereof
KR101220162B1 (ko) * 2009-07-02 2013-01-14 한양대학교 산학협력단 아르기닌―기제 양친성 펩티드 마이셀
US20140088292A1 (en) * 2011-03-22 2014-03-27 Korea Advanced Institute Of Science And Technology Water-Soluble Polypeptides Comprised of Repeat Modules, Method for Preparing the Same and Method for a Target-Specific Polypeptide and Analysis of Biological Activity Thereof

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997023631A2 (en) * 1995-12-22 1997-07-03 Somatogen, Inc. Globins containing binding domains
DE602004008582T2 (de) * 2003-02-17 2008-05-21 Peter Burkhard Peptidische nanoteilchen als arzneimittelabgabe- und antigen-display-systeme
US20070160628A1 (en) * 2005-08-31 2007-07-12 Birkett Ashley J Stabilized virus-like particles and epitope display systems
KR20150037959A (ko) 2012-08-02 2015-04-08 에프. 호프만-라 로슈 아게 단량체 및 다량체 분자의 제조 방법 및 이의 용도
KR101599589B1 (ko) 2012-10-31 2016-03-04 고려대학교 산학협력단 인 비보 이미징을 위한 재조합 형광 단백질 나노입자
US10688175B2 (en) * 2015-10-13 2020-06-23 Daniel C. Carter NSP10 self-assembling fusion proteins for vaccines, therapeutics, diagnostics and other nanomaterial applications

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110165584A1 (en) * 2004-05-21 2011-07-07 Uab Research Foundation, The Variable Lymphocyte Receptors, Related Polypeptides and Nucleic Acids and Uses Thereof
KR101220162B1 (ko) * 2009-07-02 2013-01-14 한양대학교 산학협력단 아르기닌―기제 양친성 펩티드 마이셀
US20140088292A1 (en) * 2011-03-22 2014-03-27 Korea Advanced Institute Of Science And Technology Water-Soluble Polypeptides Comprised of Repeat Modules, Method for Preparing the Same and Method for a Target-Specific Polypeptide and Analysis of Biological Activity Thereof

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
FLAJNIK: "Origin and evolution of the adaptive immune system: genetic events and selective pressures", NATURE REVIEWS GENETICS, vol. 11, 8 December 2009 (2009-12-08), pages 47 - 59, XP055612913 *
KIM: "Globular-shaped variable lymphocyte receptors (VLRs) of hagfish : a primordial antibody in vertebrates", ANTIBODY ENGINEERING & THERAPEUTICS, 11 December 2016 (2016-12-11) *
KIM: "Multimerized variable lymphocyte receptors B of hagfish induced by hydrophobic clustering", vol. 56, no. 3, October 2016 (2016-10-01), pages 47 *
PANCER: "Variable lymphocyte receptors in hagfish", PNAS, vol. 102, no. 26, 28 June 2005 (2005-06-28), pages 9224 - 9229, XP008103115 *

Also Published As

Publication number Publication date
US12037373B2 (en) 2024-07-16
KR101955928B1 (ko) 2019-03-08
US20190315817A1 (en) 2019-10-17
KR20180078741A (ko) 2018-07-10

Similar Documents

Publication Publication Date Title
US10416172B2 (en) Recombinant soluble truncated IL-23 receptor (IL-23R) capable of inhibiting IL-23R-mediated cell signaling
JP5973591B2 (ja) 改善された細胞表面発現を有するgpcr
ES2311485T3 (es) Ligandos anclados y procedimientos de utilizacion.
Shimozawa et al. Identification of a new complementation group of the peroxisome biogenesis disorders and PEX14 as the mutated gene
CN114835810B (zh) 一种抗pd-1纳米抗体及其应用
Suen et al. Transient expression of an IL-23R extracellular domain Fc fusion protein in CHO vs. HEK cells results in improved plasma exposure
CN114369584A (zh) 重组人源岩藻糖基转移酶变异体及应用
WO2023017115A1 (en) Fractionation of cells based on a marker protein
US20110091956A1 (en) Biomolecule-immobilized carrier and method for immobilizing biomolecule on carrier
WO2018124398A1 (ko) 먹장어 유래 vlrb 단백질의 소수성 테일 도메인을 포함하는 다량체 다가 중합체
Wu et al. The Drosophila Hedgehog receptor component Interference hedgehog (Ihog) mediates cell–Cell interactions through trans-homophilic binding
Di Matteo et al. An optimized procedure for the site-directed labeling of NGF and proNGF for imaging purposes
JP2011525103A (ja) ディスプレイベクター並びにその方法及び用途
CN120248052A (zh) Panx3生物孔蛋白及其突变体和单分子检测的应用
JP7142310B2 (ja) フィブリノゲンフラグメントとラミニンフラグメントを含むキメラタンパク質およびその利用
WO2014175512A1 (ko) 바이오틴이 태그된 신경접착단백질 및 이를 이용한 인공시냅스의 재구성방법
JP6399563B2 (ja) Wnt蛋白質の製造方法および保存方法
US7879978B2 (en) Macaca fascicularis ST2L
Chapuis et al. Expression and functional characterization of bovine receptor activator of NF-κB ligand (RANKL)
Twair et al. Secretion of recombinant human annexin V in fusion with the super folder GFP for labelling phosphatidylserine-exposing membranes
WO2022002015A1 (zh) 多肽、hla-dr蛋白及其制备方法和应用
WO2018212467A1 (ko) 소수성 테일 도메인이 제거된 먹장어 유래 vlrb 단백질에 칠성장어 유래 vlrb 단백질의 c 말단 서열이 연결된 융합 단백질 및 이의 용도
CN120309736A (zh) 一种识别dmf5-tcr的高亲和力融合蛋白突变体及其应用
US20090053181A1 (en) Modulation of Cells
CN119552259A (zh) 一种具有抑制表皮生长因子受体功能的重组尿调蛋白片段及其应用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17885970

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17885970

Country of ref document: EP

Kind code of ref document: A1