WO2018114754A1 - Combination therapy with targeted 4-1bb (cd137) agonists - Google Patents
Combination therapy with targeted 4-1bb (cd137) agonists Download PDFInfo
- Publication number
- WO2018114754A1 WO2018114754A1 PCT/EP2017/083235 EP2017083235W WO2018114754A1 WO 2018114754 A1 WO2018114754 A1 WO 2018114754A1 EP 2017083235 W EP2017083235 W EP 2017083235W WO 2018114754 A1 WO2018114754 A1 WO 2018114754A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- antigen binding
- acid sequence
- bispecific antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3007—Carcino-embryonic Antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/525—Tumour necrosis factor [TNF]
- C07K14/5255—Lymphotoxin [LT]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
Definitions
- the present invention relates to combination therapies employing tumor targeted anti- CD3 bispecific antibodies and 4-1BB (CD137) agonists, in particular 4-1BBL trimer containing antigen binding molecules, the use of these combination therapies for the treatment of cancer and methods of using the combination therapies.
- combination therapies employing 4- IBB agonists comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen, in particular 4-1BBL trimer containing antigen binding molecules, with an agent blocking PD-Ll/PD-1 interaction, in particular a PD-L1 antibody and/or with a tumor targeted anti-CD3 bispecific antibody.
- T cell bispecific antibodies One way to recruit the patient's own immune system to fight cancer are T cell bispecific antibodies (TCB).
- An anti-CEA/anti-CD3 bispecific antibody is a molecule that targets CEA expressed on tumor cells and CD3 epsilon chain (CD3s) present on T cells. Simultaneous binding leads to T-cell activation and T-cell mediated killing of B cells.
- TCB T cell bispecific antibodies
- IBB immunoglobulin-like fibroblasts
- B cells including NK cells, B cells, NKT cells, monocytes, neutrophils, mast cells, dendritic cells (DCs) and cells of non-hematopoietic origin such as endothelial and smooth muscle cells (Vinay and Kwon, 2011, Cell Mol Immunol 8, 281-284).
- DCs dendritic cells
- non-hematopoietic origin such as endothelial and smooth muscle cells
- TCR T-cell receptor
- B-cell receptor triggering signaling induced through co- stimulatory molecules or receptors of pro-inflammatory cytokines
- 4-lBB ligand (4-1BBL or CD137L) was identified in 1993 (Goodwin et al., 1993, Eur J Immunol 23, 2631-2641). It has been shown that expression of 4-1BBL was restricted on professional antigen presenting cells (APC) such as B-cells, DCs and macrophages. Inducible expression of 4-1BBL is characteristic for T-cells, including both ⁇ and ⁇ T-cell subsets, and endothelial cells (Shao and Schwarz, 2011 , J Leukoc Biol 89, 21 -29) .
- APC professional antigen presenting cells
- Co-stimulation through the 4- IBB receptor activates multiple signaling cascades within the T cell (both CD4 + and CD8 + subsets), powerfully augmenting T cell activation (Bartkowiak and Curran, 2015).
- agonistic 4-lBB-specific antibodies enhance proliferation of T-cells, stimulate lymphokine secretion and decrease sensitivity of T-lymphocytes to activation-induced cells death (Snell et al., 2011, Immunol Rev 244, 197-217). This mechanism was further advanced as the first proof of concept in cancer immunotherapy.
- Fusion proteins composed of one extracellular domain of a 4- IBB ligand and a single chain antibody fragment (Hornig et al., 2012, J Immunother 35, 418-429; Miiller et al., 2008, J Immunother 31, 714-722) or a single 4- IBB ligand fused to the C-terminus of a heavy chain (Zhang et al., 2007, Clin Cancer Res 13, 2758-2767) have been made.
- WO 2010/010051 discloses the generation of fusion proteins that consist of three TNF ligand ectodomains linked to each other and fused to an antibody part.
- antigen binding molecules composed of a trimeric and thus biologically active 4- IBB ligand and an antigen binding domain specific for the tumor-associated antigen FAP and an Fc inactive domain, are shown particularly stable and robust (herein named as FAP-4-1BBL).
- the FAP antigen binding domain replaces the unspecific FcyR-mediated crosslinking that is responsible for Fc- mediated toxicity in particular in the liver, by a FAP-targeted specific crosslinking.
- the crosslinking by a tumor (stroma) antigen makes it possible to administer the 4- IBB agonist
- a better anti-tumor effect of 4- IBB agonism is achieved when the targeted 4-1BBL antigen binding molecule is combined with an anti-CEA/anti-CD3 bispecific antibody, i.e. a CEA TCB.
- the T-cell bispecific antibody provides the initial TCR activating signalling to T cells, and then the combination with FAP-4-1BBL leads to a further boost of anti-tumor T cell immunity.
- CEA cancer-positive cancer
- the combination of the targeted 4- IBB agonist FAP-4-1BBL with an agent blocking PD-Ll/PD-1 interaction induced a strong tumor regression that cannot be observed with the agent blocking PD- Ll/PD-1 interaction alone.
- the present invention relates to anti-CD3 bispecific antibodies and their use in combination with 4-1BB (CD137) agonists, in particular 4-1BBL trimer containing antigen binding molecules, in particular to their use in a method for treating or delaying progression of cancer, more particularly for treating or delaying progression of advanced and/or metastatic solid tumors. It has been found that the combination therapy described herein is more effective in inhibiting tumor growth and eliminating tumor cells than treatment with the anti- CEA/anti-CD3 bispecific antibodies alone.
- 4-1BB CD137
- 4-1BBL trimer containing antigen binding molecules in particular to their use in a method for treating or delaying progression of cancer, more particularly for treating or delaying progression of advanced and/or metastatic solid tumors.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen for use in a method for treating or delaying
- the T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen is used in combination with a 4-1BB (CD137) agonist.
- the T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen is an anti-CEA/anti-CD3 bispecific antibody or an anti-FolRl/anti-CD3 bispecific antibody or an anti-MCSP/anti-CD3 bispecific antibody.
- the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen is an anti-CEA/anti-CD3 bispecific antibody or an anti-FolRl/anti-CD3 bispecific antibody.
- the T- cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen is an anti- CEA/anti-CD3 bispecific antibody.
- the invention provides an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti-CEA/anti-CD3 bispecific antibody is used in combination with a 4-1BB (CD137) agonist.
- the 4- IBB agonist is an antigen binding molecule comprising a tumor- associated antigen.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain with modifications reducing Fey receptor binding and/or effector function.
- the crosslinking by a tumor associated antigen makes it possible to avoid unspecific FcyR-mediated crosslinking and thus higher and more efficacious doses of the 4- 1BB agonists may be administered in comparison to common 4- IBB antibodies.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen and the 4- IBB agonist are administered together in a single composition or administered separately in two or more different compositions.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen is used in combination with a 4-1BB (CD137) agonist, and wherein the 4-1BB agonist acts synergistically with the T-cell activating anti-CD3 bispecific antibody.
- 4-1BB CD137
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the anti-CEA/anti- CD3 bispecific antibody is administered concurrently with, prior to, or subsequently to the 4- 1BB agonist.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- 1BB agonist comprises three ectodomains of 4-lBBL or fragments thereof.
- an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is a molecule comprising three ectodomains of 4-lBBL or fragments thereof and wherein the ectodomains of 4-lBBL comprise an amino acid sequence selected from the group consisting of SEQ ID NO: l, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO: 6, SEQ ID NO:7 and SEQ ID NO:8, particularly the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:5. More particularly, the ectodomains of 4-lBBL comprise an amino acid sequence of SEQ ID NO:5.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to a tumor-associated antigen.
- the 4- IBB agonist is an antigen binding molecule comprising an IgG Fc domain, specifically an IgGl Fc domain or an IgG4 Fc domain.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to a tumor-associated antigen, in particular to FAP.
- an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the 4- 1BB agonist is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one moiety capable of specific binding to FAP, wherein the antigen binding domain capable of specific binding to FAP comprises
- V H FAP heavy chain variable region
- V H FAP heavy chain variable region
- CDR-Hl comprising the amino acid sequence of SEQ ID NO:9
- CDR-H2 comprising the amino acid sequence of SEQ ID NO: 10
- CDR-H3 comprising the amino acid sequence of SEQ ID NO: 11
- a light chain variable region comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 12, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 13, and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 14, or
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to FAP
- the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:21 and a light chain variable region (V L FAP) comprising an amino acid sequence of SEQ ID NO:22 or wherein the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:23 and a light chain variable region (V L FAP) comprising an amino acid sequence of SEQ ID NO:24.
- V H FAP heavy chain variable region
- V L FAP light chain variable
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is an antigen binding molecule further comprising a Fc domain composed of a first and a second subunit capable of stable association.
- the 4- IBB agonist is an antigen binding molecule comprising an IgG Fc domain, specifically an IgGl Fc domain or an IgG4 Fc domain.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain that comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the 4- IBB agonist comprises an IgGl Fc domain comprising the amino acid substitutions L234A, L235A and P329G.
- T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- the first polypeptide contains a CHI or CL domain and the second polypeptide contains a CL or CHI domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to the CHI or CL domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment therof connected via a peptide linker to the CL or CHI domain of said polypeptide, or
- the first polypeptide contains a CH3 domain and the second polypeptide contains a CH3 domain, respectively, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to the C-terminus of the CH3 domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment thereof connected via a peptide linker to the C-terminus of the CH3 domain of said polypeptide, or
- the first polypeptide contains a VH-CL or a VL-CH1 domain and the second polypeptide contains a VL-CH1 domain or a VH-CL domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to VH or VL by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment thereof connected via a peptide linker to VL or VH of said polypeptide.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- V H FAP heavy chain variable region
- V L FAP light chain variable region
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- the second polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- 1BB agonist is an antigen binding molecule comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO:65, a first light chain comprising the amino acid sequence of SEQ ID NO:66, a second heavy chain comprising the amino acid sequence of SEQ ID NO:67 and a second light chain comprising the amino acid sequence of SEQ ID NO:68.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- a polypeptide comprising three ectodomains of 4-1BBL or fragments thereof that are connected to each other by peptide linkers.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an anti-FAP/anti-4-lBB bispecific antibody.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA.
- an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA
- the antigen binding domain capable of specific binding to CEA comprises a heavy chain variable region (V H CEA) comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:49, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:50, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:51, and a light chain variable region (V L CEA)
- CDR-Ll comprising the amino acid sequence of SEQ ID NO:52
- CDR-L2 comprising the amino acid sequence of SEQ ID NO:53
- CDR-L3 comprising the amino acid sequence of SEQ ID NO:54.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- 1BB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA
- the antigen binding domain capable of specific binding to CEA comprises a heavy chain variable region (V H CEA) comprising an amino acid sequence of SEQ ID NO:55 and a light chain variable region (V L CEA) comprising an amino acid sequence of SEQ ID NO:56.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer
- the 4- IBB agonist is an antigen binding molecule further comprising a Fc domain composed of a first and a second subunit capable of stable association.
- the 4- IBB agonist is an antigen binding molecule comprising an IgG Fc domain, specifically an IgGl Fc domain or an IgG4 Fc domain.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain that comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the 4- IBB agonist comprises an IgGl Fc domain comprising the amino acid substitutions L234A, L235A and P329G.
- T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- the first polypeptide contains a CHI or CL domain and the second polypeptide contains a CL or CHI domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-lBBL or fragments thereof that are connected to each other and to the CHI or CL domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-lBBL or a fragment therof connected via a peptide linker to the CL or CHI domain of said polypeptide, or
- the first polypeptide contains a CH3 domain and the second polypeptide contains a CH3 domain, respectively, and wherein the first polypeptide comprises two ectodomains of 4-lBBL or fragments thereof that are connected to each other and to the C-terminus of the CH3 domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-lBBL or a fragment thereof connected via a peptide linker to the C-terminus of the CH3 domain of said polypeptide, or
- the first polypeptide contains a VH-CL or a VL-CH1 domain and the second polypeptide contains a VL-CH1 domain or a VH-CL domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to VH or VL by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment thereof connected via a peptide linker to VL or VH of said polypeptide.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the antigen binding molecule comprises the amino acid sequence selected from the group consisting of SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 and SEQ ID NO:32 and in that the second polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an antigen binding molecule comprising
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist is an anti-CEA/anti-4-lBB bispecific antibody.
- the invention further provides an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti- CEA/anti-CD3 bispecific antibody comprises a first antigen binding domain that binds to CD3, and a second antigen binding domain that binds to CEA.
- the anti- CEA/anti-CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) and a light chain variable region (V L CD3), and a second antigen binding domain comprising a heavy chain variable region (V H CEA) and a light chain variable region (V L CEA).
- the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising CDR-Hl sequence of SEQ ID NO:33, CDR-H2 sequence of SEQ ID NO:34, and CDR-H3 sequence of SEQ ID NO:35; and/or a light chain variable region (V L CD3) comprising CDR-L1 sequence of SEQ ID NO:36, CDR-L2 sequence of SEQ ID NO:37, and CDR-L3 sequence of SEQ ID NO:38. More particularly, the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising the amino acid sequence of SEQ ID NO:39 and/or a light chain variable region (V L CD3) comprising the amino acid sequence of SEQ ID NO:40.
- the second antigen binding domain comprises a heavy chain variable region (V H CEA) comprising CDR-Hl sequence of SEQ ID NO:41, CDR-H2 sequence of SEQ ID NO:42, and CDR-H3 sequence of SEQ ID NO:43, and/or a light chain variable region (V L CEA) comprising CDR-L1 sequence of SEQ ID NO:44, CDR-L2 sequence of SEQ ID NO:45, and CDR-L3 sequence of SEQ ID NO:46.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the second antigen binding domain comprises a heavy chain variable region (V H CEA) comprising CDR-Hl sequence of SEQ ID NO:49, CDR-H2 sequence of SEQ ID NO:50, and CDR-H3 sequence of SEQ ID NO:51, and/or a light chain variable region (V L CEA) comprising CDR-L1 sequence of SEQ ID NO:52, CDR-L2 sequence of SEQ ID NO:53, and CDR-L3 sequence of SEQ ID NO:54.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the second antigen binding domain comprises a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:47 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:48. More particularly, the second antigen binding domain comprises a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:55 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:56.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the invention further provides an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti- CEA/anti-CD3 bispecific antibody further comprises a third antigen binding domain that binds to CEA.
- the third antigen binding domain comprises (a) a heavy chain variable region (V H CEA) comprising CDR-H1 sequence of SEQ ID NO:41, CDR-H2 sequence of SEQ ID NO:42, and CDR-H3 sequence of SEQ ID NO:43, and/or a light chain variable region (V L CEA) comprising CDR-L1 sequence of SEQ ID NO:44, CDR-L2 sequence of SEQ ID NO:45, and CDR-L3 sequence of SEQ ID NO:46, or (b) a heavy chain variable region (V H CEA) comprising CDR-H1 sequence of SEQ ID NO:49, CDR-H2 sequence of SEQ ID NO:50, and CDR-H3 sequence of SEQ ID NO:51, and/or a light chain variable region (V L CEA) comprising CDR-L1 sequence of SEQ ID NO:52, CDR-L2 sequence of SEQ ID NO:53, and CDR-L3 sequence of SEQ ID NO:54.
- V H CEA
- the third antigen binding domain comprises a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:47 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:48 or wherein the second antigen binding domain comprises a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:55 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:56.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the first antigen binding domain is a cross-Fab molecule wherein the variable domains or the constant domains of the Fab heavy and light chain are exchanged, and the second and third, if present, antigen binding domain is a conventional Fab molecule.
- an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein (i) the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding domain, the first antigen binding domain is fused at the C- terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N- terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding domain, the second antigen binding domain is fused at the C- terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and the third antigen binding domain is fused at the
- the invention provides an anti-CEA/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti-CEA/anti- CD3 bispecific antibody comprises an Fc domain comprising one or more amino acid substitutions that reduce binding to an Fc receptor and/or effector function. More particularly, the anti-CEA/anti-CD3 bispecific antibody comprises an IgGl Fc domain comprising the amino acid substitutions L234A, L235A and P329G.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, wherein the tumor- associated antigen is FolRl.
- the invention provides an anti-FolRl/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti-FolRl/anti-CD3 bispecific antibody comprises a first antigen binding domain that binds to CD3, and a second antigen binding domain that binds to FolRl.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3), a second antigen binding domain comprising a heavy chain variable region (V H FOIRI) and a common light chain variable region.
- V H CD3 heavy chain variable region
- V H FOIRI heavy chain variable region
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen for use in a method for treating or delaying progression of cancer
- the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising CDR-H1 sequence of SEQ ID NO: 121, CDR-H2 sequence of SEQ ID NO: 122, and CDR-H3 sequence of SEQ ID NO: 123
- the second antigen binding domain comprises a heavy chain variable region (V H FOIRI) comprising CDR-H1 sequence of SEQ ID NO: 124, CDR-H2 sequence of SEQ ID NO: 125, and CDR-H3 sequence of SEQ ID NO: 126
- the common light chain comprises a CDR-Ll sequence of SEQ ID NO: 127, CDR-L2 sequence of SEQ ID NO: 128, and CDR-L3 sequence of SEQ ID NO: 129.
- the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising the sequence of SEQ ID NO: 130;
- the second antigen binding domain comprises a heavy chain variable region (V H FOIRI) comprising the sequence of SEQ ID NO: 131; and wherein the common light chain comprises the sequence of SEQ ID NO: 132.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen for use in a method for treating or delaying progression of cancer wherein the anti-FolRl/anti-CD3 bispecific antibody comprises a third antigen binding domain that binds to FolRl.
- an anti-FolRl/anti-CD3 bispecific antibody comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO: 133, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 134 and a common light chain of SEQ ID NO: 135.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, wherein the tumor- associated antigen is MCSP.
- the invention provides an anti-MCSP/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti-MCSP/anti-CD3 bispecific antibody comprises a first antigen binding domain that binds to CD3, and a second antigen binding domain that binds to MCSP.
- the anti-CEA/anti-CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) and a light chain variable region (V L CD3), and a second antigen binding domain comprising a heavy chain variable region (V H MCSP) and a light chain variable region (V L MCSP).
- the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising CDR-H1 sequence of SEQ ID NO:33, CDR-H2 sequence of SEQ ID NO:34, and CDR-H3 sequence of SEQ ID NO:35; and/or a light chain variable region (V L CD3) comprising CDR-L1 sequence of SEQ ID NO:36, CDR-L2 sequence of SEQ ID NO:37, and CDR-L3 sequence of SEQ ID NO:38. More particularly, the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising the amino acid sequence of SEQ ID NO:39 and/or a light chain variable region (V L CD3) comprising the amino acid sequence of SEQ ID NO:40.
- V H CD3 heavy chain variable region
- V L CD3 light chain variable region
- the second antigen binding domain comprises a heavy chain variable region (V H MCSP) comprising CDR-H1 sequence of SEQ ID NO: 151, CDR-H2 sequence of SEQ ID NO: 152, and CDR-H3 sequence of SEQ ID NO: 153, and/or a light chain variable region (V L MCSP) comprising CDR-L1 sequence of SEQ ID NO: 154, CDR-L2 sequence of SEQ ID NO: 155, and CDR-L3 sequence of SEQ ID NO: 156.
- V H MCSP heavy chain variable region
- V L MCSP light chain variable region
- the second antigen binding domain comprises a heavy chain variable region (V H MCSP) comprising the amino acid sequence of SEQ ID NO: 157 and/or a light chain variable region (V L MCSP) comprising the amino acid sequence of SEQ ID NO: 158.
- V H MCSP heavy chain variable region
- V L MCSP light chain variable region
- the invention further provides an anti-MCSP/anti-CD3 bispecific antibody for use in a method for treating or delaying progression of cancer, wherein the anti- MCSP/anti-CD3 bispecific antibody further comprises a third antigen binding domain that binds to MCSP.
- the third antigen binding domain comprises (a) a heavy chain variable region (V H MCSP) comprising CDR-H1 sequence of SEQ ID NO: 151, CDR-H2 sequence of SEQ ID NO: 152, and CDR-H3 sequence of SEQ ID NO: 153, and/or a light chain variable region (V L MCSP) comprising CDR-L1 sequence of SEQ ID NO: 154, CDR-L2 sequence of SEQ ID NO: 155, and CDR-L3 sequence of SEQ ID NO: 156.
- V H MCSP heavy chain variable region
- V L MCSP light chain variable region
- the third antigen binding domain comprises a heavy chain variable region (V H MCSP) comprising the amino acid sequence of SEQ ID NO: 157 and/or a light chain variable region (V L MCSP) comprising the amino acid sequence of SEQ ID NO: 158.
- V H MCSP heavy chain variable region
- V L MCSP light chain variable region
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen is used in combination with a 4-lBB (CD137) agonist and wherein the combination is administered at intervals from about about one week to three weeks.
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen is used in combination with a 4- IBB (CD 137) agonist and in combination with an agent blocking PD-Ll/PD-1 interaction.
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody or an anti-PDl antibody.
- the agent blocking PD-Ll/PD-1 interaction is selected from the group consisting of atezolizumab, durvalumab, pembrolizumab and nivolumab.
- the agent blocking PD- Ll/PD-1 interaction is atezolizumab.
- the invention provides a pharmaceutical product comprising (A) a first composition comprising as active ingredient a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and a pharmaceutically acceptable carrier; and (B) a second composition comprising as active ingredient a 4- IBB agonist and a pharmaceutically acceptable carrier, for use in the combined, sequential or simultaneous treatment of a disease, in particular for the treatment of cancer.
- the T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen is for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti- CD3 bispecific antibody specific for a tumor-associated antigen is used in combination with a 4- IBB agonist and wherein a pretreatment with an Type II anti-CD20 antibody, preferably obinutuzumab, is performed prior to the combination treatment, wherein the period of time between the pretreatment and the combination treatment is sufficient for the reduction of B- cells in the individual in response to the Type II anti-CD20 antibody, preferably
- a pharmaceutical composition comprising a T- cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and a 4- IBB agonist.
- the pharmaceutical composition is for use in treating or delaying progression of cancer, in particular for the treatment of solid tumors.
- the pharmaceutical composition is for use in treating a disease selected from the group consisting of colon cancer, lung cancer, ovarian cancer, gastric cancer, bladder cancer, pancreatic cancer, endometrial cancer, breast cancer, kidney cancer, esophageal cancer, and prostate cancer.
- the invention provides a kit for treating or delaying progression of cancer in a subject, comprising a package comprising (A) a first composition comprising as active ingredient a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and a
- compositions comprising as active ingredient a 4- IBB agonist and a pharmaceutically acceptable carrier, and (C) instructions for using the compositions in a combination therapy.
- the invention relates to the use of a combination of a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and a 4- IBB agonist in the manufacture of a medicament for treating or delaying progression of a proliferative disease, in particular cancer.
- a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen in particular an anti-CEA/anti- CD3 bispecific antibody
- a 4- IBB agonist in the manufacture of a medicament for treating a disease selected from the group consisting of colon cancer, lung cancer, ovarian cancer, gastric cancer, bladder cancer, pancreatic cancer, endometrial cancer, breast cancer, kidney cancer, esophageal cancer, and prostate cancer.
- the invention provides a method for treating or delaying progression of cancer in a subject comprising administering to the subject an effective amount of a T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and a 4- IBB agonist.
- the invention relates to a method for treating or delaying progression of cancer in a subject, wherein the 4- 1BB agonist is an antigen binding molecule.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain with modifications reducing Fey receptor binding and/or effector function.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof.
- the 4- IBB agonist is a molecule comprising three ectodomains of 4-1BBL or fragments thereof and wherein the ectodomains of 4-1BBL comprise an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO: 6, SEQ ID NO:7 and SEQ ID NO:8, particularly the amino acid sequence of SEQ ID NO: l or SEQ ID NO:5.
- the 4- IBB agonist is an antigen binding molecule comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen.
- the the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to a tumor-associated antigen.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and an antigen binding domain capable of specific binding to FAP.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and an antigen binding domain capable of specific binding to CEA.
- a 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen is used in combination with an agent blocking PD-Ll/PD-1 interaction.
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody or an anti-PDl antibody. More particularly, the agent blocking PD-Ll/PD-1 interaction is selected from the group consisting of
- the agent blocking PD-Ll/PD-1 interaction is atezolizumab.
- the tumor-associated antigen is selected from Fibroblast activation protein (FAP) or CEA.
- FAP Fibroblast activation protein
- the 4- 1BB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to Fibroblast activation protein (FAP).
- Figure 1 shows particular FAP-4-1BBL antigen binding molecules and a particular anti-CEA/anti-CD3 bispecific antibody as used in the Examples. These molecules are described in more detail in Examples 1 and 2, respectively.
- the thick black point stands for the knob-into-hole modification. * symbolizes amino acid modifications in the CHI and CL domain (so-called charged residues).
- Figure 1 A an exemplary bispecific anti-CEA/anti- CD3 antibody in 2+1 format is shown (named CEA CD3 TCB or CEACAM5 CD3 TCB, respectively).
- Figure IB shows a monovalent FAP 4-lBBL-trimer containing antigen binding molecule with modifications in the CHI and CL domain adjacent to the 4-1BBL dimer and 4- 1BBL monomer.
- FIG. 1C shows the bivalent construct with binder FAP(4B9), termed bi FAP(4B9)-4-lBBL.
- Figures ID and IE show untargeted control molecules (the FAP binder has been replaced by a non-binding DP47 Fab).
- Figure 2 shows that the groups treated with combinations of CEA CD3 TCB with monovalent FAP(4B9)-4-lBBL showed improved efficacy in terms of tumor growth inhibition compared to the other groups.
- Figures 3A to 3F show that treatment with combinations of CEA CD3 TCB with monovalent or bivalent FAP(4B9)-4-lBBL led to increased infiltration of CD 8 and CD4 positive T-cells in the tumor compared to treatment with the single agents.
- the letters A to J refer to the treatment groups as defined in Figure 2.
- Figures 4A and 4B show the histological analysis at the end of the study, i.e. the amount of CD8 positive ( Figure 4A) and CD3 positive cells per mm ( Figure 4B).
- Figure 5 shows that the groups treated with combinations of CEA CD3 TCB with monovalent FAP(28Hl)-4-lBBL showed improved efficacy in terms of tumor growth inhibition compared to groups treated with the single agents.
- Figures 6A and 6B show that treatment with combinations of CEA CD3 TCB with monovalent or bivalent FAP(4B9)-4-lBBL led to increased infiltration of CD 8 and CD4 positive T-cells in the tumor ( Figure 6A) and blood ( Figure 6B) compared to treatment with the single agents.
- Figure 7 shows that treatment with the combinations of CEA CD3 TCB + FAP(4B9)-4- 1BBL at different doses mediates superior efficacy in terms of tumor growth inhibition compared to treatment with single agents.
- Mice were inoculated with MKN45 and 3T3 cells in a ratio of 1: 1.
- mice were randomized and treated with vehicle, CEA CD3 TCB, FAP-4-1BBL or the combinations.
- Figures 8A and 8B show the pharmacokinetic profile of injected compounds during the first week. 2 mice per Group were bled 10 min, 6h, 24h, 96h and 7d after the first therapy and injected compounds were analysed by ELISA. 4-1BBL was detected via 4- IBB binding ( Figure 8A), whereas CEA CD3 TCB was detected via binding to anti-CD3 CDR antibody ( Figure 8B). All groups injected with compounds show comparable exposure of the molecules between the different groups (dose dependent), either FAP-4-1BBL or CEA CD3 TCB.
- Figure 9 is shown the T cell infiltration in tumor and spleen at study termination. Spleen and tumor from 2-5 mice/group were analysed by flow cytometry at termination.
- Figure 9A shows the increase of CD3 positive cells in the tumor
- Figure 9B is shown the increase of CD8 positive cells in the tumor
- Figure 9C the increase of CD4 positive cells in the tumor
- Figure 9D the increase of CD3 positive cells in the spleen.
- FIGS 10A and 10B The histological analysis at the end of the study is illustrated in Figures 10A and 10B. Immunohistochemical images of human MKN45 gastric subcutaneous tumors cografted with 3T3 murine fibroblasts derived from the indicated treatment groups in humanized NOG mice were generated. Tissue samples were prepared for immunohistochemical staining.
- Subcutaneous tumors were harvested from animals at day 52 and during the experiment, fixed in formalin 10% (Sigma, Germany) and later processed for FFPET (Leica 1020, Germany). 4 ⁇ paraffin sections were subsequently cut in a microtome (Leica RM2235, Germany). HuCD8 and HuCD3 immunohistochemistry was performed with anti-human CD8 (Cell Marque Corporation, California) and anti-human CD3 (ThermoFischer Scientific, USA) in the Leica autostainer (Leica ST5010, Germany) following the manufacture's protocols.
- Figure 11 it is shown that the combinations of CEACAM5 CD3 TCB + FAP(4B9)- 4-1BBL lOmg/kg mediate slightly improved efficacy in terms of tumor growth inhibition compared to the other groups.
- Figures 12A and 12B show the pharmacokinetic profile of injected compounds during the first week. 2 mice per Group were bled lh and 72h after 1 st and 2 nd therapy. Injected compounds were analysed by ELISA as described in Example 5.
- FIGS 13A and 13B show the T cell infiltration in tumor at study termination as analysed by FACS.
- the increase of CD8 positive T cells in the tumor is shown in Figure 13A and the increase of CD4 positive T cells in the tumor is illustrated in Figure 13B.
- Figures 14A and 14B relate to the histological analysis at day 33 and the end of the study day 50 and Figures 15A, 15B and 15C refer to the cytokine analysis at the end of the study (see Example 5).
- Figure 16 it is shown that combinations of CEA CD3 TCB + CEA-4- 1BBL in the doses of 10 mg/kg and 3 mg/kg mediate improved efficacy in terms of tumor growth inhibition compared to CEA CD3 TCB monotherapy (see Example 7).
- Figures 17A and 17B show the pharmacokinetic profile of injected compounds CEA CD3 TCB and CEA-4- 1BBL during the first week. 2 mice per Group were bled lh and 72h after 1 st and 2 nd therapy. Injected compounds were analysed by ELISA as described in
- Example 7 In Figure 17A 4-1BBL was detected via 4-1BB binding whereas in Figure 17B the concentration of CEA CD3 TCB was detected via binding to anti-CD3 CDR antibody.
- Figures 18A (CD3 positive T cells), 18B (CD 8 positive T cells) and 18C (CD4 positive T cells).
- Figures 19A and 19B relate to the histological analysis at day 44 of the study (see Example 7). There is a significant increase of CD3 positve T cells (Figure 19A) and CD8 positve T cells (Figure 19B) positive T cells in the groups treated with CEA CD3 TCB + CEA-4-1BBL lOmg/kg and 3 mg/kg group compared to CEA CD3 TCB monotherapy and vehicle.
- TCB mediated lysis of MKN45 NucLight red tumor cells by various human immune cell preparations is shown (Example 8).
- Different human immune effector cell preparations resting PBMC, CD4 or CD8 T cells, NLV specific CD8 T effector memory cells
- MKN-45 NucLight Red cells and irradiated NIH/3T3 huFAP were cocultured with MKN-45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEACAM5 CD3 TCB for 48 hourrs.
- the amount of living tumor cells was quantified by fluorescence microscopy high content life imaging using the Incucyte Zoom System (Essenbioscience, HD phase-contrast, green fluorescence and red fluorescence, lOx objective) in a 3 hours interval for 48 hours at 37 °C and 5% C0 2 .
- the integrated red fluorescence of healthy tumor cells (RCU x ⁇ /image) of triplicates (median) was used to calculate the specific lysis which was plotted against the used TCB concentration to show the cytolytic potential of T cells.
- Figures 21A-21D show the expression of 4- IBB on T cells upon TCB stimulation.
- Different human immune effector cell preparations resting PBMC, CD4 or CD8 T cells, NLV specific CD8 T effector memory cells
- MKN-45 NucLight Red cells
- NIH/3T3 huFAP a serial dilution row of CEACAM5 CD3 TCB for 48 hours.
- the expression of 4-1BB was determined on CD4 + and CD8 + T cells by flow cytometry.
- the percentage of positive cells Figures 21A and 21C) and MFI
- Different human immune effector cell preparations (resting PBMC in Figure 22B, CD4 T cells in Figure 22A, CD 8 T cells in Figure 22C, NLV specific CD8 T effector memory cells in Figure 22D) were cocultured for 48 hours with MKN-45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEACAM5 CD3 TCB with or without a fixed concentration of FAP 4-1BBL.
- the amount of living tumor cells was quantified by fluorescence microscopy high content life imaging using the Incucyte Zoom System (Essenbioscience, HD phase-contrast, green fluorescence and red fluorescence, lOx objective) in a 3 hours interval for 48 hours at 37 °C and 5% C0 2 .
- the integrated red fluorescence of healthy tumor cells (RCU x ⁇ /image) of triplicates (median) was used to calculate the specific lysis which was plotted against the used TCB concentration to show the cytolytic potential of T cells.
- the 42 hours timepoint is shown exemplary. Error bars indicate the SEM.
- FIG. 23A-23D it is shown that 4- IBB costimulation did increase CEA CD3 TCB and CEACAM5 CD3 TCB mediated TNF-a release.
- Resting CD4 T cells were cocultured for 48 hrs with MKN45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEACAM5 CD3 TCB or CEA CD3 TCB with or without a fixed concentration of FAP 4-1BBL, respectively.
- the amount of TNF-a was quantified as GFP induction in TNF-a sensor cells by fluorescence microscopy high content life imaging using the Incucyte Zoom System (Essenbioscience, HD phase-contrast, green fluorescence and red fluorescence, lOx objective) in a 3 hours interval for 42 hours at 37 °C and 5% C0 2 .
- the integrated green fluorescence of TNF-a sensor cells (GCU x ⁇ /image) of triplicates (median) was plotted against the used TCB concentration to quantify TNF-a secretion of T cells. Error bars indicate the SEM.
- Figure 23A shows the results for CEACAM5 CD3 TCB without the presence of FAP-4-1BBL, the increase with the addition of FAP-4-1BBL is shown in Figure 23B.
- Figures 23C and 23D show the TNF-a release mediated by CEA CD3 TCB without ( Figure 23C) and with ( Figure 23D) costimulation with FAP-4- 1BBL.
- FIGs 24A and 24B the area under the curve (AUC) values are plotted against each timepoint.
- the amount of TNF-a was quantified as GFP induction in TNF-a sensor cells by fluorescence microscopy high content life imaging.
- the AUC of GFP was calculated for each condition and time point and was plotted against each timepoint to quantify TNF-a secretion of T cells. It can be seen that the TNF-a release mediated by CEACAM5 CD3 TCB ( Figure 24A) and CEA CD3 TCB ( Figure 24B) did increase with 4- IBB costimulation through the presence of FAP-41BBL.
- FIGs 25A-25D it is shown how 4- IBB costimulation did modulate cytokine secretion by CEACAM5 CD3 TCB (called CEA CD3 TCB(2) in the graphs).
- CEA CD3 TCB(2) Resting CD4 T cells were cocultured for 48 hrs with MKN-45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEA CD3 TCB (2) with or without a fixed concentration of FAP 4-lBBL.
- the secreted amount of TNF-a, IFN- ⁇ , IL-2 and IL-10 was quantified at the 48 hours end point using cytometric bead array technology.
- the respective cytokine concentrations were plotted against the TCB concentration.
- FIGS 26A-26D similar data are shown for CEA CD3 TCB mediated cytokine secretion.
- Resting CD4 T cells were cocultured for 48 hrs with MKN-45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEA CD3 TCB with or without a fixed concentration of FAP 4-lBBL.
- the secreted amount of TNF-a (Figure 26A), IFN- ⁇ (Figure 26B), IL-2 ( Figure 26C) and IL-10 ( Figure 26D) was quantified at the 48h end point using cytometric bead array technology.
- the respective cytokine concentrations were plotted against the TCB concentration.
- FIG. 27 a comparison of FAP 4-lBBL costimulation mediated changes [ ] in cytokine concentration in the presence of a high concentration of CEA CD3 TCB [50 nM] or CEACAM5 CD3 TCB [2 nM] (in the graph CEA CD3 TCB(2)) with or without a fixed concentration of FAP 4-lBBL are shown.
- the secreted amount of TNF-a, IFN- ⁇ , IL-2, IL-10, IL-9 and IL-17A was quantified at the 48 hours end point using cytometric bead array technology.
- the changes of cytokine concentration were calculated in percent, whereby the respective sample w/o FAP 4-lBBL costimulation was considered 100%.
- FIGS 28A-28H illustrate that 4- IBB costimulation did also modulate CEACAM5 CD3 TCB mediated cytokine secretion of resting CD8 T cells.
- Resting CD8 T cells were cocultured for 72 hrs with MKN-45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEACAM5 CD3 TCB (called CEA TCB2 in the graphs) with or without a fixed concentration of FAP 4-lBBL.
- FIGS 29A-29H it is shown that 4- IBB costimulation did modulate CEACAM5 CD3 TCB (CEA TCB2) mediated cytokine secretion of NLV specific effector memory CD8 T cells.
- NLV specific effector memory CD8 T cells were cocultured for 72 hours with MKN- 45 NucLight Red cells and irradiated NIH/3T3 huFAP in the presence of a serial dilution row of CEA TCB2 with or without a fixed concentration of FAP 4-lBBL.
- the secreted amount of IL-2 Figure 29A
- TNF- ⁇ Figure 29B
- IFN- ⁇ Figure 29C
- IL-4 Figure 29D
- IL-9 The secreted amount of IL-9
- FIG 30 a comparison of FAP 4-lBBL costimulation mediated changes [%] in cytokine concentration in the presence of a high concentration of CEA CD3 TCB [50 nM] or CEACAM5 CD3 TCB [2 nM] (in the graph CEA CD3 TCB(2)) with or without a fixed concentration of FAP 4-lBBL are shown.
- the secreted amount of TNF-a, IFN- ⁇ , IL-2, IL-10, IL-9 and IL-17A was quantified at the 48 hours end point using cytometric bead array technology.
- the changes of cytokine concentration were calculated in percent, whereby the respective sample w/o FAP 4-lBBL costimulation was considered 100%.
- Figures 41A and 41B show the simultaneous binding of hybrid surrogate FAP-mu4- 1BBL (Analyte 1) to immobilized murine 4-1BB and human FAP or murine FAP (Analyte 2), respectively.
- Figure 41 C is shown the simultaneous binding of murine bispecific FAP-4- 1BB antibody muFAP-4-lBB (Analyte 1) to immobilized murine 4-1BB and murine FAP (Analyte 2).
- Figure 42 shows the pharmacokinetic profile of muFAP-4-lBB after single injection in C57BL/6 mice as described in Example 13. A stable PK-behavior was observed which suggests that the compound can be administered in a once weekly schedule. This led to the treatment schedule of the efficacy study with muFAP-4-lBB and anti-PD-Ll antibody in the MC38-CEA model as shown in Figure 43 and described in Example 14.
- Figure 44A shows the tumor growth kinetics (Mean +/- SEM) as observed in mice treated with muFAP-4-lBB alone, anti-PD-Ll antibody alone or with the combination of both.
- Figure 44B shows a waterfall plot indicating the tumor growth change of any animal from start of treatment at day 15 until day 37. The individual tumor growth kinetics of each animal for all treatment groups is furthermore shown in more detail in Figure 44C.
- Monotherapy of muFAP-4-lBB did not reveal any tumor growth inhibition.
- Treatment with anti-PD-Ll alone induced tumor growth inhibition with one mouse being tumor free at day 37.
- the combination of muFAP-4-lBB and a-PD-Ll induced strong tumor regression in 5 out of 10 mice resulting in 50% tumor free mice by day 37.
- Figures 45A and 45B show that the groups treated with combinations of FolRl CD3
- TCB with monovalent FAP(28Hl)-4-lBBL showed improved efficacy in terms of tumor growth inhibition compared to the other groups receiving FolRl CD3 TCB alone or monovalent FAP(28Hl)-4-lBBL as single agent (Fig. 45B).
- Fig. 45A it can be seen that monovalent FAP(28Hl)-4-lBBL is much more potent in inhibiting tumor growth as untargeted 4-1BBL, but less potent than in combination with FolRl CD3 TCB.
- Figure 46 shows the pharmacokinetic profile of injected compounds during the first week. 2-3 mice per Group were bled 10 min, lh, 8h, 24h and 7d after the first therapy and injected compounds were analysed by ELISA. 4-1BBL was detected via 4- IBB binding. All groups injected with compounds show comparable exposure of the molecules between the different groups (dose dependent).
- Figures 47A to 47D show that treatment with FolRl CD3 TCB alone or combinations of FolRl CD3 TCB with monovalent FAP(28Hl)-4-lBBL led to increased infiltration of CD3 + T-cells (Fig. 47 A), CD8 + T cells (Fig. 47C) and CD4 + T-cells (Fig 47B) in the tumor compared to treatment with 4-1BBL alone, however the ratio of CD8 + /CD4 + T-cells is much higher in the combination groups compared to the group receiving FolRl CD3 TCB alone (Fig. 47D).
- Figures 48A to 48C relate to the histological analysis at the end of the study, in particular to the quantification of CD3 + (Fig. 48A) and CD8 + T cells (Fig. 48B) in subcutaneous SKOV3 ovarian tumors collected at day 44, 1 day after last administration.
- Immunohistochemistry staining of CD3 and CD8 T cells was performed on human SKOV3 ovarian subcutaneous tumors derived from the indicated treatment groups in PBMC transfer NOG mice. Tissue samples were prepared for immunohistochemical staining: subcutaneous tumors were harvested from animals at day 44, fixed in formalin 10% (Sigma, Germany) and later processed for FFPET (Leica 1020, Germany).
- Figure 49 shows that the groups treated with combinations of FolRl CD3 TCB with monovalent or bivalent FAP(28Hl)-4-lBBL showed improved efficacy in terms of tumor growth inhibition compared to groups treated with the single agents.
- Figure 50 shows the pharmacokinetic profile of injected compounds during the first week. 2 mice per Group were bled 10 min, lh, 8h, 24h and 7d after the first therapy and injected compounds were analysed by ELISA. 4-1BBL was detected via 4- IBB binding. All groups injected with compounds show comparable exposure of the molecules between the different groups.
- Figures 51A and 51B show that treatment with combinations of FolRl CD3 TCB with monovalent or bivalent FAP(4B9)-4-lBBL led to increased infiltration of CD 8 and CD4 positive T-cells in the tumor and blood compared to treatment with the single agents.
- Figure 51C shows that the ratio of CD8 + /CD4 + T-cells is much higher in the combination groups compared to the group receiving FolRl CD3 TCB alone.
- Figure 52 shows a comparison of MCSP CD3 TCB-mediated killing of MV3 melanoma cells without or in the presence of FAP-4-1BBL with CD8 + T cells of 3 donors (see Example 16). For all three donors a significantly increased tumor target cell killing was observed.
- Figure 53 shows the comparison of TCB-mediated killing of MV3 melanoma cells without or in the presence of FAP-4-1BBL with pan T cells of 3 donors. Significantly increased tumor target cell killing was observed for all 3 donors.
- antigen binding molecule refers in its broadest sense to a molecule that specifically binds an antigenic determinant.
- antigen binding molecules are antibodies, antibody fragments and scaffold antigen binding proteins.
- antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, monospecific and multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g. containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the term "monospecific" antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen.
- bispecific means that the antigen binding molecule is able to specifically bind to at least two distinct antigenic determinants.
- a bispecific antigen binding molecule comprises two antigen binding sites, each of which is specific for a different antigenic determinant.
- the bispecific antigen binding molecule is capable of simultaneously binding two antigenic determinants, particularly two antigenic determinants expressed on two distinct cells.
- the term "valent” as used within the current application denotes the presence of a specified number of binding sites in an antigen binding molecule. As such, the terms
- bivalent denotes the presence of two binding sites, four binding sites, and six binding sites, respectively, in an antigen binding molecule.
- full length antibody intact antibody
- whole antibody whole antibody
- Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures. For example, native IgG-class antibodies are
- heterotetrameric glycoproteins of about 150,000 daltons composed of two light chains and two heavy chains that are disulfide-bonded.
- each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3), also called a heavy chain constant region.
- VH variable region
- CHI, CH2, and CH3 constant domains
- each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a light chain constant domain (CL), also called a light chain constant region.
- the heavy chain of an antibody may be assigned to one of five types, called a (IgA), ⁇ (IgD), ⁇ (IgE), ⁇ (IgG), or ⁇ (IgM), some of which may be further divided into subtypes, e.g. ⁇ (IgGl), ⁇ 2 (IgG2), ⁇ 3 (IgG3), ⁇ 4 (IgG4), al (IgAl) and a2 (IgA2).
- the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies, triabodies, tetrabodies, cross-Fab fragments; linear antibodies; single-chain antibody molecules (e.g. scFv); and single domain antibodies.
- Diabodies are antibody fragments with two antigen- binding sites that may be bivalent or bispecific, see, for example, EP 404,097; WO
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single- domain antibody (Domantis, Inc., Waltham, MA; see e.g. U.S. Patent No. 6,248,516 Bl).
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein. Papain digestion of intact antibodies produces two identical antigen-binding fragments, called "Fab" fragments containing each the heavy- and light-chain variable domains and also the constant domain of the light chain and the first constant domain (CHI) of the heavy chain.
- Fab fragment refers to an antibody fragment comprising a light chain fragment comprising a VL domain and a constant domain of a light chain (CL), and a VH domain and a first constant domain (CHI) of a heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteins from the antibody hinge region.
- Fab'-SH are Fab' fragments in which the cysteine residue(s) of the constant domains bear a free thiol group. Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites (two Fab fragments) and a part of the Fc region.
- cross-Fab fragment or "xFab fragment” or “crossover Fab fragment” refers to a Fab fragment, wherein either the variable regions or the constant regions of the heavy and light chain are exchanged.
- Two different chain compositions of a crossover Fab molecule are possible and comprised in the bispecific antibodies of the invention: On the one hand, the variable regions of the Fab heavy and light chain are exchanged, i.e. the crossover Fab molecule comprises a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CHI), and a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL).
- This crossover Fab molecule is also referred to as CrossFab ( VLVH>
- the crossover Fab molecule comprises a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL), and a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CHI).
- This crossover Fab molecule is also referred to as CrossFab ( CLCHI>
- a “single chain Fab fragment” or “scFab” is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CHI), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1 -linker- VL-CL, b) VL-CL-linker-VH-CHl, c) VH-CL- linker-VL-CHl or d) VL-CH1 -linker- VH-CL; and wherein said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids.
- Said single chain Fab fragments are stabilized via the natural disulfide bond between the CL domain and the CHI domain.
- these single chain Fab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g. position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
- a “crossover single chain Fab fragment” or “x-scFab” is a is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CHI), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N- terminal to C-terminal direction: a) VH-CL-linker-VL-CHl and b) VL-CH1 -linker- VH-CL; wherein VH and VL form together an antigen-binding site which binds specifically to an antigen and wherein said linker is a polypeptide of at least 30 amino acids.
- x-scFab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g. position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
- a "single-chain variable fragment (scFv)" is a fusion protein of the variable regions of the heavy (V H ) and light chains (V L ) of an antibody, connected with a short linker peptide of ten to about 25 amino acids.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the V H with the C- terminus of the V L , or vice versa.
- antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain, namely being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the antigen binding property of full length antibodies.
- fibronectin and designed ankyrin repeat proteins have been used as alternative scaffolds for antigen-binding domains, see, e.g., Gebauer and Skerra, Engineered protein scaffolds as next- generation antibody therapeutics. Curr Opin Chem Biol 13:245-255 (2009) and Stumpp et al., Darpins: A new generation of protein therapeutics. Drug Discovery Today 13: 695-701
- a scaffold antigen binding protein is selected from the group consisting of CTLA-4 (Evibody), Lipocalins (Anticalin), a Protein A-derived molecule such as Z-domain of Protein A (Affibody), an A-domain (Avimer/Maxibody), a serum transferrin (trans-body); a designed ankyrin repeat protein (DARPin), a variable domain of antibody light chain or heavy chain (single-domain antibody, sdAb), a variable domain of antibody heavy chain (nanobody, aVH), V NAR fragments, a fibronectin (AdNectin), a C-type lectin domain (Tetranectin); a variable domain of a new antigen receptor beta-lactamase (V NAR fragments), a human gamma-crystallin or ubiquitin (Affilin molecules); a kunitz type domain of human protease inhibitors, microbodies such as the proteins
- Lipocalins are a family of extracellular proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids and lipids. They have a rigid beta-sheet secondary structure with a number of loops at the open end of the conical structure which can be engineered to bind to different target antigens. Anticalins are between 160-180 amino acids in size, and are derived from lipocalins. For further details see Biochim Biophys Acta 1482: 337-350 (2000), US7250297B1 and US20070224633.
- DARPins Designed Ankyrin Repeat Proteins
- Ankyrin which is a family of proteins that mediate attachment of integral membrane proteins to the cytoskeleton.
- a single ankyrin repeat is a 33 residue motif consisting of two alpha-helices and a beta-turn. They can be engineered to bind different target antigens by randomizing residues in the first alpha-helix and a beta- turn of each repeat. Their binding interface can be increased by increasing the number of modules (a method of affinity maturation).
- affinity maturation For further details see J. Mol. Biol. 332, 489-503 (2003), PNAS 100(4), 1700-1705 (2003) and J. Mol. Biol. 369, 1015-1028 (2007) and US20040132028 Al.
- a single-domain antibody is an antibody fragment consisting of a single monomeric variable antibody domain.
- the first single domains were derived from the variable domain of the antibody heavy chain from camelids (nanobodies or V H H fragments).
- the term single-domain antibody includes an autonomous human heavy chain variable domain (aVH) or V NAR fragments derived from sharks.
- an "antigen binding molecule that binds to the same epitope" as a reference molecule refers to an antigen binding molecule that blocks binding of the reference molecule to its antigen in a competition assay by 50% or more, and conversely, the reference molecule blocks binding of the antigen binding molecule to its antigen in a competition assay by 50% or more.
- antigen binding domain refers to the part of an antigen binding molecule that comprises the area which specifically binds to and is complementary to part or all of an antigen. Where an antigen is large, an antigen binding molecule may only bind to a particular part of the antigen, which part is termed an epitope.
- An antigen binding domain may be provided by, for example, one or more variable domains (also called variable regions).
- an antigen binding domain comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- VL antibody light chain variable region
- VH antibody heavy chain variable region
- antigenic determinant is synonymous with “antigen” and "epitope,” and refers to a site (e.g. a contiguous stretch of amino acids or a conformational configuration made up of different regions of non-contiguous amino acids) on a polypeptide macromolecule to which an antigen binding moiety binds, forming an antigen binding moiety- antigen complex.
- Useful antigenic determinants can be found, for example, on the surfaces of tumor cells, on the surfaces of virus-infected cells, on the surfaces of other diseased cells, on the surface of immune cells, free in blood serum, and/or in the extracellular matrix (ECM).
- the proteins useful as antigens herein can be any native form the proteins from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g. mice and rats), unless otherwise indicated.
- the antigen is a human protein.
- the term encompasses the "full-length", unprocessed protein as well as any form of the protein that results from processing in the cell.
- the term also encompasses naturally occurring variants of the protein, e.g. splice variants or allelic variants.
- specific binding is meant that the binding is selective for the antigen and can be discriminated from unwanted or non-specific interactions.
- the ability of an antigen binding molecule to bind to a specific antigen can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g. Surface Plasmon Resonance (SPR) technique (analyzed on a BIAcore instrument) (Liljeblad et al., Glyco J 17, 323-329 (2000)), and traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002)).
- ELISA enzyme-linked immunosorbent assay
- SPR Surface Plasmon Resonance
- the extent of binding of an antigen binding molecule to an unrelated protein is less than about 10% of the binding of the antigen binding molecule to the antigen as measured, e.g. by SPR.
- an molecule that binds to the antigen has a dissociation constant (Kd) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 ⁇ 8 M or less, e.g. from 10 ⁇ 8 M to 10 "13 M, e.g. from 10 "9 M to 10 "13 M).
- Binding affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1: 1 interaction between members of a binding pair (e.g. antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd), which is the ratio of dissociation and association rate constants (koff and kon, respectively).
- Kd dissociation constant
- equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same.
- Affinity can be measured by common methods known in the art, including those described herein.
- a particular method for measuring affinity is Surface Plasmon Resonance (SPR).
- SPR Surface Plasmon Resonance
- tumor-associated antigen means any antigen that is highly expressed by tumor cells or in the tumor stroma.
- tumor-associated antigens are CEA or FAP, but also other targets such as Folate Receptor.
- FAP Fibroblast activation protein
- Prolyl endopeptidase FAP or Seprase EC 3.4.21
- FAP Fibroblast activation protein
- mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the term encompasses "full- length,” unprocessed FAP as well as any form of FAP which results from processing in the cell.
- the term also encompasses naturally occurring variants of FAP, e.g., splice variants or allelic variants.
- the antigen binding molecule of the invention is capable of specific binding to human, mouse and/or cynomolgus FAP.
- the amino acid sequence of human FAP is shown in UniProt (www.uniprot.org) accession no. Q12884 (version 149, SEQ ID NO:80), or NCBI (www.ncbi.nlm.nih.gov/) RefSeq NP_004451.2.
- the extracellular domain (ECD) of human FAP extends from amino acid position 26 to 760.
- the amino acid sequence of a His-tagged human FAP ECD is shown in SEQ ID NO: 81.
- the amino acid sequence of mouse FAP is shown in UniProt accession no.
- an anti-FAP binding molecule of the invention binds to the extracellular domain of FAP.
- Exemplary anti-FAP binding molecules are described in International Patent Application No. WO 2012/020006 A2.
- Carcinoembroynic antigen also known as Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), refers to any native CEA from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human CEA is shown in UniProt accession no. P06731 (version 151, SEQ ID NO: 85).
- CEA has long been identified as a tumor- associated antigen (Gold and Freedman, J Exp Med., 121:439-462, 1965; Berinstein N.
- CEA has now been identified in several normal adult tissues. These tissues are primarily epithelial in origin, including cells of the gastrointestinal, respiratory, and urogential tracts, and cells of colon, cervix, sweat glands, and prostate (Nap et al., Tumour Biol., 9(2-3): 145-53, 1988; Nap et al., Cancer Res., 52(8):2329-23339, 1992). Tumors of epithelial origin, as well as their metastases, contain CEA as a tumor associated antigen.
- CEA While the presence of CEA itself does not indicate transformation to a cancerous cell, the distribution of CEA is indicative.
- CEA is generally expressed on the apical surface of the cell (Hammarstrom S., Semin Cancer Biol. 9(2):67-81 (1999)), making it inaccessible to antibody in the blood stream.
- CEA tends to be expressed over the entire surface of cancerous cells (Hammarstrom S., Semin Cancer Biol. 9(2):67-81 (1999)). This change of expression pattern makes CEA accessible to antibody binding in cancerous cells.
- CEA expression increases in cancerous cells.
- CEA expression promotes increased intercellular adhesions, which may lead to metastasis (Marshall J., Semin Oncol., 30(a Suppl. 8):30-6, 2003).
- CRC colorectal carcinoma
- NSCLC non-small cell lung cancer
- HER3 non-small cell lung cancer
- CEA is readily cleaved from the cell surface and shed into the blood stream from tumors, either directly or via the lymphatics. Because of this property, the level of serum CEA has been used as a clinical marker for diagnosis of cancers and screening for recurrence of cancers, particularly colorectal cancer (Goldenberg D M., The International Journal of
- FolRl refers to Folate receptor alpha and has been identified as a potential prognostic and therapeutic target in a number of cancers. It refers to any native FolRl from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human FolRl is shown in UniProt accession no.
- FolR 1 is an N-glycosylated protein expressed on plasma membrane of cells. FolR 1 has a high affinity for folic acid and for several reduced fol ic acid derivatives and mediates delivery of the physiological folate, 5-methyltetrahydrofolate, to the interior of cells.
- FOLR 1 is a desirable target for FOLR 1 -directed cancer therapy as it is overexpressed in vast majority of ovarian cancers, as well as in many uterine, endometrial, pancreatic, renal, lung, and breast cancers, while the expression of FOLR 1 on normal tissues is restricted to the apical membrane of epithelial cells in the kidney proximal tubules, alveolar pneumocytes of the lung, bladder, testes, choroid plexus, and thyroid. Recent studies have identified that FolR 1 expression is particularly high in triple negative breast cancers (Neceia et al. PloS One 2015, 10(3), e0127133).
- MCSP refers to Melanoma- associated Chondroitin Sulfate Proteoglycan, also known as Chondroitin Sulfate Proteoglycan 4 (CSPG4). It refers to any native FolRl from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human MCSP is shown in UniProt accession no.
- MCSP is a highly glycosylated integral membrane chondroitin sulfate
- proteoglycan consisting of an N -linked 280 kDa glycoprotein component and a 450-kDa chondroitin sulfate proteoglycan component expressed on the cell membrane (Ross et al., Arch. Biochem. Biophys. 1983, 225:370-38).
- MCSP is more broadly distributed in a number of normal and transformed cells. In particular, MCSP is found in almost all basal cells of the epidermis. MCSP is differentially expressed in melanoma cells, and was found to be expressed in more than 90% of benign nevi and melanoma lesions analyzed.
- T-cell antigen refers to an antigenic determinant presented on the surface of a T lymphocyte, particularly a cytotoxic T lymphocyte.
- T cell activating therapeutic agent refers to a therapeutic agent capable of inducing T cell activation in a subject, particularly a therapeutic agent designed for inducing T-cell activation in a subject.
- T cell activating therapeutic agents include bispecific antibodies that specifically bind an activating T cell antigen, such as CD3, and a target cell antigen, such as CEA or Folate Receptor.
- an "activating T cell antigen” as used herein refers to an antigenic determinant expressed by a T lymphocyte, particularly a cytotoxic T lymphocyte, which is capable of inducing or enhancing T cell activation upon interaction with an antigen binding molecule. Specifically, interaction of an antigen binding molecule with an activating T cell antigen may induce T cell activation by triggering the signaling cascade of the T cell receptor complex.
- An exemplary activating T cell antigen is CD3.
- CD3 refers to any native CD3 from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the term encompasses "full- length,” unprocessed CD3 as well as any form of CD3 that results from processing in the cell.
- the term also encompasses naturally occurring variants of CD3, e.g., splice variants or allelic variants.
- CD3 is human CD3, particularly the epsilon subunit of human CD3 (CD3s). The amino acid sequence of human CD3s is shown in UniProt
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antigen binding molecule to antigen.
- the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al., Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007).
- a single VH or VL domain may be sufficient to confer antigen-binding specificity.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops").
- native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
- HVRs generally comprise amino acid residues from the hypervariable loops and/or from the
- CDRs complementarity determining regions
- Exemplary hypervariable loops occur at amino acid residues 26-32 (LI), 50-52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3).
- CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 occur at amino acid residues 24-34 of LI, 50-56 of L2, 89-97 of L3, 31-35B of HI, 50-65 of H2, and 95-102 of H3.
- HVRs Hypervariable regions
- CDRs complementarity determining regions
- Kabat et al. also defined a numbering system for variable region sequences that is applicable to any antibody.
- One of ordinary skill in the art can unambiguously assign this system of "Kabat numbering" to any variable region sequence, without reliance on any experimental data beyond the sequence itself.
- Kabat numbering refers to the numbering system set forth by Kabat et al., U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an antibody variable region are according to the Kabat numbering system.
- CDRs generally comprise the amino acid residues that form the hypervariable loops.
- CDRs also comprise "specificity determining residues,” or "SDRs,” which are residues that contact antigen. SDRs are contained within regions of the CDRs called abbreviated-CDRs, or a-CDRs.
- Exemplary a-CDRs (a-CDR-Ll, a-CDR-L2, a- CDR-L3, a-CDR-Hl, a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of LI, 50-55 of L2, 89-96 of L3, 31-35B of HI, 50-58 of H2, and 95-102 of H3.
- HVR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
- affinity matured in the context of antigen binding molecules (e.g., antibodies) refers to an antigen binding molecule that is derived from a reference antigen binding molecule, e.g., by mutation, binds to the same antigen, preferably binds to the same epitope, as the reference antibody; and has a higher affinity for the antigen than that of the reference antigen binding molecule.
- Affinity maturation generally involves modification of one or more amino acid residues in one or more CDRs of the antigen binding molecule.
- the affinity matured antigen binding molecule binds to the same epitope as the initial reference antigen binding molecule.
- FR Framework or "FR” refers to variable domain residues other than hypervariable region (HVR) residues.
- the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
- acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
- An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
- the "class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi, and IgA 2 .
- a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a “humanized form” of an antibody refers to an antibody that has undergone humanization.
- Other forms of "humanized antibodies” encompassed by the present invention are those in which the constant region has been additionally modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to Clq binding and/or Fc receptor (FcR) binding.
- a "human” antibody is one which possesses an amino acid sequence which
- a human antibody corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences.
- This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- Fc domain or "Fc region” herein is used to define a C-terminal region of an antibody heavy chain that contains at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- An IgG Fc region comprises an IgG CH2 and an IgG CH3 domain.
- the "CH2 domain” of a human IgG Fc region usually extends from an amino acid residue at about position 231 to an amino acid residue at about position 340.
- a carbohydrate chain is attached to the CH2 domain.
- the CH2 domain herein may be a native sequence CH2 domain or variant CH2 domain.
- the "CH3 domain” comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e.
- the CH3 region herein may be a native sequence CH3 domain or a variant CH3 domain (e.g. a CH3 domain with an introduced "protuberance” ("knob”) in one chain thereof and a corresponding introduced “cavity” ("hole”) in the other chain thereof; see US Patent No. 5,821,333, expressly incorporated herein by reference).
- a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
- the C-terminal lysine (Lys447) of the Fc region may or may not be present.
- numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
- the "knob-into-hole” technology is described e.g. in US 5,731,168; US 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001).
- the method involves introducing a protuberance ("knob") at the interface of a first polypeptide and a corresponding cavity ("hole") in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g.
- tyrosine or tryptophan tyrosine or tryptophan.
- Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
- a knob modification comprises the amino acid substitution T366W in one of the two subunits of the Fc domain
- the hole modification comprises the amino acid substitutions T366S, L368A and Y407V in the other one of the two subunits of the Fc domain.
- the subunit of the Fc domain comprising the knob modification additionally comprises the amino acid substitution S354C
- the subunit of the Fc domain comprising the hole modification additionally comprises the amino acid substitution Y349C.
- a "region equivalent to the Fc region of an immunoglobulin" is intended to include naturally occurring allelic variants of the Fc region of an immunoglobulin as well as variants having alterations which produce substitutions, additions, or deletions but which do not decrease substantially the ability of the immunoglobulin to mediate effector functions (such as antibody-dependent cellular cytotoxicity).
- one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function.
- Such variants can be selected according to general rules known in the art so as to have minimal effect on activity (see, e.g., Bowie, J. U. et al., Science 247: 1306-10 (1990)).
- effector functions refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype.
- antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation.
- an “activating Fc receptor” is an Fc receptor that following engagement by an Fc region of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions.
- Activating Fc receptors include FcyRIIIa (CD 16a), FcyRI (CD64), FcyRIIa (CD32), and FcaRI (CD89).
- a particular activating Fc receptor is human FcyRIIIa (see UniProt accession no. P08637, version 141).
- An “ectodomain” is the domain of a membrane protein that extends into the
- the extracellular space i.e. the space outside the target cell. Ectodomains are usually the parts of proteins that initiate contact with surfaces, which leads to signal transduction.
- the ectodomain of 4-lBBL as defined herein thus refers to the part of the 4-lBBL that extends into the extracellular space (the extracellular domain), but also includes shorter parts or fragments thereof that are responsible for the trimerization and for the binding to the corresponding receptor 4-1BB.
- the term "ectodomain of 4-lBBL or a fragment thereof thus refers to the extracellular domain of 4-lBBL that forms the extracellular domain or to parts thereof that are still able to bind to the receptor (receptor binding domain).
- 4-lBBL or "4-1BB ligand” or “CD137L” is a costimulatory TNF ligand family member, which is able to costimulate proliferation and cytokine production of T-cells.
- 4-lBBL is a type II transmembrane protein. Complete or full length 4-lBBL having the amino acid sequence of SEQ ID NO:86 has been described to form trimers on the surface of cells. The formation of trimers is enabled by specific motives of the ectodomain of 4-lBBL. Said motives are designated herein as "trimerization region”.
- amino acids 50- 254 of the human 4-lBBL sequence form the extracellular domain of 4- 1BBL, but even fragments thereof are able to form the trimers.
- the term "ectodomain of 4-lBBL or a fragment thereof refers to a polypeptide having an amino acid sequence selected from SEQ ID NO:4 (amino acids 52-254 of human 4- 1BBL), SEQ ID NO: l (amino acids 71-254 of human 4-lBBL), SEQ ID NO:3 (amino acids 80-254 of human 4-lBBL), SEQ ID NO:2 (amino acids 85-254 of human 4-lBBL), SEQ ID NO:5 (amino acids 71-248 of human 4-lBBL), SEQ ID NO:6 (amino acids 85-248 of human 4-lBBL), SEQ ID NO:7 (amino acids 80-248 of human 4-lBBL) and SEQ ID NO:8 (amino acids 52-248 of human 4-
- 4-1BB refers to any native 4- IBB from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- the term encompasses "full-length,” unprocessed 4- IBB as well as any form of 4- IBB that results from processing in the cell.
- the term also encompasses naturally occurring variants of 4-1BB, e.g., splice variants or allelic variants.
- the amino acid sequence of an exemplary human 4- IBB is shown in SEQ ID NO: 88 (Uniprot accession no.
- amino acid sequence of an exemplary murine 4-1BB is shown in SEQ ID NO: 89 (Uniprot accession no. P20334) and the amino acid sequence of an exemplary cynomolgous 4- IBB (from Macaca mulatta) is shown in SEQ ID NO:90 (Uniprot accession no. F6W5G6).
- anti-4-lBB antibody refers to an antibody that is capable of binding 4-lBB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting 4- IBB.
- an antibody that binds to 4- IBB has a dissociation constant ( K D ) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "6 M or less, e.g.
- peptide linker refers to a peptide comprising one or more amino acids, typically about 2 to 20 amino acids. Peptide linkers are known in the art or are described herein. Suitable, non-immunogenic linker peptides are, for example, (G 4 S) n , (SG 4 ) n or G 4 (SG 4 ) n peptide linkers, wherein "n” is generally a number between 1 and 10, typically between 2 and 4, in particular 2, i.e.
- GGGGS GGGSGGGGS
- SEQ ID NO:92 GGGGSGGGGS
- SEQ ID NO:93 SGGGGSGGGGGG
- SEQ ID NO:94 GGGGSGGGGSGGGG
- Peptide linkers of particular interest are (G4S) (SEQ ID NO:91), (G 4 S) 2 and GGGGSGGG
- amino acid denotes the group of naturally occurring carboxy a-amino acids comprising alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gin, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
- fused or “connected” is meant that the components (e.g. a polypeptide and an ectodomain of 4-1BBL) are linked by peptide bonds, either directly or via one or more peptide linkers.
- Percent (%) amino acid sequence identity with respect to a reference polypeptide (protein) sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN. SAWI or Megalign
- ALIGN-2 The ALIGN-2 sequence comparison computer program was authored by
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
- the ALIGN- 2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- Amino acid sequence variants of the antigen binding molecules may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the molecules, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen- binding.
- Sites of interest for substitutional mutagenesis include the HVRs and Framework (FRs).
- Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, He;
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
- amino acid sequence variants includes substantial variants wherein there are amino acid substitutions in one or more hypervariable region residues of a parent antigen binding molecule (e.g. a humanized or human antibody).
- a parent antigen binding molecule e.g. a humanized or human antibody.
- the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antigen binding molecule and/or will have substantially retained certain biological properties of the parent antigen binding molecule.
- An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein.
- one or more CDR residues are mutated and the variant antigen binding molecules displayed on phage and screened for a particular biological activity (e.g. binding affinity).
- substitutions, insertions, or deletions may occur within one or more CDRs so long as such alterations do not substantially reduce the ability of the antigen binding molecule to bind antigen.
- conservative alterations e.g., conservative substitutions as provided herein
- a residue or group of target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
- a crystal structure of an antigen-antigen binding molecule complex to identify contact points between the antibody and antigen.
- Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
- Variants may be screened to determine whether they contain the desired properties.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include antigen binding molecules with an N-terminal methionyl residue.
- Other insertional variants of the molecule include the fusion to the N- or C-terminus to a polypeptide which increases the serum half-life of the antigen binding molecules.
- the antigen binding molecules provided herein are altered to increase or decrease the extent to which the antibody is glycosylated.
- Glycosylation variants of the molecules may be conveniently obtained by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
- the antigen binding molecule comprises an Fc region
- the carbohydrate attached thereto may be altered.
- Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997).
- the oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure.
- modifications of the oligosaccharide in the antigen binding molecules may be made in order to create variants with certain improved properties.
- variants of antigen binding molecules are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. Such fucosylation variants may have improved ADCC function, see e.g.
- variants of the antigen binding molecules of the invention include those with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region is bisected by GlcNAc. Such variants may have reduced fucosylation and/or improved ADCC function., see for example WO 2003/011878 (Jean-Mairet et al.); US Patent No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al.). Variants with at least one galactose residue in the
- oligosaccharide attached to the Fc region are also provided.
- Such antibody variants may have improved CDC function and are described, e.g., in WO 1997/30087 (Patel et al.); WO
- cysteine engineered variants of the antigen binding molecules of the invention e.g., "thioMAbs”
- one or more residues of the molecule are substituted with cysteine residues.
- the substituted residues occur at accessible sites of the molecule.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker- drug moieties, to create an immunoconjugate.
- any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
- Cysteine engineered antigen binding molecules may be generated as described, e.g., in U.S. Patent No. 7,521,541.
- the antigen binding molecules provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
- water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3- dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide copolymers, polyoxyethylated polyols (e.g., PEG), copo
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the bispecific antibody derivative will be used in a therapy under defined conditions, etc.
- conjugates of an antibody and non-proteinaceous moiety that may be selectively heated by exposure to radiation are provided.
- the non-proteinaceous moiety is a carbon nanotube (Kam, N.W. et al., Proc. Natl. Acad. Sci. USA 102 (2005) 11600-11605).
- the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the non-proteinaceous moiety to a temperature at which cells proximal to the antibody-non-proteinaceous moiety are killed.
- immunoconjugates of the 4-lBBL-containing antigen binding molecules provided herein maybe obtained.
- An "immunoconjugate" is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
- polynucleotide refers to an isolated nucleic acid molecule or construct, e.g. messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA).
- mRNA messenger RNA
- pDNA virally-derived RNA
- a polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g. an amide bond, such as found in peptide nucleic acids (PNA).
- PNA peptide nucleic acids
- nucleic acid molecule refers to any one or more nucleic acid segments, e.g. DNA or RNA fragments, present in a polynucleotide.
- isolated nucleic acid molecule or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment.
- a recombinant polynucleotide encoding a polypeptide contained in a vector is considered isolated for the purposes of the present invention. Further examples of an isolated nucleic acid molecule or polynucleotide
- polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution.
- An isolated polynucleotide includes a polynucleotide molecule contained in cells that ordinarily contain the
- RNA molecules include in vivo or in vitro RNA transcripts of the present invention, as well as positive and negative strand forms, and double- stranded forms. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
- a polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
- nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence.
- up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
- alterations of the reference sequence may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- whether any particular polynucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs, such as the ones discussed above for polypeptides (e.g. ALIGN-2).
- expression cassette refers to a polynucleotide generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be
- the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- the expression cassette of the invention comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
- vector or "expression vector” is synonymous with "expression construct” and refers to a DNA molecule that is used to introduce and direct the expression of a specific gene to which it is operably associated in a target cell.
- the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- the expression vector of the present invention comprises an expression cassette. Expression vectors allow transcription of large amounts of stable mRNA. Once the expression vector is inside the target cell, the ribonucleic acid molecule or protein that is encoded by the gene is produced by the cellular transcription and/or translation machinery.
- the expression vector of the invention comprises an expression cassette that comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
- host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
- Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
- a host cell is any type of cellular system that can be used to generate the bispecific antigen binding molecules of the present invention.
- Host cells include cultured cells, e.g.
- mammalian cultured cells such as CHO cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
- an “effective amount” of an agent refers to the amount that is necessary to result in a physiological change in the cell or tissue to which it is administered.
- the combination therapies in accordance with the invention have a synergistic effect.
- a "synergistic effect" of two compounds is one in which the effect of the combination of the two agents is greater than the sum of their individual effects and is statistically different from the controls and the single drugs.
- the combination therapies disclosed herein have an additive effect.
- An “additive effect” of two compounds is one in which the effect of the combination of the two agents is the sum of their individual effects and is statistically different from either the controls and/or the single drugs.
- a “therapeutically effective amount” of an agent e.g. a pharmaceutical composition, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- a therapeutically effective amount of an agent for example eliminates, decreases, delays, minimizes or prevents adverse effects of a disease.
- An "individual” or “subject” is a mammal. Mammals include, but are not limited to, domesticated animals (e.g. cows, sheep, cats, dogs, and horses), primates (e.g. humans and non-human primates such as monkeys), rabbits, and rodents (e.g. mice and rats). Particularly, the individual or subject is a human.
- composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical composition, other than an active ingredient, which is nontoxic to a subject.
- pharmaceutically acceptable excipient includes, but is not limited to, a buffer, a stabilizer, or a preservative.
- package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
- treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- the molecules of the invention are used to delay development of a disease or to slow the progression of a disease.
- cancer refers to proliferative diseases, such as solid tumors, or melanoma.
- CD20 refers to B-lymphocyte antigen CD20, also known as B-lymphocyte surface antigen Bl or Leukocyte surface antigen Leu- 16, and includes any native CD20 from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human CD20 is shown in Uniprot accession no. PI 1836 (version 149, SEQ ID NO: 159).
- CD20 is a hydrophobic transmembrane protein with a molecular weight of approximately 35 kD expressed on pre-B and mature B lymphocytes.
- the corresponding human gene is membrane- spanning 4-domains, subfamily A, member 1, also known as MS4A1.
- This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
- This gene encodes the B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 1 lql2, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
- CD20 encompasses "full-length,” unprocessed CD20 as well as any form of CD20 that results from processing in the cell.
- the term also encompasses naturally occurring variants of CD20, e.g., splice variants or allelic variants.
- anti-CD20 antibody and “an antibody that binds to CD20” refer to an antibody that is capable of binding CD20 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD20.
- the extent of binding of an anti-CD20 antibody to an unrelated, non-CD20 protein is less than about 10% of the binding of the antibody to CD20 as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to CD20 has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "8 M or less, e.g. from 10 "8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
- Kd dissociation constant
- an anti-CD20 antibody binds to an epitope of CD20 that is conserved among CD20 from different species.
- Type II anti-CD20 antibody an anti-CD20 antibody having binding properties and biological activities of Type II anti-CD20 antibodies as described in Cragg et al., Blood 103 (2004) 2738-2743; Cragg et al., Blood 101 (2003) 1045-1052, Klein et al., mAbs 5 (2013), 22-33.
- a type II anti-CD20 antibody binds to class II epitope on CD20, it does not localize CD20 to lipid rafts, shows ADCC activity, but low CDC if it is a IgGl isotype antibody, has less binding capacity to B cells compared with antibodies binding to the Class I CD20 epitope, shows homotypic aggregation and strong death induction.
- type II anti-CD20 antibodies include e.g. obinutuzumab (GA101), tositumumab (Bl), humanized B-Lyl antibody IgGl (a chimeric humanized IgGl antibody as disclosed in WO 2005/044859), 11B8 IgGl (as disclosed in WO 2004/035607) and AT80 IgGl.
- the Type II anti-CD20 antibody is obinutuzumab (recommended INN, WHO Drug Information, Vol. 26, No. 4, 2012, p. 453).
- obinutuzumab is
- the Type II anti-CD20 antibody is tositumomab.
- anti-CEA/anti-CD3 bispecific antibodies for use in the invention
- the present invention relates to anti-CEA/anti-CD3 bispecific antibodies and their use in combination with 4-1BB (CD137) agonists, in particular to their use use in a method for treating or delaying progression of cancer, more particularly for treating or delaying progression of solid tumors.
- the anti-CEA/anti-CD3 bispecific antibodies as used herein are bispecific antibodies comprising a first antigen binding domain that binds to CD3, and a second antigen binding domain that binds to CEA.
- the anti-CEA/anti-CD3 bispecific antibody as used herein comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) and a light chain variable region (V L CD3), and a second antigen binding domain comprising a heavy chain variable region (V H CEA) and a light chain variable region (V L CEA).
- the anti-CEA/anti-CD3 bispecific antibody for use in the combination comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) comprising CDR-H1 sequence of SEQ ID NO:33, CDR-H2 sequence of SEQ ID NO:34, and CDR-H3 sequence of SEQ ID NO:35; and/or a light chain variable region (V L CD3) comprising CDR-Ll sequence of SEQ ID NO:36, CDR-L2 sequence of SEQ ID NO:37, and CDR-L3 sequence of SEQ ID NO:38.
- V H CD3 heavy chain variable region
- V L CD3 light chain variable region
- the anti-CEA/anti- CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:39 and/or a light chain variable region (V L CD3) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:40.
- the anti-CEA/anti-CD3 bispecific antibody comprises a heavy chain variable region (V H CD3) comprising the amino acid sequence of SEQ ID NO:39 and/or a light chain variable region (V L CD3) comprising the amino acid sequence of SEQ ID NO:40.
- the antibody that specifically binds to CD3 is a full-length antibody.
- the antibody that specifically binds to CD3 is an antibody of the human IgG class, particularly an antibody of the human IgGi class.
- the antibody that specifically binds to CD3 is an antibody fragment, particularly a Fab molecule or a scFv molecule, more particularly a Fab molecule.
- the antibody that specifically binds to CD3 is a crossover Fab molecule wherein the variable domains or the constant domains of the Fab heavy and light chain are exchanged (i.e. replaced by each other).
- the antibody that specifically binds to CD3 is a humanized antibody.
- the anti-CEA/anti-CD3 bispecific antibody comprises a second antigen binding domain comprising
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a second antigen binding domain comprising a heavy chain variable region (V H CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:47 and/or a light chain variable region (V L CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:48.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a second antigen binding domain comprising a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:47 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:48.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a second antigen binding domain comprising a heavy chain variable region (V H CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:55 and/or a light chain variable region (V L CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:56.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a second antigen binding domain comprising a heavy chain variable region
- V H CEA comprising the amino acid sequence of SEQ ID NO:55 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:56.
- the anti-CEA/anti-CD3 bispecific antibody comprises a third antigen binding domain that binds to CEA.
- the anti-CEA/anti-CD3 bispecific antibody comprises a third antigen binding domain comprising
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a third antigen binding domain comprising a heavy chain variable region (V H CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:47 and/or a light chain variable region (V L CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:48.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a third antigen binding domain comprising a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:47 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:48.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a third antigen binding domain comprising a heavy chain variable region (V H CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:55 and/or a light chain variable region (V L CEA) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:56.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific comprises a third antigen binding domain comprising a heavy chain variable region (V H CEA) comprising the amino acid sequence of SEQ ID NO:55 and/or a light chain variable region (V L CEA) comprising the amino acid sequence of SEQ ID NO:56.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the anti-CEA/anti-CD3 bispecific antibody is bispecific antibody, wherein the first antigen binding domain is a cross-Fab molecule wherein the variable domains or the constant domains of the Fab heavy and light chain are exchanged, and the second and third, if present, antigen binding domain is a conventional Fab molecule.
- the anti-CEA/anti-CD3 bispecific antibody is bispecific antibody, wherein (i) the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding domain, the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and the third antigen binding domain is fused at the C- terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain, or (ii) the first antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding domain, the second antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and the third antigen binding domain is fused at the C-terminus of the Fab heavy chain to the N-
- the Fab molecules may be fused to the Fc domain or to each other directly or through a peptide linker, comprising one or more amino acids, typically about 2-20 amino acids.
- Peptide linkers are known in the art and are described herein. Suitable, non-immunogenic peptide linkers include, for example, (G 4 S) n , (SG 4 ) n , (G 4 S) n or G 4 (SG 4 ) n peptide linkers, "n" is generally an integer from 1 to 10, typically from 2 to 4.
- said peptide linker has a length of at least 5 amino acids, in one embodiment a length of 5 to 100, in a further embodiment of 10 to 50 amino acids.
- said peptide linker is (G 4 S)2.
- a particularly suitable peptide linker for fusing the Fab light chains of the first and the second Fab molecule to each other is (G 4 S) 2 .
- An exemplary peptide linker suitable for connecting the Fab heavy chains of the first and the second Fab fragments comprises the sequence (D)-(G 4 S) 2 .
- Another suitable such linker comprises the sequence (G 4 S) 4 .
- linkers may comprise (a portion of) an immunoglobulin hinge region. Particularly where a Fab molecule is fused to the N-terminus of an Fc domain subunit, it may be fused via an immunoglobulin hinge region or a portion thereof, with or without an additional peptide linker.
- the anti-CEA/anti-CD3 bispecific antibody comprises an Fc domain comprising one or more amino acid substitutions that reduce binding to an Fc receptor and/or effector function.
- the anti-CEA/anti-CD3 bispecific antibody comprises an IgGl Fc domain comprising the amino aciod substitutions L234A, L235A and P329G.
- the anti-CEA/anti-CD3 bispecific antibody comprises a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 61, a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 62, a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 63, and a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 64.
- the bispecific antibody comprises a polypeptide sequence of SEQ ID NO: 61, a polypeptide sequence of SEQ ID NO: 62, a polypeptide sequence of SEQ ID NO: 63 and a polypeptide sequence of SEQ ID NO: 64 (CEA CD3 TCB).
- the anti-CEA/anti-CD3 bispecific antibody comprises a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO:57, a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO:58, a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO:59, and a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO:60.
- the bispecific antibody comprises a polypeptide sequence of SEQ ID NO:57, a polypeptide sequence of SEQ ID NO:58, a polypeptide sequence of SEQ ID NO:59 and a polypeptide sequence of SEQ ID NO:60 (CEACAM5 CD3 TCB).
- the anti-CEA/anti-CD3 bispecific antibody may also comprise a bispecific T cell engager (BiTE®).
- the anti-CEA/anti-CD3 bispecific antibody is a bispecific antibody as described in WO 2007/071426 or WO 2014/131712.
- the bispecific antibody is MED 1565.
- the present invention also relates to anti-FolRl/anti-CD3 bispecific antibodies and their use in combination with 4-1BB (CD137) agonists, in particular to their use use in a method for treating or delaying progression of cancer, more particularly for treating or delaying progression of solid tumors.
- the anti-FolRl/anti-CD3 bispecific antibodies as used herein are bispecific antibodies comprising a first antigen binding domain that binds to CD3, and a second antigen binding domain that binds to FolRl.
- the anti-FolRl/anti-CD3 bispecific antibodies as used herein comprise a third antigen binding domain that binds to FolRl.
- the T-cell activating anti-CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3), a second antigen binding domain comprising a heavy chain variable region (V H FOIRI), a third antigen binding domain comprising a heavy chain variable region (V H FOIRI) and three times a common light chain variable region.
- V H CD3 heavy chain variable region
- V H FOIRI heavy chain variable region
- V H FOIRI heavy chain variable region
- V H FOIRI heavy chain variable region
- the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising CDR-Hl sequence of SEQ ID NO: 121, CDR-H2 sequence of SEQ ID NO: 122, and CDR-H3 sequence of SEQ ID NO: 123;
- the second antigen binding domain comprises a heavy chain variable region (V H FOIRI) comprising CDR-Hl sequence of SEQ ID NO: 124, CDR-H2 sequence of SEQ ID NO: 125, and CDR-H3 sequence of SEQ ID NO: 126;
- the third antigen binding domain comprises a heavy chain variable region (V H FOIRI) comprising CDR-Hl sequence of SEQ ID NO: 124, CDR-H2 sequence of SEQ ID NO: 125, and CDR-H3 sequence of SEQ ID NO: 126;
- the common light chains comprise a CDR-Ll sequence of SEQ ID NO: 127, CDR-L2 sequence of SEQ ID NO: 128, and CDR-L3 sequence of SEQ
- the first antigen binding domain comprises a heavy chain variable region (V H CD3) comprising the sequence of SEQ ID NO: 130;
- the second antigen binding domain comprises a heavy chain variable region (V H FOIRI) comprising the sequence of SEQ ID NO: 131;
- the third antigen binding domain comprises a heavy chain variable region (V H FOIRI) comprising the sequence of SEQ ID NO: 131; and the common light chains comprise the sequence of SEQ ID NO: 132.
- the anti-FolRl/anti-CD3 bispecific antibody comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 133, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 134 and three times a common light chain of SEQ ID NO: 135.
- anti-MCSP/anti-CD3 bispecific antibodies for use in the invention
- the present invention further relates to anti-MCSP/anti-CD3 bispecific antibodies and their use in combination with 4-1BB (CD137) agonists, in particular to their use use in a method for treating or delaying progression of cancer, more particularly for treating or delaying progression of solid tumors.
- the anti-MCSP/anti-CD3 bispecific antibodies as used herein are bispecific antibodies comprising a first antigen binding domain that binds to CD3, and a second antigen binding domain that binds to MCSP.
- the anti-MCSP/anti- CD3 bispecific antibodies as used herein comprise a third antigen binding domain that binds to MCSP.
- the T-cell activating anti-CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) and a light chain variable region (V L CD3), and a second antigen binding domain comprising a heavy chain variable region (V H MCSP) and a light chain variable region (ViMCSP).
- V H CD3 heavy chain variable region
- V H FOIRI heavy chain variable region
- V H FOIRI heavy chain variable region
- the anti-MCSP/anti-CD3 bispecific antibody for use in the combination comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) comprising CDR-H1 sequence of SEQ ID NO:33, CDR-H2 sequence of SEQ ID NO:34, and CDR-H3 sequence of SEQ ID NO:35; and/or a light chain variable region (V L CD3) comprising CDR-L1 sequence of SEQ ID NO:36, CDR-L2 sequence of SEQ ID NO:37, and CDR-L3 sequence of SEQ ID NO:38.
- V H CD3 heavy chain variable region
- V L CD3 light chain variable region
- the anti-MCSP/anti- CD3 bispecific antibody comprises a first antigen binding domain comprising a heavy chain variable region (V H CD3) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:39 and/or a light chain variable region (V L CD3) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO:40.
- the anti-MCSP/anti-CD3 bispecific antibody comprises a heavy chain variable region (V H CD3) comprising the amino acid sequence of SEQ ID NO:39 and/or a light chain variable region (V L CD3) comprising the amino acid sequence of SEQ ID NO:40.
- the anti-MCSP/anti-CD3 bispecific antibody comprises a second antigen binding domain comprising a heavy chain variable region (V H MCSP) comprising CDR-H1 sequence of SEQ ID NO: 151, CDR-H2 sequence of SEQ ID NO: 152, and CDR-H3 sequence of SEQ ID NO: 153, and/or a light chain variable region (ViMCSP) comprising CDR-L1 sequence of SEQ ID NO: 154, CDR-L2 sequence of SEQ ID NO: 155, and CDR-L3 sequence of SEQ ID NO: 156.
- V H MCSP heavy chain variable region
- ViMCSP light chain variable region
- the anti-MCSP/anti-CD3 bispecific comprises a second antigen binding domain comprising a heavy chain variable region (V H MCSP) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 157 and/or a light chain variable region (V L MCSP) that is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 158.
- V H MCSP heavy chain variable region
- V L MCSP light chain variable region
- the anti- MCSP/anti-CD3 bispecific comprises a second antigen binding domain comprising a heavy chain variable region (V H MCSP) comprising the amino acid sequence of SEQ ID NO: 157 and/or a light chain variable region (ViMCSP) comprising the amino acid sequence of SEQ ID NO: 158.
- V H MCSP heavy chain variable region
- ViMCSP light chain variable region
- the anti-MCSP/anti-CD3 bispecific antibody comprises a third antigen binding domain that binds to MCSP.
- the anti-MCSP/anti-CD3 bispecific antibody comprises a third antigen binding domain comprising
- V H MCSP heavy chain variable region
- ViMCSP light chain variable region
- the anti-MCSP/anti-CD3 bispecific comprises a third antigen binding domain comprising a heavy chain variable region (V H MCSP) comprising the amino acid sequence of SEQ ID NO: 157 and/or a light chain variable region (ViMCSP) comprising the amino acid sequence of SEQ ID NO: 158.
- V H MCSP heavy chain variable region
- ViMCSP light chain variable region
- the anti-MCSP/anti-CD3 bispecific antibody comprises an Fc domain comprising one or more amino acid substitutions that reduce binding to an Fc receptor and/or effector function.
- the anti-MCSP/anti-CD3 bispecific antibody comprises an IgGl Fc domain comprising the amino aciod substitutions L234A, L235A and P329G.
- the anti-MCSP/anti-CD3 bispecific antibody comprises a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 147, a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 148, a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 149, and a polypeptide that is at least 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 150.
- the bispecific antibody comprises a polypeptide sequence of SEQ ID NO: 147, a polypeptide sequence of SEQ ID NO: 148, a polypeptide sequence of SEQ ID NO: 149 and a polypeptide sequence of SEQ ID NO: 150 (MCSP CD3 TCB).
- MCSP CD3 TCB polypeptide sequence of SEQ ID NO: 147, a polypeptide sequence of SEQ ID NO: 148, a polypeptide sequence of SEQ ID NO: 149 and a polypeptide sequence of SEQ ID NO: 150
- Particular anti-MCSP/anti-CD3 bispecific antibodies are described in PCT publication no. WO 2014/131712 Al.
- the 4- IBB agonists as used in combination with the anti-CEA/anti-CD3 bispecific antibody are molecules comprising 4-1BBL.
- the 4-1BB agonist used in the invention comprises three ectodomains of 4-1BBL or fragments thereof.
- the 4- IBB agonist is a molecule comprising three ectodomains of 4-1BBL or fragments thereof and wherein the ectodomains of 4-1BBL comprise an amino acid sequence selected from the group consisting of SEQ ID NO: l, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO: 6, SEQ ID NO:7 and SEQ ID NO:8, particularly the amino acid sequence of SEQ ID NO: l or SEQ ID NO:5.
- the 4- IBB agonist is especially useful if it comprises an antigen binding domain that is specific for a tumor-associated antigen, in particular for a target on cancer cells or in the stroma.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to FAP or CEA.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to FAP, wherein the antigen binding domain capable of specific binding to FAP comprises
- V H FAP heavy chain variable region
- V H FAP heavy chain variable region
- CDR-Hl comprising the amino acid sequence of SEQ ID NO:9
- CDR-H2 comprising the amino acid sequence of SEQ ID NO: 10
- CDR-H3 comprising the amino acid sequence of SEQ ID NO: 11
- ViFAP light chain variable region
- V H FAP heavy chain variable region
- V H FAP heavy chain variable region
- CDR-Hl comprising the amino acid sequence of SEQ ID NO: 15
- CDR-H2 comprising the amino acid sequence of SEQ ID NO: 16
- CDR-H3 comprising the amino acid sequence of SEQ ID NO: 17
- ViFAP light chain variable region
- the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising (i) CDR-Hl comprising the amino acid sequence of SEQ ID NO: 15, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 16, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 17, and a a light chain variable region (ViFAP) comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 18, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 19, and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO:20.
- V H FAP heavy chain variable region
- ViFAP light chain variable region comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 18, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 19, and (vi) CDR-L3 comprising the
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to FAP, wherein the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:21 and a light chain variable region (ViFAP) comprising an amino acid sequence of SEQ ID NO:22 or wherein the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:23 and a light chain variable region (ViFAP) comprising an amino acid sequence of SEQ ID NO:24.
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:23 and a light chain variable region (ViFAP) comprising an amino acid sequence of SEQ ID NO:24.
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- the 4- IBB agonist is an antigen binding molecule further comprising a Fc domain composed of a first and a second subunit capable of stable association.
- the 4- IBB agonist is an antigen binding molecule comprising an IgG Fc domain, specifically an IgGl Fc domain or an IgG4 Fc domain.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain that comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the 4- IBB agonist is an antigen binding molecule comprising an IgGl Fc domain comprising the amino acid substitutions L234A, L235A and P329G.
- the 4- IBB agonist is an antigen binding molecule comprising
- the 4- IBB agonist is an antigen binding molecule comprising
- the first polypeptide contains a CHI or CL domain and the second polypeptide contains a CL or CHI domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to the CHI or CL domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment therof connected via a peptide linker to the CL or CHI domain of said polypeptide, or
- the first polypeptide contains a CH3 domain and the second polypeptide contains a CH3 domain, respectively, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to the C-terminus of the CH3 domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment thereof connected via a peptide linker to the C-terminus of the CH3 domain of said polypeptide, or
- the first polypeptide contains a VH-CL or a VL-CH1 domain and the second polypeptide contains a VL-CH1 domain or a VH-CL domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-1BBL or fragments thereof that are connected to each other and to VH or VL by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-1BBL or a fragment thereof connected via a peptide linker to VL or VH of said polypeptide.
- the 4- IBB agonist is an antigen binding molecule comprising
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- the antigen binding molecule comprises the amino acid sequence selected from the group consisting of SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 and SEQ ID NO:32 and in that the second polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.
- the 4- IBB agonist is an antigen binding molecule selected from the group consisting of a) a molecule comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO:65, a first light chain comprising the amino acid sequence of SEQ ID NO:66, a second heavy chain comprising the amino acid sequence of SEQ ID NO:67 and a second light chain comprising the amino acid sequence of SEQ ID NO:68; and
- SEQ ID NO:69 a first light chain comprising the amino acid sequence of SEQ ID NO:70, a second heavy chain comprising the amino acid sequence of SEQ ID NO:71 and a second light chain comprising the amino acid sequence of SEQ ID NO:72.
- the 4- IBB agonist is an antigen binding molecule comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO:65, a first light chain comprising the amino acid sequence of SEQ ID NO:66, a second heavy chain comprising the amino acid sequence of SEQ ID NO:67 and a second light chain comprising the amino acid sequence of SEQ ID NO:68.
- the 4- IBB agonist is an antigen binding molecule comprising (a) at least one antigen binding domain capable of specific binding to FAP,
- the 4- IBB agonist is an antigen binding molecule comprising
- a Fc domain composed of a first and a second subunit capable of stable association, wherein the polypeptide comprising the three ectodomains of 4-1BBL or fragments thereof that are connected to each other by peptide linkers is fused to the N- or C-terminal amino acid of one of the two subunits of the Fc domain, optionally through a peptide linker.
- the 4- IBB agonist is an anti-FAP/anti-4-lBB bispecific antibody.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-1BBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA, wherein the antigen binding domain capable of specific binding to CEA comprises a heavy chain variable region (V H CEA) comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:49, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:50, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:51, and a light chain variable region (V L CEA) comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO:52, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO:53, and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO:54.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA, wherein the antigen binding domain capable of specific binding to CEA comprises a heavy chain variable region (V H CEA) comprising an amino acid sequence of SEQ ID NO:55 and a light chain variable region (V L CEA) comprising an amino acid sequence of SEQ ID NO:56.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the 4- IBB agonist is an antigen binding molecule further comprising a Fc domain composed of a first and a second subunit capable of stable association.
- the 4- IBB agonist is an antigen binding molecule comprising an IgG Fc domain, specifically an IgGl Fc domain or an IgG4 Fc domain.
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain that comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the 4- IBB agonist is an antigen binding molecule comprising an IgGl Fc domain comprising the amino acid substitutions L234A, L235A and P329G.
- the 4- IBB agonist is an antigen binding molecule comprising
- the 4- IBB agonist is an antigen binding molecule comprising (a) at least one Fab domain capable of specific binding to CEA, and
- the first polypeptide contains a CHI or CL domain and the second polypeptide contains a CL or CHI domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4-lBBL or fragments thereof that are connected to each other and to the CHI or CL domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4-lBBL or a fragment therof connected via a peptide linker to the CL or CHI domain of said polypeptide, or
- the first polypeptide contains a CH3 domain and the second polypeptide contains a CH3 domain, respectively, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to the C-terminus of the CH3 domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment thereof connected via a peptide linker to the C-terminus of the CH3 domain of said polypeptide, or (iii) the first polypeptide contains a VH-CL or a VL-CH1 domain and the second polypeptide contains a VL-CH1 domain or a VH-CL domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to VH or VL by
- the 4- IBB agonist is an antigen binding molecule comprising
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the antigen binding molecule comprises the amino acid sequence selected from the group consisting of SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 and SEQ ID NO:32 and in that the second polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.
- the 4- IBB agonist is an antigen binding molecule comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO:65, a first light chain comprising the amino acid sequence of SEQ ID NO:66, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 108 and a second light chain comprising the amino acid sequence of SEQ ID NO: 109.
- the 4- IBB agonist is an antigen binding molecule comprising (a) at least one antigen binding domain capable of specific binding to CEA,
- the 4- IBB agonist is an antigen binding molecule comprising
- a Fc domain composed of a first and a second subunit capable of stable association, wherein the polypeptide comprising the three ectodomains of 4-1BBL or fragments thereof that are connected to each other by peptide linkers is fused to the N- or C-terminal amino acid of one of the two subunits of the Fc domain, optionally through a peptide linker.
- the 4- IBB agonist comprises an anti-CEA/anti-4-lBB bispecific antibody.
- the T-cell activating anti-CD3 bispecific antibodies specific for a tumor- associated antigen are for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibodies specific for a tumor-associated antigen are used in combination with a 4-1BB (CD137) agonist and additionally they are combined with an agent blocking PD-Ll/PD-1 interaction.
- the agent blocking PD-Ll/PD-1 interaction is only combined with a targeted 4-1BB agonist.
- an agent blocking PD-Ll/PD-1 interaction is a PD-Ll binding antagonist or a PD-1 binding antagonist.
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody or an anti-PD-1 antibody.
- PD-Ll also known as CD274 or B7-H1
- CD274 refers to any native PD-Ll from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), in particular to "human PD-Ll".
- mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), in particular to "human PD-Ll".
- the amino acid sequence of complete human PD-Ll is shown in UniProt
- PD-Ll binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-Ll with either one or more of its binding partners, such as PD-1, B7-1.
- a PD-Ll binding antagonist is a molecule that inhibits the binding of PD-Ll to its binding partners.
- the PD-Ll binding antagonist inhibits binding of PD-Ll to PD-1 and/or B7-1.
- the PD-Ll binding antagonists include anti-PD-Ll antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-Ll with one or more of its binding partners, such as PD-1, B7-1.
- a PD-Ll binding antagonist reduces the negative co- stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-Ll so as to render a dysfunctional T-cell less dysfunctional (e.g., enhancing effector responses to antigen recognition).
- a PD-Ll binding antagonist is an anti-PD-Ll antibody.
- anti-PD-Ll antibody or “antibody binding to human PD-Ll” or “antibody that specifically binds to human PD-Ll” or “antagonistic anti-PD-Ll” refers to an antibody specifically binding to the human PD-Ll antigen with a binding affinity of KD- value of 1.0 x 10 - " 8 mol/1 or lower, in one aspect of a KD-value of 1.0 xlO - " 9 mol/1 or lower.
- the binding affinity is determined with a standard binding assay, such as surface plasmon resonance technique (BIAcore®, GE-Healthcare Uppsala, Sweden).
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody.
- the anti-PD-Ll antibody is selected from the group consisting of atezolizumab (MPDL3280A, RG7446), durvalumab (MEDI4736), avelumab
- an anti-PD-Ll antibody is
- an anti-PD-Ll antibody is MDX- 1105 described herein.
- an anti-PD-Ll antibody is MEDI4736 (durvalumab).
- an anti-PD-Ll antibody is MSB0010718C (avelumab). More particularly, the agent blocking PD-Ll/PD-1 interaction is atezolizumab (MPDL3280A).
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody comprising a heavy chain variable domain VH(PDL- 1) of SEQ ID NO: 112 and a light chain variable domain VL(PDL-l) of SEQ ID NO: 113.
- the agent blocking PD- Ll/PD-1 interaction is an anti-PD-Ll antibody comprising a heavy chain variable domain VH(PDL-l) of SEQ ID NO: l 14 and a light chain variable domain VL(PDL-l) of SEQ ID NO: 115.
- PD-1 also known as CD279, PD1 or programmed cell death protein 1
- CD279 PD1 or programmed cell death protein 1
- mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), in particular to the human protein PD-1 with the amino acid sequence as shown in UniProt (www.uniprot.org) accession no. Q15116 (SEQ ID NO: 111).
- PD-1 binding antagonist refers to a molecule that inhibits the binding of PD-1 to its ligand binding partners. In some embodiments, the PD-1 binding antagonist inhibits the binding of PD-1 to PD-Ll.
- the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L2. In some embodiments, the PD-1 binding antagonist inhibits the binding of PD-1 to both PD-Ll and PD-L2. In particular, a PD-Ll binding antagonist is an anti-PD-Ll antibody.
- anti-PD-1 antibody or “antibody binding to human PD-1” or “antibody that specifically binds to human PD-1” or “antagonistic anti-PD-1” refers to an antibody specifically binding to the human PD1 antigen with a binding affinity of KD-value of 1.0 x
- the binding affinity is determined with a standard binding assay, such as surface plasmon resonance technique (BIAcore®, GE-Healthcare Uppsala, Sweden).
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-1 antibody.
- the anti-PD-1 antibody is selected from the group consisting of MDX 1106 (nivolumab), MK-3475 (pembrolizumab), CT-011 (pidilizumab), MEDI-0680 (AMP-514), PDR001, REGN2810, and BGB-108, in particular from pembrolizumab and nivolumab.
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-1 antibody comprising a heavy chain variable domain VH(PD-l) of SEQ ID NO: 116 and a light chain variable domain VL(PD-l) of SEQ ID NO: 117.
- the agent blocking PD- Ll/PD-1 interaction is an anti-PD-1 antibody comprising a heavy chain variable domain VH(PD-l) of SEQ ID NO: 118 and a light chain variable domain VL(PD-l) of SEQ ID NO: 119.
- the present invention also relates to 4- IBB agonists comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in a method for treating or delaying progression of cancer, wherein the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen is used in combination with an agent blocking PD-Ll/PD-1 interaction.
- the 4- IBB agonist is for use in a method for treating or delaying progression of cancer, wherein the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody or an anti-PDl antibody, in particular the agent blocking PD-Ll/PD-1 interaction is selected from the group consisting of atezolizumab, durvalumab, pembrolizumab and nivolumab. More particularly, the the agent blocking PD-Ll/PD-1 interaction is atezolizumab.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen for use in in combination with an agent blocking PD- Ll/PD-1 interaction is particularly one, wherein the tumor-associated antigen is selected from Fibroblast activation protein (FAP) or CEA. More particularly, the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to Fibroblast activation protein (FAP).
- FAP Fibroblast activation protein
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in a method for treating or delaying progression of cancer in combination with an agent blocking PD-Ll/PD-1 interaction is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to FAP, wherein the antigen binding domain capable of specific binding to FAP comprises (a) a heavy chain variable region (V H FAP) comprising (i) CDR-Hl comprising the amino acid sequence of SEQ ID NO:9, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 10, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 11, and a light chain variable region (ViFAP) comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO: 12, (v) CDR-L2 comprising the amino acid sequence of SEQ
- V H FAP heavy chain variable region
- V H FAP heavy chain variable region
- CDR-Hl comprising the amino acid sequence of SEQ ID NO: 15
- CDR-H2 comprising the amino acid sequence of SEQ ID NO: 16
- CDR-H3 comprising the amino acid sequence of SEQ ID NO: 17
- ViFAP light chain variable region
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in a method for treating or delaying progression of cancer in combination with an agent blocking PD-Ll/PD-1 interaction is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to FAP, wherein the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:21 and a light chain variable region (ViFAP) comprising an amino acid sequence of SEQ ID NO:22 or wherein the antigen binding domain capable of specific binding to FAP comprises a heavy chain variable region (V H FAP) comprising an amino acid sequence of SEQ ID NO:23 and a light chain variable region (ViFAP) comprising an amino acid sequence of SEQ ID NO:24.
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method is an antigen binding molecule comprising an IgG Fc domain, specifically an IgGl Fc domain or an IgG4 Fc domain.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen for use in the method is an antigen binding molecule comprising a Fc domain that comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen a method for treating or delaying progression of cancer in combination with an agent blocking PD-Ll/PD-1 interaction is an antigen binding molecule comprising
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in a method for treating or delaying progression of cancer in combination with an agent blocking PD-Ll/PD- 1 interaction is an antigen binding molecule comprising
- the first polypeptide contains a CHI or CL domain and the second polypeptide contains a CL or CHI domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to the CHI or CL domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment therof connected via a peptide linker to the CL or CHI domain of said polypeptide, or
- the first polypeptide contains a CH3 domain and the second polypeptide contains a CH3 domain, respectively, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to the C-terminus of the CH3 domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment thereof connected via a peptide linker to the C-terminus of the CH3 domain of said polypeptide, or
- the first polypeptide contains a VH-CL or a VL-CH1 domain and the second polypeptide contains a VL-CH1 domain or a VH-CL domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to VH or VL by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment thereof connected via a peptide linker to VL or
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method an antigen binding molecule comprising
- V H FAP heavy chain variable region
- V L FAP light chain variable region
- V H FAP heavy chain variable region
- ViFAP light chain variable region
- the antigen binding molecule comprises the amino acid sequence selected from the group consisting of SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 and SEQ ID NO:32 and in that the second polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method is an antigen binding molecule selected from the group consisting of
- a molecule comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO:69, a first light chain comprising the amino acid sequence of SEQ ID NO:70, a second heavy chain comprising the amino acid sequence of SEQ ID NO:71 and a second light chain comprising the amino acid sequence of SEQ ID NO:72.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in a method as described herein before is an antigen binding molecule comprising
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method is an antigen binding molecule comprising
- a Fc domain composed of a first and a second subunit capable of stable association, wherein the polypeptide comprising the three ectodomains of 4- 1BBL or fragments thereof that are connected to each other by peptide linkers is fused to the N- or C-terminal amino acid of one of the two subunits of the Fc domain, optionally through a peptide linker.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in in a method for treating or delaying progression of cancer in combination with an agent blocking PD-Ll/PD-1 interaction is an anti-FAP/anti-4-lBB bispecific antibody.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA.
- the 4- IBB agonist is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA, wherein the antigen binding domain capable of specific binding to CEA comprises (a) a heavy chain variable region (V H CEA) comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:49, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:50, and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:51, and a light chain variable region (V L CEA) comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO:52, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO:53, and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO:54.
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen for use in the method is an antigen binding molecule comprising three ectodomains of 4-lBBL or fragments thereof and at least one antigen binding domain capable of specific binding to CEA, wherein the antigen binding domain capable of specific binding to CEA comprises a heavy chain variable region (V H CEA) comprising an amino acid sequence of SEQ ID NO:55 and a light chain variable region (V L CEA) comprising an amino acid sequence of SEQ ID NO:56.
- the 4- IBB agonist is an antigen binding molecule comprising an IgG Fc domain, specifically an
- the 4- IBB agonist is an antigen binding molecule comprising a Fc domain that comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method described herein before is an antigen binding molecule comprising
- the 4- IBB agonist is an antigen binding molecule comprising
- the first polypeptide contains a CHI or CL domain and the second polypeptide contains a CL or CHI domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to the CHI or CL domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment therof connected via a peptide linker to the CL or CHI domain of said polypeptide, or
- the first polypeptide contains a CH3 domain and the second polypeptide contains a CH3 domain, respectively, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to the C-terminus of the CH3 domain by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment thereof connected via a peptide linker to the C-terminus of the CH3 domain of said polypeptide, or
- the first polypeptide contains a VH-CL or a VL-CH1 domain and the second polypeptide contains a VL-CH1 domain or a VH-CL domain, respectively, wherein the second polypeptide is linked to the first polypeptide by a disulfide bond between the CHI and CL domain, and wherein the first polypeptide comprises two ectodomains of 4- 1BBL or fragments thereof that are connected to each other and to VH or VL by a peptide linker and wherein the second polypeptide comprises one ectodomain of 4- 1BBL or a fragment thereof connected via a peptide linker to VL or
- the 4- IBB agonist for use in the method is an antigen binding molecule comprising
- V H CEA heavy chain variable region
- V L CEA light chain variable region
- the antigen binding molecule comprises the amino acid sequence selected from the group consisting of SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 and SEQ ID NO:32 and in that the second polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.
- the 4- IBB agonist is an antigen binding molecule comprising a first heavy chain comprising the amino acid sequence of SEQ ID NO:65, a first light chain comprising the amino acid sequence of SEQ ID NO:66, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 108 and a second light chain comprising the amino acid sequence of SEQ ID NO:109.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method is an antigen binding molecule comprising (a) at least one antigen binding domain capable of specific binding to CEA, and (b) a polypeptide comprising three ectodomains of 4-lBBL or fragments thereof that are connected to each other by peptide linkers.
- the 4- IBB agonist for use in the method is an antigen binding molecule comprising
- a Fc domain composed of a first and a second subunit capable of stable association, wherein the polypeptide comprising the three ectodomains of 4-lBBL or fragments thereof that are connected to each other by peptide linkers is fused to the N- or C-terminal amino acid of one of the two subunits of the Fc domain, optionally through a peptide linker.
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen for use in the method is an anti- CEA/anti-4-lBB bispecific antibody.
- the therapeutic agents used in the combination comprise multispecific antibodies, e.g. bispecific antibodies.
- Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites.
- the binding specificities are for different antigens.
- the binding specificities are for different epitopes on the same antigen.
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
- Multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob-in-hole” engineering (see, e.g., U.S. Patent No. 5,731,168). Multi- specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO
- the antibodies or fragmentsa herein also include a “Dual Acting FAb” or “DAF” comprising an antigen binding site that binds to two different antigens (see, US 2008/0069820, for example).
- “Crossmab” antibodies are also included herein (see e.g. WO 2009/080251, WO 2009/080252, WO2009/080253, or WO2009/080254).
- bispecific T cell engager or BiTE® approach (see, e.g., WO2004/106381, WO2005/061547,
- a single polypeptide chain includes two single chain Fv (scFv) fragments, each having a variable heavy chain (VH) and a variable light chain (VL) domain separated by a polypeptide linker of a length sufficient to allow intramolecular association between the two domains.
- This single polypeptide further includes a polypeptide spacer sequence between the two scFv fragments.
- Each scFv recognizes a different epitope, and these epitopes may be specific for different cell types, such that cells of two different cell types are brought into close proximity or tethered when each scFv is engaged with its cognate epitope.
- One particular embodiment of this approach includes a scFv recognizing a cell-surface antigen expressed by an immune cell, e.g., a CD3 polypeptide on a T cell, linked to another scFv that recognizes a cell-surface antigen expressed by a target cell, such as a malignant or tumor cell.
- the bispecific T cell engager may be expressed using any prokaryotic or eukaryotic cell expression system known in the art, e.g., a CHO cell line.
- a solution containing secreted polypeptides is first subjected to a metal affinity chromatography, and polypeptides are eluted with a gradient of imidazole
- the bispecific bispecific antibodies used in the invention are composed of a single polypeptide chain comprising two single chain FV fragments (scFV) fused to each other by a peptide linker. Fc domain modifications reducing Fc receptor binding and/or effector function
- the Fc domain of the antigen binding molecules of the invention consists of a pair of polypeptide chains comprising heavy chain domains of an immunoglobulin molecule.
- the Fc domain of an immunoglobulin G (IgG) molecule is a dimer, each subunit of which comprises the CH2 and CH3 IgG heavy chain constant domains.
- the two subunits of the Fc domain are capable of stable association with each other.
- the Fc domain confers favorable pharmacokinetic properties to the antigen binding molecules of the invention, including a long serum half-life which contributes to good accumulation in the target tissue and a favorable tissue-blood distribution ratio. At the same time it may, however, lead to undesirable targeting of the bispecific antibodies of the invention to cells expressing Fc receptors rather than to the preferred antigen-bearing cells. Accordingly, in particular aspects, the Fc domain of the antigen binding molecules of the invention exhibits reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgGl Fc domain. In one aspect, the Fc does not substantially bind to an Fc receptor and/or does not induce effector function. In a particular aspect the Fc receptor is an Fey receptor.
- the Fc receptor is a human Fc receptor.
- the Fc receptor is an activating human Fey receptor, more specifically human FcyRIIIa, FcyRI or FcyRIIa, most specifically human FcyRIIIa.
- the Fc domain does not induce effector function.
- the reduced effector function can include, but is not limited to, one or more of the following: reduced complement dependent cytotoxicity (CDC), reduced antibody- dependent cell-mediated cytotoxicity (ADCC), reduced antibody-dependent cellular phagocytosis (ADCP), reduced cytokine secretion, reduced immune complex-mediated antigen uptake by antigen-presenting cells, reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing apoptosis, reduced dendritic cell maturation, or reduced T cell priming.
- CDC reduced complement dependent cytotoxicity
- ADCC reduced antibody- dependent cell-mediated cytotoxicity
- ADCP reduced antibody-dependent cellular phagocytosis
- reduced immune complex-mediated antigen uptake by antigen-presenting cells reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing apoptosis, reduced den
- one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
- the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
- the invention provides an antibody, wherein the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor, in particular towards Fey receptor.
- the Fc domain of the antibody of the invention comprises one or more amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor and/or effector function.
- the same one or more amino acid mutation is present in each of the two subunits of the Fc domain.
- the Fc domain comprises an amino acid substitution at a position of E233, L234, L235, N297, P331 and P329 (EU numbering).
- the Fc domain comprises amino acid substitutions at positions 234 and 235 (EU numbering) and/or 329 (EU numbering) of the IgG heavy chains.
- an antibody according to the invention which comprises an Fc domain with the amino acid substitutions L234A, L235A and P329G ("P329G LALA", EU numbering) in the IgG heavy chains.
- the amino acid substitutions L234A and L235A refer to the so-called LALA mutation.
- the "P329G LALA" combination of amino acid substitutions almost completely abolishes Fey receptor binding of a human IgGl Fc domain and is described in International Patent
- Fc domains with reduced Fc receptor binding and/or effector function also include those with substitution of one or more of Fc domain residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
- Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
- the Fc domain is an IgG4 Fc domain.
- IgG4 antibodies exhibit reduced binding affinity to Fc receptors and reduced effector functions as compared to IgGl antibodies.
- the Fc domain is an IgG4 Fc domain comprising an amino acid substitution at position S228 (Kabat numbering), particularly the amino acid substitution S228P.
- the Fc domain is an IgG4 Fc domain
- IgG4 Fc domain mutants comprising amino acid substitutions L235E and S228P and P329G (EU numbering).
- IgG4 Fc domain mutants and their Fey receptor binding properties are also described in WO 2012/130831.
- Mutant Fc domains can be prepared by amino acid deletion, substitution, insertion or modification using genetic or chemical methods well known in the art. Genetic methods may include site- specific mutagenesis of the encoding DNA sequence, PCR, gene synthesis, and the like. The correct nucleotide changes can be verified for example by sequencing. Binding to Fc receptors can be easily determined e.g. by ELISA, or by Surface Plasmon Resonance (SPR) using standard instrumentation such as a BIAcore instrument (GE
- Fc receptors such as may be obtained by recombinant expression.
- binding affinity of Fc domains or cell activating antibodies comprising an Fc domain for Fc receptors may be evaluated using cell lines known to express particular Fc receptors, such as human NK cells expressing Fcyllla receptor.
- Effector function of an Fc domain, or antibodies of the invention comprising an Fc domain can be measured by methods known in the art.
- a suitable assay for measuring ADCC is described herein.
- Other examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Patent No. 5,500,362; Hellstrom et al. Proc Natl Acad Sci USA 83, 7059-7063 (1986) and Hellstrom et al., Proc Natl Acad Sci USA 82, 1499-1502 (1985); U.S. Patent No. 5,821,337; Bruggemann et al., J Exp Med 166, 1351-1361 (1987).
- non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA); and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, WI)).
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g. in a animal model such as that disclosed in Clynes et al., Proc Natl Acad Sci USA 95, 652-656 (1998).
- binding of the Fc domain to a complement component specifically to
- Clq is reduced. Accordingly, in some embodiments wherein the Fc domain is engineered to have reduced effector function, said reduced effector function includes reduced CDC.
- Clq binding assays may be carried out to determine whether the bispecific antibodies of the invention is able to bind Clq and hence has CDC activity. See e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
- a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J Immunol Methods 202, 163 (1996); Cragg et al., Blood 101, 1045-1052 (2003); and Cragg and Glennie, Blood 103, 2738-2743 (2004)).
- the bispecific antigen binding molecules of the invention comprise different antigen- binding sites, fused to one or the other of the two subunits of the Fc domain, thus the two subunits of the Fc domain may be comprised in two non-identical polypeptide chains.
- the invention relates to the bispecific antigen binding molecule comprising (a) at least one antigen binding domain capable of specific binding to a tumor-associated antigen, (b) a first and a second polypeptide that are linked to each other by a disulfide bond, wherein the antigen binding molecule is characterized in that the first polypeptide comprises two ectodomains of 4-1BBL or two fragments thereof that are connected to each other by a peptide linker and in that the second polypeptide comprises only one ectodomain of said 4-1BBL or a fragment thereof, and (c) a Fc domain composed of a first and a second subunit capable of stable association, wherein the Fc domain comprises a modification promoting the association of the first and second subunit of the Fc domain.
- the site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain of the Fc domain.
- said modification is in the CH3 domain of the Fc domain.
- said modification is a so-called "knob-into-hole” modification, comprising a "knob” modification in one of the two subunits of the Fc domain and a "hole” modification in the other one of the two subunits of the Fc domain.
- the invention relates to an antigen binding molecule comprising (a) at least one antigen binding domain capable of specific binding to a tumor-asociated antigen, (b) a first and a second polypeptide that are linked to each other by a disulfide bond,
- the antigen binding molecule is characterized in that the first polypeptide comprises two ectodomains of 4-1BBL or two fragments thereof that are connected to each other by a peptide linker and in that the second polypeptide comprises only one ectodomain of 4-1BBL or a fragment thereof, and (c) a Fc domain composed of a first and a second subunit capable of stable association, wherein the first subunit of the Fc domain comprises knobs and the second subunit of the Fc domain comprises holes according to the knobs into holes method.
- the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (EU numbering) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S and Y407V (numbering according to Kabat EU index).
- knob-into-hole technology is described e.g. in US 5,731,168; US 7,695,936;
- the method involves introducing a protuberance ("knob") at the interface of a first polypeptide and a corresponding cavity ("hole") in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g.
- protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). Accordingly, in one aspect, in the CH3 domain of the first subunit of the Fc domain of the bispecific antigen binding molecules of the invention an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a
- protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and in the CH3 domain of the second subunit of the Fc domain an amino acid residue is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
- the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the CH3 domain of the second subunit of the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V).
- the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A).
- the serine residue at position 354 is replaced with a cysteine residue (S354C)
- the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C).
- the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W (EU numbering) and the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S and Y407V (numbering according to Kabat EU index).
- a modification promoting association of the first and the second subunit of the Fc domain comprises a modification mediating electrostatic steering effects, e.g. as described in PCT publication WO 2009/089004.
- this method involves replacement of one or more amino acid residues at the interface of the two Fc domain subunits by charged amino acid residues so that homodimer formation becomes
- the C-terminus of the heavy chain of the bispecific antibody as reported herein can be a complete C-terminus ending with the amino acid residues PGK.
- the C-terminus of the heavy chain can be a shortened C-terminus in which one or two of the C terminal amino acid residues have been removed.
- the C-terminus of the heavy chain is a shortened C-terminus ending PG.
- a bispecific antibody comprising a heavy chain including a C-terminal CH3 domain as specified herein comprises the C-terminal glycine-lysine dipeptide (G446 and K447, numbering according to Kabat EU index).
- a bispecific antibody comprising a heavy chain including a C-terminal CH3 domain as specified herein, comprises a C-terminal glycine residue (G446, numbering according to Kabat EU index).
- the invention relates to a 4-lBBL-containing antigen binding molecule, comprising (a) a Fab fragment capable of specific binding to a tumor-associated antigen, (b) a first and a second polypeptide that are linked to each other by a disulfide bond, wherein the antigen binding molecule is characterized in that the first polypeptide comprises two ectodomains of 4-1BBL or two fragments thereof that are connected to each other by a peptide linker and in that the second polypeptide comprises only one ectodomain of 4-1BBL or a fragment thereof, and (c) a Fc domain composed of a first and a second subunit capable of stable association, wherein in one of the Fab fragments either the variable domains VH and VL or the constant domains CHI and CL are exchanged.
- the bispecific antibodies are prepared according to the Crossmab technology.
- Multispecific antibodies with a domain replacement/exchange in one binding arm are described in detail in WO2009/080252 and Schaefer, W. et al, PNAS, 108 (2011) 11187-1191. They clearly reduce the byproducts caused by the mismatch of a light chain against a first antigen with the wrong heavy chain against the second antigen (compared to approaches without such domain exchange).
- the invention relates to a bispecific antigen binding molecule comprising (a) a first Fab fragment capable of specific binding to a tumor associated antigen, (b) a first and a second polypeptide that are linked to each other by a disulfide bond, wherein the antigen binding molecule is characterized in that the first polypeptide comprises two ectodomains of 4-1BBL or two fragments thereof that are connected to each other by a peptide linker and in that the second polypeptide comprises only one ectodomain of 4-1BBL or a fragment thereof, and wherein each of them is linked to a CHI or CL domain, and (c) a Fc domain composed of a first and a second subunit capable of stable association, wherein the constant domains CL and CHI adjacent to 4-lBBL are replaced by each other so that the CHI domain is part of the light chain and the CL domain is part of the heavy chain.
- the invention in another aspect, relates to a bispecific antigen binding molecule, comprising (a) two light chains and two heavy chains of an antibody comprising two Fab fragments capable of specific binding to 4- IBB and the Fc domain, and (b) two additional Fab fragments capable of specific binding to a tumor associated antigen, wherein said additional Fab fragments are each connected via a peptide linker to the C-terminus of the heavy chains of (a).
- the additional Fab fragments are Fab fragments, wherein the variable domains VL and VH are replaced by each other so that the VH domain is part of the light chain and the VL domain is part of the heavy chain.
- the bispecific antigen binding molecule comprising (a) a first Fab fragment capable of specific binding to a tumor associated antigen, (b) a first and a second polypeptide that are linked to each other by a disulfide bond, wherein the antigen binding molecule is characterized in that the first polypeptide comprises two ectodomains of 4-lBBL or two fragments thereof that are connected to each other by a peptide linker and in that the second polypeptide comprises only one ectodomain of 4-lBBL or a fragment thereof, and wherein each of them is linked to a CHI or CL domain, and (c) a Fc domain composed of a first and a second subunit capable of stable association, can contain different charged amino acid substitutions (so-called "charged residues").
- the invention relates to a bispecific antigen binding molecule, wherein in one of CL domains the amino acid at position 123 (EU numbering) has been replaced by arginine (R) and the amino acid at position 124 (EU numbering) has been substituted by lysine (K) and wherein in one of the CHI domains the amino acids at position 147 (EU numbering) and at position 213 (EU numbering) have been substituted by glutamic acid (E).
- the invention relates to a bispecific binding molecule comprising a Fab, wherein in the CL domain adjacent to 4-lBBL the amino acid at position 123 (EU numbering) has been replaced by arginine (R) and the amino acid at position 124 (EU numbering) has been substituted by lysine (K), and wherein in the CHI domain adjacent to 4- 1BBL the amino acids at position 147 (EU numbering) and at position 213 (EU numbering) have been substituted by glutamic acid (E).
- the invention further provides isolated polynucleotides encoding an antibody as described herein or a fragment thereof.
- the isolated polynucleotides encoding the antibodies of the invention may be expressed as a single polynucleotide that encodes the entire antigen binding molecule or as multiple (e.g., two or more) polynucleotides that are co-expressed.
- polynucleotides that are co-expressed may associate through, e.g., disulfide bonds or other means to form a functional antigen binding molecule.
- the light chain portion of an immunoglobulin may be encoded by a separate polynucleotide from the heavy chain portion of the immunoglobulin.
- the heavy chain polypeptides When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the immunoglobulin.
- the isolated polynucleotide encodes the entire antibody according to the invention as described herein. In other embodiments, the isolated polynucleotide encodes a polypeptide comprised in the antibody according to the invention as described herein.
- the polynucleotide or nucleic acid is DNA. In other words, the polynucleotide or nucleic acid is DNA. In other words, the polynucleotide or nucleic acid is DNA.
- a polynucleotide of the present invention is RNA, for example, in the form of messenger RNA (mRNA).
- RNA of the present invention may be single stranded or double stranded.
- Bispecific antibodies as used in the invention may be obtained, for example, by solid- state peptide synthesis (e.g. Merrifield solid phase synthesis) or recombinant production.
- solid- state peptide synthesis e.g. Merrifield solid phase synthesis
- polynucleotide encoding the antibody or polypeptide fragments thereof, e.g., as described above is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- Such polynucleotide may be readily isolated and sequenced using conventional procedures.
- a vector, preferably an expression vector, comprising one or more of the polynucleotides of the invention is provided.
- the expression vector can be part of a plasmid, virus, or may be a nucleic acid fragment.
- the expression vector includes an expression cassette into which the polynucleotide encoding the antibody or polypeptide fragments thereof (i.e. the coding region) is cloned in operable association with a promoter and/or other transcription or translation control elements.
- a "coding region" is a portion of nucleic acid which consists of codons translated into amino acids.
- a "stop codon" (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, if present, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, 5' and 3' untranslated regions, and the like, are not part of a coding region.
- Two or more coding regions can be present in a single polynucleotide construct, e.g. on a single vector, or in separate polynucleotide constructs, e.g. on separate (different) vectors.
- any vector may contain a single coding region, or may comprise two or more coding regions, e.g.
- a vector of the present invention may encode one or more polypeptides, which are post- or co-translationally separated into the final proteins via proteolytic cleavage.
- a vector, polynucleotide, or nucleic acid of the invention may encode heterologous coding regions, either fused or unfused to a
- heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
- An operable association is when a coding region for a gene product, e.g. a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s).
- Two DNA fragments are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
- a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid.
- the promoter may be a cell- specific promoter that directs substantial transcription of the DNA only in predetermined cells.
- transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell- specific transcription.
- Suitable promoters and other transcription control regions are disclosed herein.
- a variety of transcription control regions are known to those skilled in the art. These include, without limitation, transcription control regions, which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (e.g. the immediate early promoter, in conjunction with intron-A), simian virus 40 (e.g. the early promoter), and retroviruses (such as, e.g. Rous sarcoma virus).
- transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit a-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue- specific promoters and enhancers as well as inducible promoters (e.g. promoters inducible tetracyclins). Similarly, a variety of translation control elements are known to those of ordinary skill in the art. These include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from viral systems (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence). The expression cassette may also include other features such as an origin of replication, and/or chromosome integration elements such as retroviral long terminal repeats (LTRs), or adeno-associated viral (AAV) inverted terminal repeats (ITRs).
- LTRs retroviral long terminal repeats
- AAV adeno
- Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention.
- DNA encoding a signal sequence may be placed upstream of the nucleic acid an antibody of the invention or polypeptide fragments thereof.
- polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N- terminus of the polypeptide, which is cleaved from the translated polypeptide to produce a secreted or "mature" form of the polypeptide.
- the native signal peptide e.g. an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it.
- a heterologous mammalian signal peptide, or a functional derivative thereof may be used.
- the wild-type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TPA) or mouse ⁇ -glucuronidase.
- DNA encoding a short protein sequence that could be used to facilitate later purification (e.g. a histidine tag) or assist in labeling the fusion protein may be included within or at the ends of the polynucleotide encoding an antibody of the invention or polypeptide fragments thereof.
- a host cell comprising one or more polynucleotides of the invention.
- a host cell comprising one or more vectors of the invention.
- the polynucleotides and vectors may incorporate any of the features, singly or in combination, described herein in relation to polynucleotides and vectors, respectively.
- a host cell comprises (e.g. has been transformed or transfected with) a vector comprising a polynucleotide that encodes (part of) an antibody of the invention of the invention.
- the term "host cell” refers to any kind of cellular system which can be engineered to generate the fusion proteins of the invention or fragments thereof.
- Host cells suitable for replicating and for supporting expression of antigen binding molecules are well known in the art. Such cells may be transfected or transduced as appropriate with the particular expression vector and large quantities of vector containing cells can be grown for seeding large scale fermenters to obtain sufficient quantities of the antigen binding molecule for clinical applications.
- Suitable host cells include prokaryotic microorganisms, such as E. coli, or various eukaryotic cells, such as Chinese hamster ovary cells (CHO), insect cells, or the like.
- polypeptides may be produced in bacteria in particular when glycosylation is not needed. After expression, the polypeptide may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized", resulting in the production of a polypeptide with a partially or fully human glycosylation pattern. See Gerngross, Nat Biotech 22, 1409-1414 (2004), and Li et al., Nat Biotech 24, 210-215 (2006).
- Suitable host cells for the expression of (glycosylated) polypeptides are also derived from multicellular organisms (invertebrates and vertebrates).
- invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts. See e.g. US Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIB ODIESTM technology for producing antibodies in transgenic plants). Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293T cells as described, e.g., in Graham et al., J Gen Virol 36, 59 (1977)), baby hamster kidney cells (BHK), mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol Reprod 23, 243-251 (1980)), monkey kidney cells (CV1), African green monkey kidney cells (VERO-76), human cervical carcinoma cells (HELA), canine kidney cells (MDCK), buffalo rat liver cells (BRL 3A), human lung cells (W138), human liver cells (Hep G2), mouse mammary tumor cells (MMT 060562), TRI cells (as described, e.g., in Mather et al., Annals N.Y.
- MRC 5 cells MRC 5 cells
- FS4 cells Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including dhfr- CHO cells (Urlaub et al., Proc Natl Acad Sci USA 77, 4216 (1980)); and myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
- CHO Chinese hamster ovary
- dhfr- CHO cells Urlaub et al., Proc Natl Acad Sci USA 77, 4216 (1980)
- myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
- Host cells include cultured cells, e.g., mammalian cultured cells, yeast cells, insect cells, bacterial cells and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
- the host cell is a eukaryotic cell, preferably a mammalian cell, such as a Chinese Hamster Ovary (CHO) cell, a human embryonic kidney (HEK) cell or a lymphoid cell (e.g., Y0, NSO, Sp20 cell). Standard technologies are known in the art to express foreign genes in these systems.
- Cells expressing a polypeptide comprising either the heavy or the light chain of an immunoglobulin may be engineered so as to also express the other of the immunoglobulin chains such that the expressed product is an immunoglobulin that has both a heavy and a light chain.
- a method of producing an antibody of the invention or polypeptide fragments thereof comprises culturing a host cell comprising polynucleotides encoding the antibody of the invention or polypeptide fragments thereof, as provided herein, under conditions suitable for expression of the antibody of the invention or polypeptide fragments thereof, and recovering the antibody of the invention or polypeptide fragments thereof from the host cell (or host cell culture medium).
- the moieties capable of specific binding to a target cell antigen (e.g. Fab fragments) forming part of the antigen binding molecule comprise at least an immunoglobulin variable region capable of binding to an antigen.
- Variable regions can form part of and be derived from naturally or non-naturally occurring antibodies and fragments thereof.
- Methods to produce polyclonal antibodies and monoclonal antibodies are well known in the art (see e.g. Harlow and Lane, "Antibodies, a laboratory manual", Cold Spring Harbor Laboratory, 1988).
- Non-naturally occurring antibodies can be constructed using solid phase- peptide synthesis, can be produced recombinantly (e.g. as described in U.S. patent No.
- Non-limiting immunoglobulins useful in the present invention can be of murine, primate, or human origin. If the fusion protein is intended for human use, a chimeric form of immunoglobulin may be used wherein the constant regions of the immunoglobulin are from a human.
- a humanized or fully human form of the immunoglobulin can also be prepared in accordance with methods well known in the art (see e. g. U.S. Patent No. 5,565,332 to Winter). Humanization may be achieved by various methods including, but not limited to (a) grafting the non-human (e.g., donor antibody) CDRs onto human (e.g.
- Human antibodies and human variable regions can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr Opin Pharmacol 5, 368-74 (2001) and Lonberg, Curr Opin Immunol 20, 450-459 (2008). Human variable regions can form part of and be derived from human monoclonal antibodies made by the hybridoma method (see e.g. Monoclonal Antibody
- Human antibodies and human variable regions may also be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge (see e.g. Lonberg, Nat Biotech 23, 1117-1125 (2005). Human antibodies and human variable regions may also be generated by isolating Fv clone variable region sequences selected from human- derived phage display libraries (see e.g., Hoogenboom et al.
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- the antibodies are engineered to have enhanced binding affinity according to, for example, the methods disclosed in PCT publication WO 2012/020006 (see Examples relating to affinity maturation) or U.S. Pat. Appl. Publ. No. 2004/0132066.
- the ability of the antigen binding molecules of the invention to bind to a specific antigenic determinant can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g. surface plasmon resonance technique (Liljeblad, et al., Glyco J 17, 323-329 (2000)), and traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002)).
- ELISA enzyme-linked immunosorbent assay
- Competition assays may be used to identify an antigen binding molecule that competes with a reference antibody for binding to a particular antigen.
- a competing antigen binding molecule binds to the same epitope (e.g. a linear or a conformational epitope) that is bound by the reference antigen binding molecule.
- epitope e.g. a linear or a conformational epitope
- Detailed exemplary methods for mapping an epitope to which an antigen binding molecule binds are provided in Morris (1996) "Epitope Mapping Protocols", in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
- immobilized antigen is incubated in a solution comprising a first labeled antigen binding molecule that binds to the antigen and a second unlabeled antigen binding molecule that is being tested for its ability to compete with the first antigen binding molecule for binding to the antigen.
- the second antigen binding molecule may be present in a hybridoma supernatant.
- immobilized antigen is incubated in a solution comprising the first labeled antigen binding molecule but not the second unlabeled antigen binding molecule. After incubation under conditions permissive for binding of the first antibody to the antigen, excess unbound antibody is removed, and the amount of label associated with immobilized antigen is measured.
- Antibodies of the invention prepared as described herein may be purified by art-known techniques such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like.
- the actual conditions used to purify a particular protein will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art.
- affinity chromatography purification an antibody, ligand, receptor or antigen can be used to which the antigen binding molecule binds.
- affinity chromatography an antibody, ligand, receptor or antigen can be used to which the antigen binding molecule binds.
- affinity chromatography an antibody, ligand, receptor or antigen can be used to which the antigen binding molecule binds.
- affinity chromatography an antibody, ligand, receptor or antigen can be used to which the antigen binding molecule binds.
- affinity chromatography an antibody, ligand, receptor
- chromatography purification of fusion proteins of the invention a matrix with protein A or protein G may be used. Sequential Protein A or G affinity chromatography and size exclusion chromatography can be used to isolate an antigen binding molecule essentially as described in the Examples. The purity of the antigen binding molecule or fragments thereof can be determined by any of a variety of well-known analytical methods including gel
- antigen binding molecules provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art. 1. Affinity assays
- the affinity of the bispecific antigen binding molecules provided herein for the corresponding receptor can be determined in accordance with the methods set forth in the Examples by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression.
- the affinity of the bispecific antigen binding molecule for the target cell antigen can also be determined by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression.
- SPR surface plasmon resonance
- GE Healthcare BIAcore instrument
- receptors or target proteins such as may be obtained by recombinant expression.
- FAP-4-1BBL antigen binding molecules the methods have been described in more detail in International Patent Appl. Publ. No. WO 2016/075278 Al.
- K D is measured by surface plasmon resonance using a BIACORE® T100 machine (GE Healthcare) at
- the FAP-4-1BBL antigen binding molecules as reported herein are tested for its antigen binding activity as described in more detail in International Patent Appl. Publ. No. WO 2016/075278 Al.
- assays are provided for identifying the biological activity of FAP-4-1BBL antigen binding molecules.
- an antibody as reported herein is tested for such biological activity in the in vitro co-culture assays with human immune effector cells as described in
- Example 8 in the in vitro co-culture assays with MKN45 cells expressing CEA and PDL-1 as described in Example 9 or in the in vitro PBMC activation assay as described in Example 10.
- the invention provides pharmaceutical compositions comprising the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and 4- IBB agonists provided herein, e.g., for use in any of the below therapeutic methods.
- a pharmaceutical composition comprises an antibody provided herein and at least one pharmaceutically acceptable excipient.
- a pharmaceutical composition comprises an antibody provided herein and at least one additional therapeutic agent, e.g., as described below.
- compositions comprising the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, and 4- IBB agonists provided herein
- the invention provides a T-cell activating anti-CD3 bispecific antibody specific for a tumor-associated antigen, in particular an anti-CEA/anti-CD3 bispecific antibody, for use in a method for treating or delaying progression of cancer, wherein the T-cell activating anti-CD3 bispecific antibody specific for a tumor- associated antigen is used in combination with a 4- IBB (CD 137) agonist and in combination with an agent blocking PD-Ll/PD-1 interaction.
- the agent blocking PD-Ll/PD-1 interaction is an anti-PD-Ll antibody or an anti-PDl antibody.
- the agent blocking PD-Ll/PD-1 interaction is selected from the group consisting of atezolizumab, durvalumab, pembrolizumab and nivolumab.
- the agent blocking PD- Ll/PD-1 interaction is atezolizumab.
- compositions of the present invention comprise a therapeutically effective amount of one or more antibodies dissolved or dispersed in a pharmaceutically acceptable excipient.
- pharmaceutically acceptable refers to molecular entities and compositions that are generally non-toxic to recipients at the dosages and concentrations employed, i.e. do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate.
- the preparation of a pharmaceutical composition that contains at least one antibody and optionally an additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference.
- compositions are lyophilized formulations or aqueous solutions.
- pharmaceutically acceptable excipient includes any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. antibacterial agents, antifungal agents), isotonic agents, salts, stabilizers and combinations thereof, as would be known to one of ordinary skill in the art.
- compositions include those designed for administration by injection, e.g. subcutaneous, intradermal, intralesional, intravenous, intraarterial intramuscular, intrathecal or intraperitoneal injection.
- the antigen binding molecules of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer.
- the solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the fusion proteins may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- Sterile injectable solutions are prepared by incorporating the fusion proteins of the invention in the required amount in the appropriate solvent with various of the other ingredients enumerated below, as required. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, suspensions or emulsion, the preferred methods of preparation are vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered liquid medium thereof.
- the liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose.
- the composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein.
- Suitable pharmaceutically acceptable excipients include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or
- immunoglobulins include hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
- PEG polyethylene glycol
- Aqueous injection suspensions may contain compounds which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, dextran, or the like.
- the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
- suspensions of the active compounds may be prepared as appropriate oily injection suspensions.
- Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl cleats or triglycerides, or liposomes.
- Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
- microcapsules respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in
- sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g. films, or microcapsules. In particular embodiments, prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
- Exemplary pharmaceutically acceptable excipients herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20
- insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20
- a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
- additional glycosaminoglycanases such as chondroitinases.
- Aqueous antibody formulations include those described in US Patent No. 6,171,586 and WO2006/044908, the latter formulations including a histidine-acetate buffer.
- the antigen binding molecules may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
- the fusion proteins may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- Pharmaceutical compositions comprising the antigen binding molecules of the invention may be manufactured by means of conventional mixing, dissolving, emulsifying,
- compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the proteins into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
- the antibodies of the invention may be formulated into a composition in a free acid or base, neutral or salt form.
- Pharmaceutically acceptable salts are salts that substantially retain the biological activity of the free acid or base. These include the acid addition salts, e.g. those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine. Pharmaceutical salts tend to be more soluble in aqueous and other protic solvents than are the corresponding free base forms.
- composition herein may also contain more than one active ingredients as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
- the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
- Both the T-cell activating anti-CD3 bispecific antibody in particular the anti-CEA/anti- CD3 bispecific antibody and the 4- IBB agonist (both called substance herein) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- the methods of the present invention are particularly useful, however, in relation to therapeutic agents administered by parenteral, particularly intravenous, infusion.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- the therapeutic agent is administered parenterally, particularly intravenously.
- the therapeutic agent is administerd by intravenous infusion. Both the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti- CD3 bispecific antibody, and the 4- IBB agonist would be formulated, dosed, and
- T-cell activating anti-CD3 bispecific antibody in particular the anti-CEA/anti-CD3 bispecific antibody, and the 4- IBB agonist need not be, but are optionally formulated with one or more agents currently used to prevent or treat the disorder in question.
- the effective amount of such other agents depends on the amount of therapeutic agent present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with
- the appropriate dosage of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody and the 4- IBB agonist (when used in their combination or with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of 4- IBB agent, the severity and course of the disease, whether both agents are administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the therapeutic agent, and the discretion of the attending physician. Each substance is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 ⁇ g/kg to 15 mg/kg (e.g.
- 0.1 mg/kg - 10 mg/kg) of the substance can be an initial candidate dosage for administration to the subject, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of each substance would be in the range from about 0.05 mg/kg to about 10 mg/kg.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the subject.
- Such doses may be administered intermittently, e.g.
- An initial higher loading dose, followed by one or more lower doses, or an initial lower dose, followed by one or more higher doses may be administered.
- An exemplary dosing regimen comprises administering an initial dose of about 10 mg, followed by a bi-weekly dose of about 20 mg of the therapeutic agent.
- other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- the administration of both the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody and the 4- IBB agonist is a single administration.
- the administration of the therapeutic agent is two or more administrations.
- the substances are administered every week, every two weeks, or every three weeks, particularly every two weeks.
- the substance is administered in a therapeutically effective amount.
- the substance is administered at a dose of about 50 ⁇ g/kg, about 100 ⁇ g/kg, about 200 ⁇ g/kg, about 300 ⁇ g/kg, about 400 ⁇ g/kg, about 500 ⁇ g/kg, about 600 ⁇ g/kg, about 700 ⁇ g/kg, about 800 ⁇ g/kg, about 900 ⁇ g/kg or about 1000 ⁇ g/kg.
- the T-cell activating anti-CD3 bispecific antibody in particular the anti-CEA/anti-CD3 bispecific antibody is administered at a dose which is higher than the dose of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, in a corresponding treatment regimen without the administration of the 4- IBB agonist.
- the administration of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody comprises an initial administration of a first dose of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, and one or more subsequent administrations of a second dose of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, wherein the second dose is higher than the first dose.
- the administration of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody comprises an initial administration of a first dose of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, and one or more subsequent administrations of a second dose of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, wherein the first dose is not lower than the second dose.
- the administration of the T-cell activating anti-CD3 bispecific antibody , in particular the anti-CEA/anti-CD3 bispecific antibody in the treatment regimen according to the invention is the first administration of said T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody to the subject (at least within the same course of treatment).
- no administration of the 4- IBB agonist is made to the subject prior to the administration of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody.
- the 4- IBB agonist is administered prior to the administration of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody.
- the T-cell activating anti-CD3 bispecific antibody in particular the anti-CEA/anti-CD3 bispecific antibody is for use in combination with a 4- IBB agonist, wherein a pretreatment with an Type II anti-CD20 antibody, preferably obinutuzumab, is performed prior to the combination treatment, wherein the period of time between the pretreatment and the combination treatment is sufficient for the reduction of B-cells in the individual in response to the Type II anti-CD20 antibody, preferably obinutuzumab.
- Activation of T cells can lead to severe cytokine release syndrome (CRS).
- CRS severe cytokine release syndrome
- TeGenero Stemcell activating therapeutic agent
- all 6 healthy volunteers experienced near fatal, severe cytokine release syndrome (CRS) rapidly post- infusion of an inappropriately-dosed, T-cell stimulating super- agonist anti-CD28 monoclonal antibody.
- the cytokine release associated with administration of a T-cell activating therapeutic agent, such as the anti-CEA/anti-CD3 bispecific antibody, to a subject can be significantly reduced by pre-treatment of said subject with a Type II anti-CD20 antibody, such as obinutuzumab.
- GAZYVA® pre-treatment should aid in the rapid depletion of B cells, both in the peripheral blood and in secondary lymphoid organs, such that the risk of highly relevant adverse events (AEs) from strong systemic T cell activation by T-cell activating therapeutic agents (e.g. CRS) is reduced, while supporting exposure levels of T-cell activating therapeutic agents that are high enough from the start of dosing to mediate tumour cell elimination.
- AEs highly relevant adverse events
- CRS T-cell activating therapeutic agents
- T-cell activating anti-CD3 bispecific antibodies such as the anti-CEA/anti-CD3 bispecific antibody
- Gpt should also help prevent the formation of anti-drug antibodies (ADAs) to these unique molecules.
- the combination of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody and the 4- IBB agonist can be used in combination with further agents in a therapy.
- at least one additional therapeutic agent may be co-administered.
- an additional therapeutic agent is an immunotherapeutic agent.
- the combination of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, and the 4- IBB agonist can be used in combination with a PD-1 axis binding antagonist.
- the PD-1 axis binding antagonist is selected from the group consisting of a PD-1 binding antagonist, a PD-L1 binding antagonist and a PD-L2 binding antagonist.
- PD-1 axis binding antagonist is a PD-1 binding antagonist.
- the PD-1 axis binding antagonist is selected MDX 1106 (nivolumab), MK-3475 (pembrolizumab), CT-011 (pidilizumab), MEDI- 0680 (AMP-514), PDROOl, REGN2810, and BGB-108.
- the PD-1 axis binding antagonist is a PD-L1 binding antagonist.
- the PD-1 axis binding antagonist is selected from MPDL3280A (atezolizumab), YW243.55.S70, MDX-1105, MEDI4736 (durvalumab), and MSB0010718C (avelumab). More particularly, the
- T-cell activating anti-CD3 bispecific antibody in particular the anti- CEA/anti-CD3 bispecific antibody
- 4- IBB agonist can be used in combination with MPDL3280A (atezolizumab).
- the period of time between the administration of the PD-1 axis binding antagonist and the administration of the combination therapy comprising T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody, and the 4- IBB agonist and the doses are chosen such as to effectively shrink the tumor in the subject prior to administration of the combination therapy.
- combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the therapeutic agent can occur prior to, simultaneously, and/or following, administration of an additional therapeutic agent or agents.
- administration of the therapeutic agent and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
- Administration of the 4-1BB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen and the agent blocking PD-Ll/PD-1 interaction
- Both the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen and the agent blocking PD-Ll/PD-1 interaction can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- the methods of the present invention are particularly useful, however, in relation to therapeutic agents administered by parenteral, particularly intravenous, infusion.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- the therapeutic agent is administered parenterally, particularly intravenously.
- the therapeutic agent is administerd by intravenous infusion.
- Both the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen and the agent blocking PD-Ll/PD-1 interaction would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. Both the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen and the agent blocking PD-Ll/PD-1 interaction need not be, but are optionally formulated with one or more agents currently used to prevent or treat the disorder in question.
- the effective amount of such other agents depends on the amount of therapeutic agent present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
- the appropriate dosage of the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen and the agent blocking PD-Ll/PD-1 interaction (when used in their combination or with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of 4- IBB agonist, the severity and course of the disease, whether both agents are administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the therapeutic agent, and the discretion of the attending physician. Each substance is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 ⁇ g/kg to 15 mg/kg (e.g.
- 0.1 mg/kg - 10 mg/kg) of the substance can be an initial candidate dosage for administration to the subject, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of each substance would be in the range from about 0.05 mg/kg to about 10 mg/kg.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the subject.
- Such doses may be administered intermittently, e.g.
- An initial higher loading dose, followed by one or more lower doses, or an initial lower dose, followed by one or more higher doses may be administered.
- An exemplary dosing regimen comprises administering an initial dose of about 10 mg, followed by a bi-weekly dose of about 20 mg of the therapeutic agent.
- other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- the administration of both the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor-associated antigen and the agent blocking PD-Ll/PD-1 interaction is a single administration.
- the administration of the therapeutic agent is two or more administrations.
- the substances are administered every week, every two weeks, or every three weeks, particularly every two weeks.
- the substance is administered in a therapeutically effective amount.
- the substance is administered at a dose of about 50 ⁇ g/kg, about 100 ⁇ g/kg, about 200 ⁇ g/kg, about 300 ⁇ g/kg, about 400 ⁇ g/kg, about 500 ⁇ g/kg, about 600 ⁇ g/kg, about 700 ⁇ g/kg, about 800 ⁇ g/kg, about 900 ⁇ g/kg or about 1000 ⁇ g/kg.
- the agent blocking PD-Ll/PD-1 interaction is administered at a dose which is higher than the dose of the agent blocking PD-Ll/PD-1 interaction, in a corresponding treatment regimen without the administration of the 4- IBB agonist.
- the agent blocking PD-Ll/PD-1 interaction is administered at a dose which is lower than the dose of the agent blocking PD-Ll/PD-1 interaction, in a corresponding treatment regimen without the administration of the 4- IBB agonist.
- the administration of the agent blocking PD-Ll/PD-1 interaction comprises an initial administration of a first dose of the agent blocking PD-Ll/PD-1 interaction and one or more subsequent administrations of a second dose of the agent blocking PD-Ll/PD-1 interaction wherein the second dose is higher than the first dose.
- the administration of the agent blocking PD-Ll/PD-1 interaction comprises an initial administration of a first dose of the agent blocking PD-Ll/PD-1 interaction and one or more subsequent administrations of a second dose of the the agent blocking PD-Ll/PD-1 interaction wherein the first dose is not lower than the second dose.
- the administration of the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen in the treatment regimen according to the invention is the first administration of said 4- IBB agonist
- the 4-1BB agonist is a tumor-associated antigen to the subject (at least within the same course of treatment).
- no administration of the 4- IBB agonist is made to the subject prior to the administration of the agent blocking PD-Ll/PD-1 interaction.
- the 4-1BB agonist is
- the 4- IBB agonist comprising at least one antigen binding domain capable of specific binding to a tumor- associated antigen is for use in combination with the agent blocking PD-Ll/PD-1 interaction, wherein a pretreatment with an Type II anti-CD20 antibody, preferably obinutuzumab, is performed prior to the combination treatment, wherein the period of time between the pretreatment and the combination treatment is sufficient for the reduction of B-cells in the individual in response to the Type II anti-CD20 antibody, preferably obinutuzumab.
- the combination of the T-cell activating anti-CD3 bispecific antibody, in particular the anti-CEA/anti-CD3 bispecific antibody and the 4- IBB agonist can be used in combination with further agents in a therapy.
- at least one additional therapeutic agent may be co-administered.
- an additional therapeutic agent is an immunotherapeutic agent.
- Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the therapeutic agent can occur prior to, simultaneously, and/or following, administration of an additional therapeutic agent or agents.
- administration of the therapeutic agent and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
- Bispecific antibodies recognizing two cell surface proteins on different cell populations hold the promise to redirect cytotoxic immune cells for destruction of pathogenic target cells.
- a method for treating or delaying progression of cancer in a subject comprising administering to the subject an effective amount of a T-cell activating anti- CD3 bispecific antibody, in particular a anti-CEA/anti-CD3 bispecific antibody, and a 4- IBB agonist.
- the method further comprises administering to the subject an effective amount of at least one additional therapeutic agent.
- a method for tumor shrinkage comprising administering to the subject an effective amount of a T-cell activating anti-CD3 bispecific antibody, in particular an anti-CEA/anti- CD3 bispecific antibody, and a 4- IBB agonist.
- An "individual” or a “subject” according to any of the above aspects is preferably a human.
- a composition for use in cancer immunotherapy comprising a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti- CD3 bispecific antibody, and a 4- IBB agonist.
- a composition comprising a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti- CD3 bispecific antibody, and a 4- IBB agonist for use in a method of cancer immunotherapy is provided.
- a composition comprising a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti-CD3 bispecific antibody, and a 4- IBB agonist in the manufacture or preparation of a medicament.
- the medicament is for treatment of solid tumors.
- the medicament is for use in a method of tumor shrinkage comprising administering to an individual having a solid tumor an effective amount of the medicament.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent.
- the medicament is for treating solid tumors.
- the individual has CEA positive cancer.
- CEA positive cancer is colon cancer, lung cancer, ovarian cancer, gastric cancer, bladder cancer, pancreatic cancer, endometrial cancer, breast cancer, kidney cancer, esophageal cancer, or prostate cancer.
- the breast cancer is a breast carcinoma or a breast adenocarcinoma.
- the breast carcinoma is an invasive ductal carcinoma.
- the lung cancer is a lung adenocarcinoma.
- the colon cancer is a colorectal adenocarcinoma.
- An "individual" according to any of the above embodiments may be a human.
- combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody as reported herein can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent or agents.
- administration of a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti-CD3 bispecific antibody, and a 4- IBB agonist and optionally the administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
- Both the T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti- CD3 bispecific antibody, and the 4- IBB agonist as reported herein (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
- Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- Both the T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti- CD3 bispecific antibody, and the 4- IBB agonist as reported herein would be formulated, dosed, and administered in a fashion consistent with good medical practice.
- Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the antibodies need not be, but are optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibodies present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
- kits containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above.
- the kit comprises at least one container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper that is pierceable by a hypodermic injection needle).
- At least two active agents in the kit are a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti-CD3 bispecific antibody, and an 4- IBB agonist of the invention.
- kits for treating or delaying progression of cancer in a subject comprising a package comprising (A) a first composition comprising as active ingredient a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti-CD3 bispecific antibody, and a pharmaceutically acceptable carrier; (B) a second composition comprising as active ingredient a 4- IBB agonist and a pharmaceutically acceptable carrier, and (C) instructions for using the compositions in a combination therapy.
- the label or package insert indicates how the composition is used for treating the condition of choice and provides the instructions for using the compositions in a combination therapy.
- the kit may comprise (a) a first container with a composition contained therein, wherein the composition comprises a T-cell activating anti-CD3 bispecific antibody, in particular a anti-CEA/anti-CD3 bispecific antibody, of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises an 4- IBB agonist of the invention.
- the kit may comprise one or more further containers comprising further active ingredients that can be used in combination.
- the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
- the kit may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- CEA-HCDR2 (CEACAM5) RIDPANGNSKYVPKFQG
- CEA-HCDR3 (CEACAM5) FGYYVSDYAMAY
- CEA-LCDR1 (CEACAM5) RAGESVDIFGVGFLH
- CEA-LCDR2 CEACAM5
- CEA VL CEACAM5
- CD3 VH-CL (CEACAM5 EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYA TCB) MNWVRQAPGKGLEWVSRIRSKYNNYATYYA
- CEA cHiAiA 98 99 humanized QVQLVQSGAEVKKPGASVKVSCKASGYTFTEF CD3 CH2527 (Crossfab VH- GMNWVROAPGOGLEWMGWINTKTGEATYVE Ck)— Fc(knob) P329GLALA EFKGRVTFTTDTSTSTAYMELRSLRSDDTAVY (CEA TCB) YC ARWDFA Y Y VE AMD YWGOGTT VT VS S AST
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
Claims
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202311602252.7A CN117752798A (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1BB (CD137) agonists |
| IL267284A IL267284B2 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1bb (cd137) agonists |
| CA3039430A CA3039430A1 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1bb (cd137) agonists |
| CN201780078076.8A CN110087682B (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1BB (CD137) agonists |
| MX2019006955A MX2019006955A (en) | 2016-12-19 | 2017-12-18 | COMBINATION THERAPY WITH TARGETED 4-1BB AGONISTS (CD137). |
| AU2017380981A AU2017380981B2 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1BB (CD137) agonists |
| JP2019532673A JP7125400B2 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1BB (CD137) agonists |
| KR1020197017457A KR102669762B1 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1BB (CD137) agonists |
| EP17832770.6A EP3554542A1 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1bb (cd137) agonists |
| MX2024011810A MX2024011810A (en) | 2016-12-19 | 2019-06-13 | Combination therapy with targeted 4-1bb (cd137) agonists |
| US16/825,773 US20200325225A1 (en) | 2016-12-19 | 2020-03-20 | Combination therapy with targeted 4-1bb (cd137) agonists |
| JP2022128613A JP7459186B2 (en) | 2016-12-19 | 2022-08-12 | Combination therapy with targeted 4-1BB (CD137) agonists |
| US18/166,783 US12565530B2 (en) | 2016-12-19 | 2023-02-09 | Combination therapy with targeted 4-1BB (CD137) agonists/anti-FAP binding domain and anti-CEA/anti-CD3 bispecific antibody |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16205190 | 2016-12-19 | ||
| EP16205190.8 | 2016-12-19 | ||
| EP17158771.0 | 2017-03-01 | ||
| EP17158771 | 2017-03-01 | ||
| EP17160857 | 2017-03-14 | ||
| EP17160857.3 | 2017-03-14 | ||
| EP17192936 | 2017-09-25 | ||
| EP17192936.7 | 2017-09-25 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US201916446484A Continuation | 2016-12-19 | 2019-06-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018114754A1 true WO2018114754A1 (en) | 2018-06-28 |
Family
ID=61017891
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/083235 Ceased WO2018114754A1 (en) | 2016-12-19 | 2017-12-18 | Combination therapy with targeted 4-1bb (cd137) agonists |
Country Status (11)
| Country | Link |
|---|---|
| US (2) | US20200325225A1 (en) |
| EP (1) | EP3554542A1 (en) |
| JP (2) | JP7125400B2 (en) |
| KR (1) | KR102669762B1 (en) |
| CN (2) | CN117752798A (en) |
| AU (1) | AU2017380981B2 (en) |
| CA (1) | CA3039430A1 (en) |
| IL (1) | IL267284B2 (en) |
| MX (2) | MX2019006955A (en) |
| TW (1) | TWI829628B (en) |
| WO (1) | WO2018114754A1 (en) |
Cited By (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019175125A1 (en) * | 2018-03-13 | 2019-09-19 | F. Hoffmann-La Roche Ag | Combination therapy with targeted 4-1bb (cd137) agonists |
| WO2019197600A1 (en) * | 2018-04-13 | 2019-10-17 | F. Hoffmann-La Roche Ag | Her2-targeting antigen binding molecules comprising 4-1bbl |
| WO2020127628A1 (en) * | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted superagonistic cd28 antigen binding molecules |
| WO2020127618A1 (en) * | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted agonistic cd28 antigen binding molecules |
| WO2020257681A1 (en) * | 2019-06-21 | 2020-12-24 | Regeneron Pharmaceuticals, Inc. | Use of bispecific antigen-binding molecules that bind psma and cd3 in combination with 4-1bb co-stimulation |
| WO2020260329A1 (en) * | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Fusion of an antibody binding cea and 4-1bbl |
| WO2021006199A1 (en) | 2019-07-05 | 2021-01-14 | 小野薬品工業株式会社 | Treatment of hematologic cancer with pd-1/cd3 dual specificity protein |
| WO2021027850A1 (en) * | 2019-08-12 | 2021-02-18 | I-Mab Biopharma Co., Ltd. | Anti-claudin 18.2 and anti-4-1bb bispecific antibodies and uses thereof |
| WO2021121215A1 (en) * | 2019-12-20 | 2021-06-24 | Shandong Boan Biotechnology Co., Ltd. | Optimized anti-cd3 arm in the generation of t-cell bispecific antibodies for immunotherapy |
| JP2021529547A (en) * | 2018-07-11 | 2021-11-04 | カール メディカル リミテッド | SIRPα-4-1BBL variant fusion protein and how to use it |
| JP2022511311A (en) * | 2019-04-26 | 2022-01-31 | アイ-エムエービー バイオファーマ ユーエス リミテッド | Human PD-L1 antibody |
| US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
| EP3988568A1 (en) | 2020-10-21 | 2022-04-27 | Numab Therapeutics AG | Combination treatment |
| JP2022537269A (en) * | 2019-06-21 | 2022-08-25 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of Bispecific Antigen Binding Molecules that Bind MUC16 and CD3 in Combination with 4-1BB Costimulation |
| WO2022189377A1 (en) * | 2021-03-09 | 2022-09-15 | F. Hoffmann-La Roche Ag | Combination therapy of pd-1-targeted il-2 variant immunoconjugates and fap/4-1bb binding molecules |
| WO2023110788A1 (en) * | 2021-12-14 | 2023-06-22 | F. Hoffmann-La Roche Ag | Treatment of cancer using a hla-a2/mage-a4 x cd3 bispecific antibody and a 4-1bb (cd137) agonist |
| US11718672B2 (en) | 2020-03-31 | 2023-08-08 | Chugai Seiyaki Kabushiki Kaisha | CD137- and DLL3-targeting multispecific antigen-binding molecules |
| WO2023225098A1 (en) * | 2022-05-18 | 2023-11-23 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen binding molecules that bind cd38 and 4-1bb, and uses thereof |
| EP4063388A4 (en) * | 2019-11-19 | 2024-01-17 | Sound Biopharmaceuticals Co. Ltd. | Humanized 4-1bb monoclonal antibody and pharmaceutical composition thereof |
| US11897937B2 (en) | 2017-01-05 | 2024-02-13 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| US11952422B2 (en) | 2017-12-05 | 2024-04-09 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region binding CD3 and CD137 |
| RU2822092C2 (en) * | 2019-06-21 | 2024-07-01 | Регенерон Фармасьютикалз, Инк. | Use of bispecific antigen-binding molecules that bind psma and cd3, in combination with costimulation 4-1bb |
| WO2024188966A1 (en) * | 2023-03-13 | 2024-09-19 | F. Hoffmann-La Roche Ag | Treatment of cancer using an anti-hla-g/anti-cd3 bispecific antibody and a 4‑1bb (cd137) agonist |
| WO2024208777A1 (en) * | 2023-04-03 | 2024-10-10 | F. Hoffmann-La Roche Ag | All-in-one agonistic antibodies |
| WO2024208776A1 (en) * | 2023-04-03 | 2024-10-10 | F. Hoffmann-La Roche Ag | Agonistic split antibodies |
| US12286466B2 (en) | 2018-07-11 | 2025-04-29 | Kahr Medical Ltd. | PD1-4-1BBL variant fusion protein and methods of use thereof |
| US12435137B2 (en) | 2018-08-03 | 2025-10-07 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule containing two antigen-binding domains that are linked to each other |
| US12492252B2 (en) | 2020-07-01 | 2025-12-09 | Shandong Boan Biotechnology Co., Ltd. | Anti-GPC3 antibody, anti-GPC3 chimeric antigen receptor and GPC3/CD3 bispecific antibody |
| US12509524B2 (en) | 2018-09-28 | 2025-12-30 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3224275B1 (en) | 2014-11-14 | 2020-03-04 | F.Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer |
| EP3973980A1 (en) | 2015-03-31 | 2022-03-30 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a trimeric tnf family ligand |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| AU2017380981B2 (en) | 2016-12-19 | 2025-01-30 | F. Hoffmann-La Roche Ag | Combination therapy with targeted 4-1BB (CD137) agonists |
| KR102692708B1 (en) | 2016-12-20 | 2024-08-07 | 에프. 호프만-라 로슈 아게 | Combination therapy of anti-CD20/anti-CD3 bispecific antibodies and 4-1BB (CD137) agonists |
| WO2018127473A1 (en) | 2017-01-03 | 2018-07-12 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-4-1bb clone 20h4.9 |
| CN110573528B (en) | 2017-03-29 | 2023-06-09 | 豪夫迈·罗氏有限公司 | Bispecific antigen-binding molecules targeting co-stimulatory TNF receptors |
| JP6997209B2 (en) | 2017-04-04 | 2022-02-04 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | A novel bispecific antigen-binding molecule capable of specifically binding to CD40 and FAP |
| WO2020070041A1 (en) | 2018-10-01 | 2020-04-09 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-fap clone 212 |
| TWI839395B (en) * | 2018-10-09 | 2024-04-21 | 瑞士商Numab治療公司 | Antibodies targeting cd137 and methods of use thereof |
| AR121706A1 (en) | 2020-04-01 | 2022-06-29 | Hoffmann La Roche | OX40 AND FAP-TARGETED BSPECIFIC ANTIGEN-BINDING MOLECULES |
| CN114940974A (en) * | 2021-09-28 | 2022-08-26 | 宁波熙宁检测技术有限公司 | Construction and application of 4-1BB reporter gene 293T stably transfected cell line |
| WO2023196593A1 (en) * | 2022-04-08 | 2023-10-12 | The University Of North Carolina At Chapel Hill | Antigen-independent targeted delivery of therapeutic agents |
| CA3256973A1 (en) * | 2022-05-12 | 2025-06-17 | Astellas Pharma Inc. | Anti-taa/anti-cd3 multispecific antibody |
Citations (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4186567A (en) | 1977-04-18 | 1980-02-05 | Hitachi Metals, Ltd. | Ornament utilizing rare earth-cobalt magnet |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| EP0404097A2 (en) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| WO2004035607A2 (en) | 2002-10-17 | 2004-04-29 | Genmab A/S | Human monoclonal antibodies against cd20 |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20040132066A1 (en) | 2002-02-14 | 2004-07-08 | Kalobios, Inc. | Methods for affinity maturation |
| US20040132028A1 (en) | 2000-09-08 | 2004-07-08 | Stumpp Michael Tobias | Collection of repeat proteins comprising repeat modules |
| WO2004106381A1 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Pharmaceutical compositions comprising bispecific anti-cd3, anti-cd19 antibody constructs for the treatment of b-cell related disorders |
| WO2005044859A2 (en) | 2003-11-05 | 2005-05-19 | Glycart Biotechnology Ag | Cd20 antibodies with increased fc receptor binding affinity and effector function |
| WO2005061547A2 (en) | 2003-12-22 | 2005-07-07 | Micromet Ag | Bispecific antibodies |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US20050260186A1 (en) | 2003-03-05 | 2005-11-24 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| EP1691833A2 (en) | 2003-11-28 | 2006-08-23 | Micromet AG | Compositions comprising polypeptides |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| WO2007042261A2 (en) | 2005-10-11 | 2007-04-19 | Micromet Ag | Compositions comprising cross-species-specific antibodies and uses thereof |
| WO2007071426A1 (en) | 2005-12-21 | 2007-06-28 | Micromet Ag | Pharmaceutical compositions with resistance to soluble cea |
| US7250297B1 (en) | 1997-09-26 | 2007-07-31 | Pieris Ag | Anticalins |
| US20070224633A1 (en) | 2003-08-25 | 2007-09-27 | Pieris Ag | Muteins of Tear Lipocalin |
| US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
| WO2008119567A2 (en) | 2007-04-03 | 2008-10-09 | Micromet Ag | Cross-species-specific cd3-epsilon binding domain |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2009080251A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080252A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080253A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010010051A1 (en) | 2008-07-21 | 2010-01-28 | Apogenix Gmbh | Tnfsf single chain molecules |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2012020006A2 (en) | 2010-08-13 | 2012-02-16 | Roche Glycart Ag | Anti-fap antibodies and methods of use |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2014131712A1 (en) | 2013-02-26 | 2014-09-04 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
| WO2016030350A1 (en) | 2014-08-29 | 2016-03-03 | F. Hoffmann-La Roche Ag | Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1 |
| WO2016075278A1 (en) | 2014-11-14 | 2016-05-19 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer |
| WO2016079076A1 (en) | 2014-11-20 | 2016-05-26 | F. Hoffmann-La Roche Ag | T cell activating bispecific antigen binding molecules agiant folr1 and cd3 |
| WO2016156291A1 (en) | 2015-03-31 | 2016-10-06 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a trimeric tnf family ligand |
Family Cites Families (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP5764127B2 (en) * | 2009-08-17 | 2015-08-12 | ロシュ グリクアート アーゲー | Targeted immunoconjugate |
| SG192673A1 (en) | 2011-02-10 | 2013-09-30 | Roche Glycart Ag | Mutant interleukin-2 polypeptides |
| EA201892619A1 (en) | 2011-04-29 | 2019-04-30 | Роше Гликарт Аг | IMMUNOCONJUGATES CONTAINING INTERLEUKIN-2 MUTANT POLYPETIPS |
| MY175687A (en) | 2012-08-07 | 2020-07-06 | Roche Glycart Ag | Composition comprising two antibodies engineered to have reduced and increased effector function |
| WO2014055442A2 (en) | 2012-10-01 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Compositions and methods for targeting stromal cells for the treatment of cancer |
| EP2961770A1 (en) | 2013-02-26 | 2016-01-06 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| UA118028C2 (en) | 2013-04-03 | 2018-11-12 | Рош Глікарт Аг | Bispecific antibodies specific for fap and dr5, antibodies specific for dr5 and methods of use |
| AU2015244814B2 (en) * | 2014-04-07 | 2020-12-24 | Chugai Seiyaku Kabushiki Kaisha | Immunoactivating antigen-binding molecule |
| WO2016194992A1 (en) * | 2015-06-05 | 2016-12-08 | 中外製薬株式会社 | Combined use of immune activators |
| AR106188A1 (en) | 2015-10-01 | 2017-12-20 | Hoffmann La Roche | ANTI-CD19 HUMANIZED HUMAN ANTIBODIES AND METHODS OF USE |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| WO2017055314A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific anti-cd19xcd3 t cell activating antigen binding molecules |
| AU2016330807B2 (en) | 2015-10-02 | 2023-08-10 | F. Hoffmann-La Roche Ag | Anti-human CD19 antibodies with high affinity |
| AU2016334623A1 (en) | 2015-10-07 | 2018-02-15 | F. Hoffmann-La Roche Ag | Bispecific antibodies with tetravalency for a costimulatory TNF receptor |
| EP3231813A1 (en) | 2016-03-29 | 2017-10-18 | F. Hoffmann-La Roche AG | Trimeric costimulatory tnf family ligand-containing antigen binding molecules |
| WO2017194442A1 (en) | 2016-05-11 | 2017-11-16 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer and a tenascin binding moiety |
| EP3243836A1 (en) | 2016-05-11 | 2017-11-15 | F. Hoffmann-La Roche AG | C-terminally fused tnf family ligand trimer-containing antigen binding molecules |
| EP3243832A1 (en) | 2016-05-13 | 2017-11-15 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer and pd1 binding moiety |
| AU2017380981B2 (en) | 2016-12-19 | 2025-01-30 | F. Hoffmann-La Roche Ag | Combination therapy with targeted 4-1BB (CD137) agonists |
| KR102692708B1 (en) | 2016-12-20 | 2024-08-07 | 에프. 호프만-라 로슈 아게 | Combination therapy of anti-CD20/anti-CD3 bispecific antibodies and 4-1BB (CD137) agonists |
| WO2018127473A1 (en) | 2017-01-03 | 2018-07-12 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-4-1bb clone 20h4.9 |
| CN110573528B (en) | 2017-03-29 | 2023-06-09 | 豪夫迈·罗氏有限公司 | Bispecific antigen-binding molecules targeting co-stimulatory TNF receptors |
| EP3601346A1 (en) | 2017-03-29 | 2020-02-05 | H. Hoffnabb-La Roche Ag | Bispecific antigen binding molecule for a costimulatory tnf receptor |
| JP6997209B2 (en) | 2017-04-04 | 2022-02-04 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | A novel bispecific antigen-binding molecule capable of specifically binding to CD40 and FAP |
| CN110505883A (en) | 2017-04-13 | 2019-11-26 | 豪夫迈·罗氏有限公司 | Interleukin-2 immunoconjugates, CD40 agonists, and optionally PD-1 axis binding antagonists for use in methods of treating cancer |
| JP6977368B2 (en) | 2017-07-28 | 2021-12-08 | コニカミノルタ株式会社 | Image forming equipment, inspection equipment and programs |
| MY205342A (en) | 2017-11-01 | 2024-10-16 | Hoffmann La Roche | Bispecific 2+1 contorsbodies |
| JP2021500902A (en) | 2017-11-01 | 2021-01-14 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | New TNF family ligand trimer-containing antigen-binding molecule |
| BR112020007630A2 (en) | 2017-11-01 | 2020-11-17 | F. Hoffmann-La Roche Ag | bispecific ox40 antibody, pharmaceutical product, pharmaceutical composition and bispecific anti-fap / anti-ox40 antibodies |
| EP3746470A1 (en) | 2018-01-31 | 2020-12-09 | F. Hoffmann-La Roche AG | Stabilized immunoglobulin domains |
| TWI841551B (en) | 2018-03-13 | 2024-05-11 | 瑞士商赫孚孟拉羅股份公司 | Combination therapy with targeted 4-1bb (cd137) agonists |
| EP3765489B1 (en) | 2018-03-13 | 2024-10-16 | F. Hoffmann-La Roche AG | Therapeutic combination of 4-1bb agonists with anti-cd20 antibodies |
| SG11202007961QA (en) | 2018-04-13 | 2020-09-29 | Hoffmann La Roche | Her2-targeting antigen binding molecules comprising 4-1bbl |
| WO2020007817A1 (en) | 2018-07-04 | 2020-01-09 | F. Hoffmann-La Roche Ag | Novel bispecific agonistic 4-1bb antigen binding molecules |
| CN112654641A (en) | 2018-10-01 | 2021-04-13 | 豪夫迈·罗氏有限公司 | Bispecific antigen binding molecules with trivalent binding to CD40 |
| WO2020070041A1 (en) | 2018-10-01 | 2020-04-09 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecules comprising anti-fap clone 212 |
| UA128001C2 (en) | 2018-12-21 | 2024-03-06 | Ф. Хоффманн-Ля Рош Аг | TUMOR-TARGETED AGONISTIC CD28-ANTIGEN-BINDING MOLECULES |
| WO2020127628A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted superagonistic cd28 antigen binding molecules |
| JP7301155B2 (en) | 2019-04-12 | 2023-06-30 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Bispecific antigen-binding molecules containing lipocalin muteins |
| KR20220025848A (en) | 2019-06-26 | 2022-03-03 | 에프. 호프만-라 로슈 아게 | Fusion of antibodies that bind CEA and 4-1BBL |
| CN114929734A (en) | 2020-01-09 | 2022-08-19 | 豪夫迈·罗氏有限公司 | Novel antigen binding molecules comprising 4-1BBL trimers |
| AR121706A1 (en) | 2020-04-01 | 2022-06-29 | Hoffmann La Roche | OX40 AND FAP-TARGETED BSPECIFIC ANTIGEN-BINDING MOLECULES |
| WO2022148853A1 (en) | 2021-01-11 | 2022-07-14 | F. Hoffmann-La Roche Ag | Immunoconjugates |
-
2017
- 2017-12-18 AU AU2017380981A patent/AU2017380981B2/en active Active
- 2017-12-18 CN CN202311602252.7A patent/CN117752798A/en active Pending
- 2017-12-18 CN CN201780078076.8A patent/CN110087682B/en active Active
- 2017-12-18 EP EP17832770.6A patent/EP3554542A1/en active Pending
- 2017-12-18 MX MX2019006955A patent/MX2019006955A/en unknown
- 2017-12-18 WO PCT/EP2017/083235 patent/WO2018114754A1/en not_active Ceased
- 2017-12-18 KR KR1020197017457A patent/KR102669762B1/en active Active
- 2017-12-18 JP JP2019532673A patent/JP7125400B2/en active Active
- 2017-12-18 CA CA3039430A patent/CA3039430A1/en active Pending
- 2017-12-18 TW TW106144416A patent/TWI829628B/en active
- 2017-12-18 IL IL267284A patent/IL267284B2/en unknown
-
2019
- 2019-06-13 MX MX2024011810A patent/MX2024011810A/en unknown
-
2020
- 2020-03-20 US US16/825,773 patent/US20200325225A1/en not_active Abandoned
-
2022
- 2022-08-12 JP JP2022128613A patent/JP7459186B2/en active Active
-
2023
- 2023-02-09 US US18/166,783 patent/US12565530B2/en active Active
Patent Citations (71)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4186567A (en) | 1977-04-18 | 1980-02-05 | Hitachi Metals, Ltd. | Ornament utilizing rare earth-cobalt magnet |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| EP0404097A2 (en) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6417429B1 (en) | 1989-10-27 | 2002-07-09 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5821333A (en) | 1995-03-01 | 1998-10-13 | Genetech, Inc. | Method for making heteromultimeric polypeptides |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US7695936B2 (en) | 1995-03-01 | 2010-04-13 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US7250297B1 (en) | 1997-09-26 | 2007-07-31 | Pieris Ag | Anticalins |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US20060025576A1 (en) | 2000-04-11 | 2006-02-02 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| US20040132028A1 (en) | 2000-09-08 | 2004-07-08 | Stumpp Michael Tobias | Collection of repeat proteins comprising repeat modules |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20040132066A1 (en) | 2002-02-14 | 2004-07-08 | Kalobios, Inc. | Methods for affinity maturation |
| WO2004035607A2 (en) | 2002-10-17 | 2004-04-29 | Genmab A/S | Human monoclonal antibodies against cd20 |
| US20050260186A1 (en) | 2003-03-05 | 2005-11-24 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| WO2004106381A1 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Pharmaceutical compositions comprising bispecific anti-cd3, anti-cd19 antibody constructs for the treatment of b-cell related disorders |
| US20070224633A1 (en) | 2003-08-25 | 2007-09-27 | Pieris Ag | Muteins of Tear Lipocalin |
| US20050123546A1 (en) | 2003-11-05 | 2005-06-09 | Glycart Biotechnology Ag | Antigen binding molecules with increased Fc receptor binding affinity and effector function |
| WO2005044859A2 (en) | 2003-11-05 | 2005-05-19 | Glycart Biotechnology Ag | Cd20 antibodies with increased fc receptor binding affinity and effector function |
| EP1691833A2 (en) | 2003-11-28 | 2006-08-23 | Micromet AG | Compositions comprising polypeptides |
| WO2005061547A2 (en) | 2003-12-22 | 2005-07-07 | Micromet Ag | Bispecific antibodies |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
| WO2007042261A2 (en) | 2005-10-11 | 2007-04-19 | Micromet Ag | Compositions comprising cross-species-specific antibodies and uses thereof |
| WO2007071426A1 (en) | 2005-12-21 | 2007-06-28 | Micromet Ag | Pharmaceutical compositions with resistance to soluble cea |
| US20080069820A1 (en) | 2006-08-30 | 2008-03-20 | Genentech, Inc. | Multispecific antibodies |
| WO2008119567A2 (en) | 2007-04-03 | 2008-10-09 | Micromet Ag | Cross-species-specific cd3-epsilon binding domain |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080252A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080253A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080251A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010010051A1 (en) | 2008-07-21 | 2010-01-28 | Apogenix Gmbh | Tnfsf single chain molecules |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2012020006A2 (en) | 2010-08-13 | 2012-02-16 | Roche Glycart Ag | Anti-fap antibodies and methods of use |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2014131712A1 (en) | 2013-02-26 | 2014-09-04 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
| WO2016030350A1 (en) | 2014-08-29 | 2016-03-03 | F. Hoffmann-La Roche Ag | Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1 |
| WO2016075278A1 (en) | 2014-11-14 | 2016-05-19 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a tnf family ligand trimer |
| WO2016079076A1 (en) | 2014-11-20 | 2016-05-26 | F. Hoffmann-La Roche Ag | T cell activating bispecific antigen binding molecules agiant folr1 and cd3 |
| WO2016156291A1 (en) | 2015-03-31 | 2016-10-06 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a trimeric tnf family ligand |
Non-Patent Citations (121)
| Title |
|---|
| "Current Protocols in Cell Biology", 2000, JOHN WILEY & SONS, INC. |
| "GenBank", Database accession no. BAB71849.1 |
| "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63 |
| "Remington's Pharmaceutical Sciences", 1990, MACK PRINTING COMPANY |
| "Uniprot", Database accession no. F6W5G6 |
| "UniProt", Database accession no. P07766 |
| "UniProt", Database accession no. P08637 |
| "Uniprot", Database accession no. P20334 |
| "Uniprot", Database accession no. Q07011 |
| ALMAGRO; FRANSSON, FRONT BIOSCI, vol. 13, 2008, pages 1619 - 1633 |
| ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633 |
| AUSUBEL ET AL.: "CURRENT PROTOCOLS IN MOLECULAR BIOLOGY", 1989, GREENE PUBLISHING ASSOCIATES AND WILEY INTERSCIENCE |
| BARTKOWIAK; CURRAN, FRONT ONCOL, vol. 5, 2015, pages 117 |
| BAUDINO ET AL., J. IMMUNOL., vol. 181, 2008, pages 6664 - 6669 |
| BERINSTEIN N. L., J CLIN ONCOL., vol. 20, 2002, pages 2197 - 2207 |
| BIOCHIM BIOPHYS ACTA, vol. 1482, 2000, pages 337 - 350 |
| BOWIE, J. U. ET AL., SCIENCE, vol. 247, 1990, pages 1306 - 10 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRUGGEMANN ET AL., J EXP MED, vol. 166, 1987, pages 1351 - 1361 |
| CARTER, J IMMUNOL METH, vol. 248, 2001, pages 7 - 15 |
| CARTER, J IMMUNOL METHODS, vol. 248, 2001, pages 7 - 15 |
| CHAU I. ET AL., J CLIN ONCOL., vol. 22, 2004, pages 1420 - 1429 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLYNES ET AL., PROC NATL ACAD SCI USA, vol. 95, 1998, pages 652 - 656 |
| CRAGG ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052 |
| CRAGG ET AL., BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| CRAGG; GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| CURR OPIN CHEM BIOL, vol. 13, 2009, pages 245 - 255 |
| DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60 |
| DIEHL ET AL., J IMMUNOL, vol. 168, 2002, pages 3755 - 3762 |
| DUBROT ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 59, 2010, pages 1223 - 1233 |
| FLAMINI ET AL., CLIN CANCER RES, vol. 12, no. 23, 2006, pages 6985 - 6988 |
| GAZZANO-SANTORO ET AL., J IMMUNOL METHODS, vol. 202, 1996, pages 163 |
| GERNGROSS, NAT BIOTECH, vol. 22, 2004, pages 1409 - 1414 |
| GOLD; FREEDMAN, J EXP MED., vol. 121, 1965, pages 439 - 462 |
| GOLDENBERG D M., THE INTERNATIONAL JOURNAL OF BIOLOGICAL MARKERS, vol. 7, 1992, pages 183 - 188 |
| GOODWIN ET AL., EUR J IMMUNOL, vol. 23, 1993, pages 2631 - 2641 |
| GRAHAM ET AL., J GEN VIROL, vol. 36, 1977, pages 59 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
| GUNASEKARAN ET AL., J. BIOL. CHEM., 2010, pages 19637 - 19646 |
| HAMMARSTROM S., SEMIN CANCER BIOL, vol. 9, no. 2, 1999, pages 67 - 81 |
| HAMMARSTROM S., SEMIN CANCER BIOL., vol. 9, no. 2, 1999, pages 67 - 81 |
| HARLOW; LANE: "Antibodies, a laboratory manual", 1988, COLD SPRING HARBOR LABORATORY |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HEELEY, ENDOCR RES, vol. 28, 2002, pages 217 - 229 |
| HELLSTROM ET AL., PROC NATL ACAD SCI USA, vol. 82, 1985, pages 1499 - 1502 |
| HELLSTROM ET AL., PROC NATL ACAD SCI USA, vol. 83, 1986, pages 7059 - 7063 |
| HOLLINGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37 |
| HORNIG ET AL., J IMMUNOTHER, vol. 35, 2012, pages 418 - 429 |
| HOUSTON, J.S., METHODS IN ENZYMOL., vol. 203, 1991, pages 46 - 96 |
| HUDSON ET AL., NAT MED, vol. 9, 2003, pages 129 - 134 |
| J. MOL. BIOL., vol. 332, 2003, pages 489 - 503 |
| J. MOL. BIOL., vol. 369, 2007, pages 1015 - 1028 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KABAT ET AL.: "Sequence of Proteins of Immunological Interest", 1983, U.S. DEPT. OF HEALTH AND HUMAN SERVICES |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983, U.S. DEPT. OF HEALTH AND HUMAN SERVICES |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KAM, N.W. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605 |
| KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34 |
| KINDT ET AL.: "Kuby Immunology", 2007, W.H. FREEMAN AND CO., pages: 91 |
| KLEIN ET AL., MABS, vol. 5, 2013, pages 22 - 33 |
| KLIMKA ET AL., BR J CANCER, vol. 83, 2000, pages 252 - 260 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KWON; WEISSMAN, PROC NATL ACAD SCI USA, vol. 86, 1989, pages 1963 - 1967 |
| LI ET AL., NAT BIOTECH, vol. 24, 2006, pages 210 - 215 |
| LI; RAVETCH, SCIENCE, vol. 333, 2011, pages 1030 - 1034 |
| LILJEBLAD ET AL., GLYCO J, vol. 17, 2000, pages 323 - 329 |
| LONBERG, CURR OPIN IMMUNOL, vol. 20, 2008, pages 450 - 459 |
| LONBERG, NAT BIOTECH, vol. 23, 2005, pages 1117 - 1125 |
| MANIATIS ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", 1989, COLD SPRING HARBOR LABORATORY |
| MARSHALL J., SEMIN ONCOL., vol. 30, no. 8, 2003, pages 30 - 6 |
| MATHER ET AL., ANNALS N.Y. ACAD SCI, vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL REPROD, vol. 23, 1980, pages 243 - 251 |
| MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554 |
| MELERO ET AL., NAT MED, vol. 3, 1997, pages 682 - 685 |
| MERCHANT, ZHU ET AL., NATURE BIOTECHNOL., vol. 16, 1998, pages 677 - 681 |
| MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537 |
| MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols" |
| MORRISON ET AL., PROC NATL ACAD SCI, vol. 81, 1984, pages 6851 - 6855 |
| MORRISON; OI, ADV IMMUNOL, vol. 44, 1988, pages 65 - 92 |
| MULLER ET AL., J IMMUNOTHER, vol. 31, 2008, pages 714 - 722 |
| NAP ET AL., CANCER RES., vol. 52, no. 8, 1992, pages 2329 - 23339 |
| NAP ET AL., TUMOUR BIOL., vol. 9, no. 2-3, 1988, pages 145 - 53 |
| NECELA ET AL., PLOS ONE, vol. 10, no. 3, 2015, pages e0127133 |
| OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68 |
| PADLAN, MOL IMMUNOL, vol. 28, 1991, pages 489 - 498 |
| PADLAN, MOLEC IMMUN, vol. 31, no. 3, 1994, pages 169 - 217 |
| PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315 |
| PNAS, vol. 100, no. 4, 2003, pages 1700 - 1705 |
| QUEEN ET AL., PROC NATL ACAD SCI USA, vol. 86, 1989, pages 10029 - 10033 |
| RIDGWAY ET AL., PROT ENG, vol. 9, 1996, pages 617 - 621 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| ROSS ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 225, 1983, pages 370 - 38 |
| SAMBROOK ET AL.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCHAEFER, W. ET AL., PNAS, vol. 108, 2011, pages 11187 - 1191 |
| SHAO; SCHWARZ, J LEUKOC BIOL, vol. 89, 2011, pages 21 - 29 |
| SIMEONE; ASCIERTO, J IMMUNOTOXICOL, vol. 9, 2012, pages 241 - 247 |
| SNELL ET AL., IMMUNOL REV, vol. 244, 2011, pages 197 - 217 |
| STUMPP ET AL.: "Darpins: A new generation of protein therapeutics", DRUG DISCOVERY TODAY, vol. 13, 2008, pages 695 - 701, XP023440383, DOI: doi:10.1016/j.drudis.2008.04.013 |
| SUNTHARALINGAM ET AL., N ENGL J MED, vol. 355, 2006, pages 1018 - 1028 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| URLAUB ET AL., PROC NATL ACAD SCI USA, vol. 77, 1980, pages 4216 |
| VAN DIJK; VAN DE WINKEL, CURR OPIN PHARMACOL, vol. 5, 2001, pages 368 - 74 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VINAY; KWON, CELL MOL IMMUNOL, vol. 8, 2011, pages 281 - 284 |
| WHO DRUG INFORMATION, vol. 22, no. 2, 2008, pages 124 |
| WHO DRUG INFORMATION, vol. 23, no. 2, 2009, pages 176 |
| WHO DRUG INFORMATION, vol. 25, no. 1, 2011, pages 75 - 76 |
| WHO DRUG INFORMATION, vol. 26, no. 4, 2012, pages 453 |
| WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32 |
| YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268 |
| ZHANG ET AL., CLIN CANCER RES, vol. 13, 2007, pages 2758 - 2767 |
| ZHANG ET AL., CLIN CANCER RES, vol. 13, 2010, pages 2758 - 2767 |
Cited By (68)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
| US12331098B2 (en) | 2017-01-05 | 2025-06-17 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| US11897937B2 (en) | 2017-01-05 | 2024-02-13 | Kahr Medical Ltd. | SIRPalpha-41BBL fusion protein and methods of use thereof |
| US11952422B2 (en) | 2017-12-05 | 2024-04-09 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region binding CD3 and CD137 |
| WO2019175125A1 (en) * | 2018-03-13 | 2019-09-19 | F. Hoffmann-La Roche Ag | Combination therapy with targeted 4-1bb (cd137) agonists |
| US12281153B2 (en) | 2018-03-13 | 2025-04-22 | Hoffmann-La Roche Inc. | Combination therapy with targeted 4-1BB (CD137) agonists |
| CN111741979B (en) * | 2018-04-13 | 2024-07-02 | 豪夫迈·罗氏有限公司 | Her 2-targeted antigen binding molecules comprising 4-1BBL |
| US12065478B2 (en) | 2018-04-13 | 2024-08-20 | Hoffmann-La Roche Inc. | HER2-targeting antigen binding molecules comprising 4-1BBL |
| CN111741979A (en) * | 2018-04-13 | 2020-10-02 | 豪夫迈·罗氏有限公司 | Her2-targeted antigen-binding molecule comprising 4-1BBL |
| WO2019197600A1 (en) * | 2018-04-13 | 2019-10-17 | F. Hoffmann-La Roche Ag | Her2-targeting antigen binding molecules comprising 4-1bbl |
| US12286466B2 (en) | 2018-07-11 | 2025-04-29 | Kahr Medical Ltd. | PD1-4-1BBL variant fusion protein and methods of use thereof |
| US12134638B2 (en) | 2018-07-11 | 2024-11-05 | Kahr Medical Ltd. | SIRPalpha-4-1BBL variant fusion protein and methods of use thereof |
| JP2021529547A (en) * | 2018-07-11 | 2021-11-04 | カール メディカル リミテッド | SIRPα-4-1BBL variant fusion protein and how to use it |
| JP7491495B2 (en) | 2018-07-11 | 2024-05-28 | カール メディカル リミテッド | SIRPα-4-1BBL variant fusion proteins and methods of use thereof |
| KR102945860B1 (en) * | 2018-07-11 | 2026-03-31 | 카 메디컬 리미티드 | SIRPalpha-4-1BBL variant fusion protein and method of using the same |
| US12435137B2 (en) | 2018-08-03 | 2025-10-07 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule containing two antigen-binding domains that are linked to each other |
| RU2850715C2 (en) * | 2018-09-28 | 2025-11-13 | Чугаи Сейяку Кабусики Кайся | Antigen-binding molecule containing a modified variable region of an antibody |
| US12509524B2 (en) | 2018-09-28 | 2025-12-30 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region |
| JP2022514343A (en) * | 2018-12-21 | 2022-02-10 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Tumor targeting agonist CD28 antigen binding molecule |
| TWI861039B (en) * | 2018-12-21 | 2024-11-11 | 瑞士商赫孚孟拉羅股份公司 | Tumor-targeted agonistic cd28 antigen binding molecules |
| US12600781B2 (en) | 2018-12-21 | 2026-04-14 | Hoffmann-La Roche Inc. | Tumor-targeted agonistic CD28 antigen binding molecules |
| WO2020127628A1 (en) * | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted superagonistic cd28 antigen binding molecules |
| WO2020127618A1 (en) * | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Tumor-targeted agonistic cd28 antigen binding molecules |
| JP7742774B2 (en) | 2018-12-21 | 2025-09-22 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Tumour-targeting agonist CD28 antigen-binding molecules |
| CN113286821B (en) * | 2018-12-21 | 2025-08-12 | 豪夫迈·罗氏有限公司 | Tumor-targeting agonistic CD28 antigen binding molecules |
| CN113286821A (en) * | 2018-12-21 | 2021-08-20 | 豪夫迈·罗氏有限公司 | Tumor-targeting agonistic CD28 antigen binding molecules |
| JP2023021958A (en) * | 2018-12-21 | 2023-02-14 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Tumor-targeting agonist CD28 antigen-binding molecule |
| US11608376B2 (en) | 2018-12-21 | 2023-03-21 | Hoffmann-La Roche Inc. | Tumor-targeted agonistic CD28 antigen binding molecules |
| JP2024020215A (en) * | 2018-12-21 | 2024-02-14 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Tumor targeting agonist CD28 antigen binding molecule |
| CN113286822A (en) * | 2018-12-21 | 2021-08-20 | 豪夫迈·罗氏有限公司 | Tumor-targeting hyperactive CD28 antigen binding molecules |
| JP7212990B2 (en) | 2019-04-26 | 2023-01-26 | アイ-エムエービー バイオファーマ ユーエス リミテッド | Human PD-L1 antibody |
| JP2022511311A (en) * | 2019-04-26 | 2022-01-31 | アイ-エムエービー バイオファーマ ユーエス リミテッド | Human PD-L1 antibody |
| US12091460B2 (en) | 2019-06-21 | 2024-09-17 | Regeneron Pharmaceuticals, Inc. | Use of bispecific antigen-binding molecules that bind MUC16 and CD3 in combination with 4-1BB co-stimulation |
| JP2024164188A (en) * | 2019-06-21 | 2024-11-26 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of bispecific antigen-binding molecules that bind MUC16 and CD3 in combination with 4-1BB costimulation |
| WO2020257681A1 (en) * | 2019-06-21 | 2020-12-24 | Regeneron Pharmaceuticals, Inc. | Use of bispecific antigen-binding molecules that bind psma and cd3 in combination with 4-1bb co-stimulation |
| CN114025802A (en) * | 2019-06-21 | 2022-02-08 | 瑞泽恩制药公司 | Use of bispecific antigen binding molecules that bind PSMA and CD3 in combination with 4-1BB co-stimulation |
| CN114025802B (en) * | 2019-06-21 | 2024-04-23 | 瑞泽恩制药公司 | Use of bispecific antigen binding molecules binding PSMA and CD3 in combination with 4-1BB co-stimulatory |
| JP7743313B2 (en) | 2019-06-21 | 2025-09-24 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of bispecific antigen binding molecules that bind PSMA and CD3 in combination with 4-1BB costimulation |
| RU2822092C2 (en) * | 2019-06-21 | 2024-07-01 | Регенерон Фармасьютикалз, Инк. | Use of bispecific antigen-binding molecules that bind psma and cd3, in combination with costimulation 4-1bb |
| RU2822091C2 (en) * | 2019-06-21 | 2024-07-01 | Регенерон Фармасьютикалз, Инк. | Use of bispecific antigen-binding molecules that bind muc16 and cd3, in combination with costimulation 4-1bb |
| JP7743314B2 (en) | 2019-06-21 | 2025-09-24 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of bispecific antigen-binding molecules that bind MUC16 and CD3 in combination with 4-1BB costimulation |
| JP2022537269A (en) * | 2019-06-21 | 2022-08-25 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of Bispecific Antigen Binding Molecules that Bind MUC16 and CD3 in Combination with 4-1BB Costimulation |
| JP2022537019A (en) * | 2019-06-21 | 2022-08-23 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of Bispecific Antigen Binding Molecules that Bind PSMA and CD3 in Combination with 4-1BB Costimulation |
| JP2024164199A (en) * | 2019-06-21 | 2024-11-26 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Use of bispecific antigen binding molecules that bind PSMA and CD3 in combination with 4-1BB costimulation |
| WO2020260329A1 (en) * | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Fusion of an antibody binding cea and 4-1bbl |
| WO2021006199A1 (en) | 2019-07-05 | 2021-01-14 | 小野薬品工業株式会社 | Treatment of hematologic cancer with pd-1/cd3 dual specificity protein |
| CN113166265B (en) * | 2019-08-12 | 2024-06-04 | 天境生物科技(上海)有限公司 | Bispecific antibody against claudin 18.2 and anti-4-1 BB and uses thereof |
| CN113166265A (en) * | 2019-08-12 | 2021-07-23 | 天境生物科技(上海)有限公司 | Anti-claudin 18.2 and anti-4-1BB bispecific antibodies and uses thereof |
| US11261259B2 (en) | 2019-08-12 | 2022-03-01 | I-Mab Biopharma Us Limited | Anti-claudin 18.2 and anti-4-1BB bispecific antibodies and uses thereof |
| US12577313B2 (en) | 2019-08-12 | 2026-03-17 | I-Mab Biopharma Us Limited | Anti-claudin 18.2 and anti-4-1BB bispecific antibodies and uses thereof |
| WO2021027850A1 (en) * | 2019-08-12 | 2021-02-18 | I-Mab Biopharma Co., Ltd. | Anti-claudin 18.2 and anti-4-1bb bispecific antibodies and uses thereof |
| AU2020387891B2 (en) * | 2019-11-19 | 2024-11-07 | Sound Biopharmaceuticals Co. Ltd. | Humanized 4-1BB monoclonal antibody and pharmaceutical composition thereof |
| US12503515B2 (en) | 2019-11-19 | 2025-12-23 | Sound Biopharmaceuticals Co. Ltd. | Humanized 4-1BB monoclonal antibody and pharmaceutical composition thereof |
| EP4063388A4 (en) * | 2019-11-19 | 2024-01-17 | Sound Biopharmaceuticals Co. Ltd. | Humanized 4-1bb monoclonal antibody and pharmaceutical composition thereof |
| CN114829408A (en) * | 2019-12-20 | 2022-07-29 | 山东博安生物技术股份有限公司 | Optimized anti-CD3 arms in T cell bispecific antibody production for immunotherapy |
| US12545730B2 (en) | 2019-12-20 | 2026-02-10 | Shandong Boan Biotechnology Co., Ltd. | Optimized anti-CD3 arm in the generation of t-cell bispecific antibodies for immunotherapy |
| WO2021121215A1 (en) * | 2019-12-20 | 2021-06-24 | Shandong Boan Biotechnology Co., Ltd. | Optimized anti-cd3 arm in the generation of t-cell bispecific antibodies for immunotherapy |
| CN114829408B (en) * | 2019-12-20 | 2024-01-26 | 山东博安生物技术股份有限公司 | Optimized anti-CD3 arms in the production of T cell bispecific antibodies for immunotherapy |
| US11718672B2 (en) | 2020-03-31 | 2023-08-08 | Chugai Seiyaki Kabushiki Kaisha | CD137- and DLL3-targeting multispecific antigen-binding molecules |
| US12492252B2 (en) | 2020-07-01 | 2025-12-09 | Shandong Boan Biotechnology Co., Ltd. | Anti-GPC3 antibody, anti-GPC3 chimeric antigen receptor and GPC3/CD3 bispecific antibody |
| EP3988568A1 (en) | 2020-10-21 | 2022-04-27 | Numab Therapeutics AG | Combination treatment |
| WO2022084440A2 (en) | 2020-10-21 | 2022-04-28 | Numab Therapeutics AG | Combination treatment |
| WO2022189377A1 (en) * | 2021-03-09 | 2022-09-15 | F. Hoffmann-La Roche Ag | Combination therapy of pd-1-targeted il-2 variant immunoconjugates and fap/4-1bb binding molecules |
| WO2023110788A1 (en) * | 2021-12-14 | 2023-06-22 | F. Hoffmann-La Roche Ag | Treatment of cancer using a hla-a2/mage-a4 x cd3 bispecific antibody and a 4-1bb (cd137) agonist |
| WO2023225098A1 (en) * | 2022-05-18 | 2023-11-23 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen binding molecules that bind cd38 and 4-1bb, and uses thereof |
| WO2024188966A1 (en) * | 2023-03-13 | 2024-09-19 | F. Hoffmann-La Roche Ag | Treatment of cancer using an anti-hla-g/anti-cd3 bispecific antibody and a 4‑1bb (cd137) agonist |
| WO2024208776A1 (en) * | 2023-04-03 | 2024-10-10 | F. Hoffmann-La Roche Ag | Agonistic split antibodies |
| WO2024208777A1 (en) * | 2023-04-03 | 2024-10-10 | F. Hoffmann-La Roche Ag | All-in-one agonistic antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3039430A1 (en) | 2018-06-28 |
| TW201834683A (en) | 2018-10-01 |
| AU2017380981A1 (en) | 2019-05-02 |
| IL267284A (en) | 2019-08-29 |
| MX2024011810A (en) | 2024-11-08 |
| KR20190097039A (en) | 2019-08-20 |
| JP7459186B2 (en) | 2024-04-01 |
| US20200325225A1 (en) | 2020-10-15 |
| CN117752798A (en) | 2024-03-26 |
| KR102669762B1 (en) | 2024-05-30 |
| JP2022176951A (en) | 2022-11-30 |
| AU2017380981B2 (en) | 2025-01-30 |
| US12565530B2 (en) | 2026-03-03 |
| CN110087682A (en) | 2019-08-02 |
| CN110087682B (en) | 2023-12-15 |
| IL267284B2 (en) | 2023-03-01 |
| TWI829628B (en) | 2024-01-21 |
| JP7125400B2 (en) | 2022-08-24 |
| JP2020504104A (en) | 2020-02-06 |
| MX2019006955A (en) | 2019-08-01 |
| EP3554542A1 (en) | 2019-10-23 |
| US20230357397A1 (en) | 2023-11-09 |
| IL267284B (en) | 2022-11-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12565530B2 (en) | Combination therapy with targeted 4-1BB (CD137) agonists/anti-FAP binding domain and anti-CEA/anti-CD3 bispecific antibody | |
| US20200392237A1 (en) | Combination therapy with targeted OX40 agonists | |
| US11718680B2 (en) | Combination therapy of anti-CD20/anti-CD3 bispecific antibodies and 4-1BB (CD137) agonists | |
| HK40105156A (en) | Combination therapy with targeted 4-1bb(cd137) agonists | |
| CA2963718C (en) | Antigen binding molecules comprising a tnf family ligand trimer | |
| WO2024246086A1 (en) | Immunostimulatory antigen binding molecules that specifically bind to bcma | |
| HK40031745A (en) | Combination therapy with targeted ox40 agonists | |
| HK40012773A (en) | Combination therapy with targeted 4-1bb (cd137) agonists | |
| HK40012774A (en) | Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists | |
| HK40012773B (en) | Combination therapy with targeted 4-1bb (cd137) agonists | |
| CA2963718A1 (en) | Antigen binding molecules comprising a tnf family ligand trimer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17832770 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3039430 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019007684 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2017380981 Country of ref document: AU Date of ref document: 20171218 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019532673 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197017457 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017832770 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 112019007684 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190416 |






























