WO2018104559A1 - Agonistes doubles de glp-1/glp-2 - Google Patents
Agonistes doubles de glp-1/glp-2 Download PDFInfo
- Publication number
- WO2018104559A1 WO2018104559A1 PCT/EP2017/082288 EP2017082288W WO2018104559A1 WO 2018104559 A1 WO2018104559 A1 WO 2018104559A1 EP 2017082288 W EP2017082288 W EP 2017082288W WO 2018104559 A1 WO2018104559 A1 WO 2018104559A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- aib
- dual agonist
- cpd
- pharmaceutically acceptable
- solvate
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to compounds having agonist activity at the GLP-1 (glucagon-like-peptide 1 ) and GLP-2 (glucagon-like peptide 2) receptors.
- the compounds find use, inter alia, in the prophylaxis or treatment of intestinal damage and dysfunction, regulation of body weight, and prophylaxis or treatment of metabolic dysfunction.
- Human GLP-2 is a 33-amino-acid peptide with the following sequence: Hy-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-lle-Leu- Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-lle-Asn-Trp-Leu-lle-Gln-Thr-Lys-lle-Thr-Asp-OH (SEQ ID NO 1 ).
- GLP-2 binds to a single G-protein-coupled receptor belonging to the class II glucagon secretin family. GLP-2 is co-secreted with GLP-1 , oxyntomodulin and glicentin, in response to nutrient ingestion.
- Human GLP-1 is produced as a 30-amino acid peptide with the following sequence: Hy-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val- Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-lle-Ala-Trp-Leu-Val-Lys-Gly-Arg- Gly-NH 2 (SEQ ID NO 2).
- GLP-2 has been reported to induce significant growth of the small intestinal mucosal epithelium via the stimulation of stem cell proliferation in the crypts, and by inhibition of apoptosis in the villi (Drucker et al., 1996, Proc. Natl. Acad. Sci. USA 93: 791 1 - 7916). GLP-2 also has growth effects on the colon. Furthermore, GLP-2 inhibits gastric emptying and gastric acid secretion (Wojdemann et al., 1999, J. Clin.
- Endocrinol. Metab. 84: 2513-2517 enhances intestinal barrier function (Benjamin et al., 2000, Gut 47: 1 12-1 19), stimulates intestinal hexose transport via the upregulation of glucose transporters (Cheeseman, 1997, Am. J. Physiol. R1965-71 ), and increases intestinal blood flow (Guan et al., 2003, Gastroenterology, 125: 136-147).
- GLP-1 has been described as a physiological incretin hormone and has thus been mostly reported to augment an insulin response after an oral intake of glucose or fat. It is, however, generally understood that GLP-1 lowers glucagon concentrations, has beneficial effects on inhibition of fast bowel movements (Tolessa et al., 1998, Dig. Dis. Sci. 43(10): 2284-90), and slows gastric emptying.
- WO2013/164484 discloses GLP-2 analogues which comprise one or more
- WO2016/066818 describes peptides having dual agonist activity at the GLP-1 and GLP-2 receptors, and proposes medical uses thereof. However, there remains a need for further compounds which combine effective agonist activities at both receptors.
- the present invention relates to compounds which have agonist activity at the GLP-1 (glucagon-like peptide 1 ) and GLP-2 (glucagon-like peptide 2) receptors, e.g. as assessed in in vitro potency assays.
- GLP-1 glucagon-like peptide 1
- GLP-2 glucagon-like peptide 2
- Such compounds are referred to in this specification as "GLP-1/GLP-2 dual agonists", or simply "dual agonists”.
- the compounds of the present invention have activities of both GLP-1 (7-36) and GLP-2 (1 -33).
- a GLP-1/GLP-2 dual agonist represented by the formula
- R 1 is hydrogen (Hy), C1-4 alkyl (e.g. methyl), acetyl, formyl, benzoyl or trifluoroacetyl;
- X * is a peptide having the formula I
- X2 is G or Aib
- X5 is S or T
- X7 is S or T
- X8 is E, S or D
- X10 is L, V or M; X11 is N, A or S;
- X16 is E, AorG
- X17 is Q, E, Lor K
- X20 is R or K
- X21 is D, L or E;
- X24 is N, S or A
- X27 is I, H, Q, KorY;
- X28 isQ, E, H, Y, L, K, RorA;
- X29 is H, Q, KorY;
- X33 is D or E
- U is absent or a sequence of 1-15 Lys residues, each independently selected from K and k;
- X2 is G or Aib
- X5 is S orT
- X8 is E, S or D
- X11 is N, AorS
- X19 is AorS
- X20 is R
- X21 is D or E; X24 is N or A;
- X27 is I, H, Q or Y;
- X28 is Q or A
- X29 is H, Q or Y;
- X33 is D or E.
- X * may be a peptide having the formula II:
- X2 is G or Aib
- X5 is S orT
- X8 is E, S or D
- X1 is ,AorS
- X16 is E or G
- X 9 is A or S
- X24 is N or A
- X27 is I, H, QorY
- U is absent or a sequence of 1-15 Lys residues, each independently selected from K and k.
- X * may be a peptide having the formula III:
- X2 is G or Aib
- X5 is S or T
- X8 is E, S or D
- X10 is Lor M
- X11 is N, AorS
- X16 is E orG
- X17isQor K is A or S;
- X24 is N or A
- X29 is H, Q or Y.
- X16 is E and X29 is H, Q or Y; or X17 is Q and X29 is H, Q or Y.
- X29 is H.
- X 1 1 is A.
- X2 is Aib.
- X2 is G.
- X27 is Q and X29 is Q;
- X28 is A and X29 is H;
- X28 is E and X29 is H;
- X10 is L, X16 is E and X17 is Q;
- X16 is E, X17 is Q and X24 is A;
- X16 is E, X17 is Q and X19 is A;
- X10 is L, X16 is E, X17 is Q and X29 is H;
- X10 is L, X1 1 is A, X16 is E, X17 is Q and X29 is H; or
- X10 is L, X1 1 is A, X16 is E, X17 is Q, X19 is A, X24 is A and X29 is H.
- X10 is L, X1 1 is A, X16 is E, X17 is Q, X27 is I and X29 is H;
- X2 is Aib
- X5 is S
- X1 1 is A
- X24 is A and X29 is H;
- X2 is Aib
- X5 is T
- X1 1 is A
- X24 is A and X29 is H;
- X2 is G, X5 is S, X1 1 is A, X24 is A and X29 is H;
- X2 is G, X5 is S, X24 is A and X29 is Q;
- X2 is G, X5 is S, X24 is A and X29 is H;
- X2 is G, X5 is S, X24 is A and X29 is Y;
- X2 is Aib
- X5 is S
- X1 1 is S
- X24 is A and X29 is H;
- X2 is Aib
- X5 is S
- X1 1 is A
- X16 is E
- X17 is Q
- X24 is A
- X2 is G, X5 is S, X1 1 is A, X16 is E, X17 is Q and X24 is A;
- X2 is Aib
- X5 is S
- X1 1 is A
- X16 is G
- X17 is K
- X24 is A and X29 is H;
- X2 is G, X5 is S, X1 1 is S, X24 is A and X29 is H;
- X2 is Aib
- X5 is S
- X1 1 is S
- X24 is A and X29 is H;
- X5 is S and X24 is A;
- X5 is S, and X24 is A; X5 is S and X16 is E;;
- X5 is S and X17 is Q;
- X5 is T, X8 is S and X24 is A;
- X8 is D and X24 is N;
- X16 is E, X17 is Q and X29 is H;
- X16 is E, X17 is Q, X24 is A and X29 is H;
- X2 is G, X16 is E, X17 is Q, X24 is A and X29 is H;
- X2 is Aib, X16 is E, X17 is Q, X24 is A and X29 is H;
- X5 is T, X16 is E, X17 is Q, X24 is A and X29 is H; or
- X5 is S
- X16 is E
- X17 is Q
- X24 is A
- X29 is H.
- X8 is D or S
- X9 is E
- X10 is L
- X1 1 is A or S
- X8 is D or S, X9 is E, X10 is L and X1 1 is A; or
- X8 is D or S
- X9 is E
- X10 is L
- X1 1 is S.
- the dual agonist of the invention may have no more than 5 amino acid changes, e.g. no more than 4, no more than 3, no more than 2 or no more than 1 change relative to the amino acid sequence
- the peptide X * may have the sequence:
- the dual agonist may be:
- X8 is E
- X10 is L and X1 1 is A
- X5 is S and X8 is E
- X2 is Aib
- X5 is S and X8 is E.
- the dual agonist of the invention may have no more than 5 amino acid changes, e.g. no more than 4, no more than 3, no more than 2 or no more than 1 change relative to the amino acid sequence
- the peptide X * may have the sequence:
- the dual agonist may be: Cpd 16 Hy-H[Aib]DGSFSEELATILDGKAARDFIAWLIQHKITD-OH; or
- X1 1 is N
- X10 is M or l_ and X1 1 is N;
- X10 is M and X1 1 is N;
- X10 is L and X1 1 is N;
- X2 is Aib, X10 is M, X24 is A and X29 is H;
- X2 is Aib, X10 is M and X24 is A;
- X2 is Aib, X10 is M, X24 is A and X29 is H;
- X2 is Aib, X10 is L and X24 is A; or
- X2 is Aib
- X10 is L
- X24 is A
- X29 is H.
- the dual agonist of the invention may have no more than 5 amino acid changes, e.g. no more than 4, no more than 3, no more than 2 or no more than 1 change relative to the amino acid sequence
- the peptide X * may have the sequence:
- the dual agonist may be:
- X * may be a peptide having the formula IV
- X2 is G or Aib
- X5 is S or T
- X8 is S, D or E
- X1 1 is A or N
- X16 is E or G; X17 is Q or K;
- X24 is N or A
- X27 is H, Q or Y;
- X29 is H, Q or Y. In some embodiments of formula IV,
- X2 is Aib, X8 is S or D and X1 1 is A;
- X2 is Aib
- X5 is S
- X1 1 is A
- X24 is A and X29 is H;
- X2 is Aib
- X5 is S
- X24 is A.
- X2 is Aib and X8 is S;
- X8 is S, X27 is H, Y or Q and X29 is H;
- X8 is S, X27 is H, Y or Q and X29 is Q;
- X8 is S, X27 is H, Y or Q and X29 is Y;
- X8 is S, X27 is H and X29 is H, Y or Q;
- X8 is S, X27 is Y and X29 is H, Y or Q; or
- X8 is S, X27 is Q and X29 is H, Y or Q.
- the dual agonist may have no more than 5 amino acid changes, e.g. no more than 4, no more than 3, no more than 2 or no more than 1 change relative to the amino acid sequence
- the amino acid sequence of the dual agonist of the invention comprises a motif selected from the group consisting of FIAWLHQT, FIAWLYQT, FIAWLQQT, FIAWLKQT, FINWLHQT, FINWLYQT, FINWLQQT and FINWLKQT.
- the amino acid sequence of the dual agonist of the invention comprises a motif selected from the group consisting of FIAWLHQH, FIAWLYQH, FIAWLQQH, FIAWLKQH, FIAWLHQQ, FIAWLYQQ, FIAWLQQQ, FIAWLKQQ, FIAWLHQK, FIAWLYQK, FIAWLQQK, FIAWLKQK, FIAWLHQY, FIAWLYQY, FIAWLQQY, FIAWLKQY, FINWLHQH, FINWLYQH, FINWLQQH, FINWLKQH, FINWLHQQ, FINWLYQQ, FINWLQQQ, FINWLKQQ, FINWLHQK, FINWLYQK, FINWLQQK, FINWLHQK, FINWLYQK, FINWLQQK, FINWLHQK, FINWLYQK, FINWLQQK,
- the peptide X * may have the sequence: H[Aib]DGSFSSELATILDEQAARDFIAWLYQQKITD;
- the dual agonist may be:
- X2 is Aib and X8 is D or E;
- X2 is Aib and X27 is H and X29 is H;
- X8 is D or E, X27 is H, Y or Q and X29 is H;
- X8 is D or E, X27 is H, Y or Q and X29 is Q;
- X8 is D or E, X27 is H, Y or Q and X29 is Y;
- X8 is D or E, X27 is H and X29 is H, Y or Q;
- X8 is D or E, X27 is Y and X29 is H, Y or Q;
- X8 is D or E, X27 is Q and X29 is H, Y or Q;
- X2 is Aib, X1 1 is N, X24 is A, X27 is H and X29 is H; or
- X2 is Aib
- X1 1 is N
- X24 is A
- X27 is H.
- the dual agonist may have no more than 5 amino acid changes, e.g. no more than 4, no more than 3, no more than 2 or no more than 1 change relative to the amino acid sequence
- the amino acid sequence of the dual agonist of the invention comprises a motif selected from the group consisting of FIAWLHQT, FIAWLYQT, FIAWLQQT, FIAWLKQT, FINWLHQT, FINWLYQT, FINWLQQT and FINWLKQT.
- the amino acid sequence of the dual agonist of the invention comprises a motif selected from the group consisting of FIAWLHQH, FIAWLYQH, FIAWLQQH, FIAWLKQH, FIAWLHQQ, FIAWLYQQ, FIAWLQQQ, FIAWLKQQ, FIAWLHQK, FIAWLYQK, FIAWLQQK, FIAWLKQK, FIAWLHQY, FIAWLYQY, FIAWLQQY, FIAWLKQY, FINWLHQH, FINWLYQH, FINWLQQH, FINWLKQH, FINWLHQQ, FINWLYQQ, FINWLQQQ, FINWLKQQ, FINWLHQK, FINWLYQK, FINWLQQK, FINWLHQK, FINWLYQK, FINWLQQK, FINWLHQK, FINWLYQK, FINWLQQK,
- the peptide X * may have the sequence
- the dual agonist may be:
- X * may be a peptide having the formula V
- X15 is D or E
- X21 is D or E
- X33 is D or E.
- the peptide X may have the sequence:
- the dual agonist may be:
- X * may be a peptide having the formula VI:
- X2 is G or Aib
- X5 is S orT
- X7 is S orT
- X10 is Lor M
- X16 is E orG
- X19 is AorS
- X * may be a peptide having the formula VII:
- X5 is S orT
- X33 is D or E.
- the peptide X * may have the sequence:
- the dual agonist may be:
- U represents a peptide sequence of 1 -15 lysine residues, e.g. 1 -10 lysine residues, Each of the amino acid residues in the peptide sequence U may independently have either D-configuration (designated "k”) or L-configuration
- K (designated "K”). In certain embodiments, all have an L-configuration or all D- configuration.
- K1-15, KMO and Ki -7 e.g., K3, K 4 , K 5 , ⁇ and K 7 , especially K 5 and ⁇ .
- Further examples include ki-i 5 , ki-io and ki -7 , e.g. k3, k 4 , k 5 , k6 and k 7 , especially k 5 and k6.
- R 1 is Hy and/or R 2 is OH.
- the dual agonist may be in the form of a pharmaceutically acceptable salt or solvate, such as a pharmaceutically acceptable acid addition salt.
- the invention also provides a composition comprising a dual agonist of the invention, or a pharmaceutically acceptable salt or solvate thereof, together with a carrier, excipient or vehicle.
- the carrier may be a pharmaceutically acceptable carrier.
- the composition may be a pharmaceutical composition.
- the pharmaceutical composition may be formulated as a liquid suitable for administration by injection or infusion. It may be formulated to achieve slow release of the dual agonist.
- the present invention further provides a dual agonist of the invention for use in therapy.
- a dual agonist of the present invention for use as a medicament.
- a dual agonist of the invention for use in a method of medical treatment.
- the invention also provides a dual agonist of the invention for use in a method of increasing intestinal mass, improving intestinal function (especially intestinal barrier function), increasing intestinal blood flow, or repairing intestinal damage or dysfunction, e.g. damage to the intestinal epithelium.
- the invention also provides a dual agonist of the invention for use in a method of prophylaxis or treatment of malabsorption, ulcers (e.g. peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, and ulcers related to infections or other pathogens), short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohns disease and ulcerative colitis), irritable bowel syndrome (IBS), pouchitis, celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, mucositis induced by chemotherapy or radiation therapy, diarrhea induced by chemotherapy or radiation therapy, low grade inflammation, metabolic endotoxemia, necrotising enterocolitis, primary biliary cirrhosis, hepatitis, fatty liver disease (including parental nutrition associated gut atrophy, PNALD (Parenteral Nutrition-Associated Liver Disease), NAFLD (Non
- the invention also provides a dual agonist of the invention for use in a method of reducing or inhibiting weight gain, reducing gastric emptying or intestinal transit, reducing food intake, reducing appetite, or promoting weight loss.
- the invention also provides a dual agonist of the invention for use in a method of prophylaxis or treatment of obesity, morbid obesity, obesity-linked gallbladder disease, obesity-induced sleep apnea, inadequate glucose control, glucose tolerance, dyslipidaemia (e.g. elevated LDL levels or reduced HDL/LDL ratio), diabetes (e.g. Type 2 diabetes, gestational diabetes), pre-diabetes, metabolic syndrome or hypertension.
- dyslipidaemia e.g. elevated LDL levels or reduced HDL/LDL ratio
- diabetes e.g. Type 2 diabetes, gestational diabetes
- pre-diabetes e.g. Type 2 diabetes, gestational diabetes
- the invention also provides a method of increasing intestinal mass, improving intestinal function (especially intestinal barrier function), increasing intestinal blood flow, or repairing intestinal damage or dysfunction in a subject in need thereof, the method comprising administering a dual agonist of the invention to the subject.
- the invention also provides a method of prophylaxis or treatment of malabsorption, ulcers (e.g. peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, and ulcers related to infections or other pathogens), short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohns disease and ulcerative colitis), irritable bowel syndrome (IBS), pouchitis, celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue,
- hypogammaglobulinemic sprue mucositis induced by chemotherapy or radiation therapy, diarrhea induced by chemotherapy or radiation therapy,, low grade inflammation, metabolic endotoxemia, necrotising enterocolitis, primary biliary cirrhosis, hepatitis, fatty liver disease (including parental nutrition associated gut atrophy, PNALD (Parenteral Nutrition-Associated Liver Disease), NAFLD (Non- Alcoholic Fatty Liver Disease) and NASH (Non-Alcoholic Steatohepatitis)), or gastrointestinal side-effects of inflammatory conditions such as pancreatitis or graft versus host disease (GVHD) in a subject in need thereof, the method comprising administering a dual agonist of the invention to the subject.
- GVHD graft versus host disease
- the invention also provides a method of reducing or inhibiting weight gain, reducing gastric emptying or intestinal transit, reducing food intake, reducing appetite, or promoting weight loss in a subject in need thereof, the method comprising administering a dual agonist of the invention to the subject.
- the invention also provides a method of prophylaxis or treatment of obesity, morbid obesity, obesity-linked gallbladder disease, obesity-induced sleep apnea, inadequate glucose control, glucose tolerance, dyslipidaemia (e.g. elevated LDL levels or reduced HDL/LDL ratio), diabetes (e.g. Type 2 diabetes, gestational diabetes), pre- diabetes, metabolic syndrome or hypertension in a subject in need thereof, the method comprising administering a dual agonist of the invention to the subject.
- dyslipidaemia e.g. elevated LDL levels or reduced HDL/LDL ratio
- diabetes e.g. Type 2 diabetes, gestational diabetes
- pre- diabetes e.g. Type 2 diabetes, gestational diabetes
- metabolic syndrome or hypertension in a subject in need thereof
- the invention also provides the use of a dual agonist of the invention in the preparation of a medicament for increasing intestinal mass, improving intestinal function (especially intestinal barrier function), increasing intestinal blood flow, or repairing intestinal damage or dysfunction, e.g. damage to the intestinal epithelium.
- the invention also provides the use of a dual agonist of the invention in the preparation of a medicament for prophylaxis or treatment of malabsorption, ulcers (e.g. peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, and ulcers related to infections or other pathogens), short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohns disease and ulcerative colitis), pouchitis, irritable bowel syndrome, celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, mucositis induced by chemotherapy or radiation therapy, diarrhea induced by chemotherapy or radiation therapy,, low grade inflammation, metabolic endotoxemia, necrotising enterocolitis, primary biliary cirrhosis, hepatitis, fatty liver disease
- ulcers e.g. peptic ulcers, Zollinger-Ellison Syndrome, drug-
- the invention also provides the use of a dual agonist of the invention in the preparation of a medicament for reducing or inhibiting weight gain, reducing gastric emptying or intestinal transit, reducing food intake, reducing appetite, or promoting weight loss.
- the invention also provides the use of a dual agonist of the invention in the preparation of a medicament for prophylaxis or treatment of obesity, morbid obesity, obesity-linked gallbladder disease, obesity-induced sleep apnea, inadequate glucose control, glucose tolerance, dyslipidaemia (e.g. elevated LDL levels or reduced HDL/LDL ratio), diabetes (e.g. Type 2 diabetes, gestational diabetes), pre-diabetes, metabolic syndrome or hypertension.
- dyslipidaemia e.g. elevated LDL levels or reduced HDL/LDL ratio
- diabetes e.g. Type 2 diabetes, gestational diabetes
- pre-diabetes e.g. Type 2 diabetes, gestational diabetes
- metabolic syndrome or hypertension e.g. Type 2 diabetes, gestational diabetes
- a further aspect provides a therapeutic kit comprising a dual agonist, or a
- patient may be used interchangeably and refer to either a human or a non-human animal.
- mammals such as humans, primates, livestock animals (e.g., bovines and porcines), companion animals (e.g., canines and felines) and rodents (e.g., mice and rats).
- solvate in the context of the present invention refers to a complex of defined stoichiometry formed between a solute (in casu, a peptide or
- the solvent in this connection may, for example, be water, ethanol or another pharmaceutically acceptable, typically small-molecular organic species, such as, but not limited to, acetic acid or lactic acid.
- a solvate is normally referred to as a hydrate.
- agonist refers to a substance (ligand) that activates the receptor type in question.
- oarmino acids such as sarcosine (Sar), norleucine (Nle), a-aminoisobutyric acid (Aib), 2,3-diaminopropanoic acid (Dap), 2,4-diaminobutanoic acid (Dab) and 2,5-diaminopentanoic acid (ornithine; Orn).
- Sar sarcosine
- Nle norleucine
- Aib 2,3-diaminopropanoic acid
- Dab 2,4-diaminobutanoic acid
- 2,5-diaminopentanoic acid ornithine; Orn.
- Such other oarmino acids may be shown in square brackets "[ ]" (e.g. "[Aib]”) when used in a general formula or sequence in the present specification, especially when the rest of the formula or sequence is shown using the single letter code.
- amino acid residues in peptides of the invention are of the L-configuration.
- D-configuration amino acids may be incorporated.
- an amino acid code written with a small letter represents the D- configuration of said amino acid, e.g. "k” represents the D-configuration of lysine (K).
- sequences disclosed herein are sequences incorporating a "Hy-”moiety at the amino terminus (N-terminus) of the sequence, and either an "-OH” moiety or an "- NH2" moiety at the carboxy terminus (C-terminus) of the sequence.
- a C- terminal "-OH" moiety may be substituted for a C-terminal "-IMH2" moiety, and vice- versa.
- Percent (%) amino acid sequence identity with respect to the GLP-2 polypeptide sequences is defined as the percentage of amino acid residues in a candidate sequence that are identical to the amino acid residues in the wild-type (human) GLP-2 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence alignment can be carried out by the skilled person using techniques well known in the art, for example using publicly available software such as BLAST, BLAST2 or Align software. For examples, see Altschul et al., Methods in Enzymology 266: 460-480 (1996) or Pearson et al., Genomics 46: 24-36, 1997.
- the dual agonist has at least one GLP-1 and at least one GLP-2 biological activity.
- Exemplary GLP-1 physiological activities include reducing rate of intestinal transit, reducing rate of gastric emptying, reducing appetite, food intake or body weight, and improving glucose control and glucose tolerance.
- Exemplary GLP-2 physiological activities include causing an increase in intestinal mass (e.g. of small intestine or colon), intestinal repair, and improving intestinal barrier function (i.e. reducing permeability of the intestine). These parameters can be assessed in in vivo assays in which the mass and the permeability of the intestine, or a portion thereof, is determined after a test animal has been treated with a dual agonist.
- the dual agonists have agonist activity at the GLP-1 and GLP-2 receptors, e.g. the human GLP-1 and GLP-2 receptors.
- EC50 values for in vitro receptor agonist activity may be used as a numerical measure of agonist potency at a given receptor.
- An EC50 value is a measure of the concentration (e.g. mol/L) of a compound required to achieve half of that compound's maximal activity in a particular assay.
- a compound having a numerical EC50 at a particular receptor which is lower than the EC50 of a reference compound in the same assay may be considered to have higher potency at that receptor than the reference compound.
- the dual agonist has an EC50 at the GLP-1 receptor (e.g. the human GLP-1 receptor) which is below 14 nM, below 13 nM, below 10 nM, below 2.0 nM, below 1 .5 nM, below 1 .0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03, below 0.02, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, or below 0.005 nM, e.g.
- the dual agonist has an EC50 at the GLP-1 receptor which is between 0.005 and 14 nM, between 0.01 nM and 13 nM, between 0.025 and 2.5 nM, between 0.005 and 10 nM, between 0.01 nM and 2.0 nM, between 0.025 and 2.0 nM, between 0.005 and 2.0 nM, between 0.01 nM and 1 .5 nM, between 0.025 and 1 .5 nM, between 0.005 and 1.0 nM, between 0.01 nM and 1.0 nM, between 0.025 and 1 .0 nM, between 0.005 and 0.5 nM, between 0.01 nM and 0.5 nM, between 0.025 and 0.5 nM, between 0.005 and 0.25 nM, between 0.01 nM and 0.25 nM, between 0.01 nM and 0.25 nM, between 0.025 and 0.25 nM, e.g. when
- the dual agonist has an EC50 at the GLP-1 receptor which is below 1.0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, or below 0.005 nM, e.g. when assessed using the GLP-1 receptor potency assay described in the Examples below
- the dual agonist has an EC50 at the GLP-1 receptor which is between 0.005 nM and 1.0 nM, between 0.006 nM and 0.9 nM, between 0.007 nM and 0.8 nM, between 0.008 nM and 0.85 nM, between 0.009 nM and 0.7 nM, between 0.01 nM and 0.65 nM, between 0.02 nM and 0.6 nM, between 0.023 nM and 0.59 nM between 0.03 nM and 0.55 nM, between 0.04 nM and 0.5 nM, between 0.05 nM and 0.45 nM, between 0.06 nM and 0.4 nM, between 0.62 nM and 0.888 nM, between 0.07 nM and 0.35 nM, between 0.08 nM and 0.3 nM, between 0.09 nM and 0.25 nM, between 0.1 nM and 0.2 nM, between 0.13 nM and
- the dual agonist has an EC50 at the GLP-1 receptor which is between 1 .001 nM and 10 nM, between 1 .01 nM and 10 nM, 1.1 nM and 10 nM, between 1 .2 nM and 9.0 nM, between 1 .5 nM and 8.0 nM, between 1.6 nM and 6.0 nM, between 1 .7 nM and 5.0 nM, between 1.8 nM and 2.0 nM, between 1.9 nM and 10.0 nM, between 2.0 nM and 9.5 nM, between 2.5 nM and 8.5 nM, between 3.0 nM and 7.5 nM, between 3.5 nM and 8.5 nM, between 4.0 nM and 5.0 nM, between 1 .1 nM and 1 .9 nM, between 1 .2 nM and 1.8 nM, between 1.3 nM and 1.7 nM, between 1.4
- the dual agonist has an EC50 at the GLP-1 receptor which is above 10.0 nM, above 10.001 nM, above 10.01 nM, above 10.5 nM, above 1 1 .0 nM, above 1 1 .5 nM, above 12.0 nM, above 12.5 nM, above 13.0 nM, above 13.5 nM, above 14.0 nM, above 14.5 nM, above 15 nM, above 15.5 nM, above 16 nM, above 20 nM, above 25 nM, above 50 nM, above 100 nM, above 200 nM, above 300 nM, above 400 nM, above 500 nM, e.g. when assessed using the GLP-1 receptor potency assay described in the Examples below
- the dual agonist has an EC50 at the GLP-1 receptor which is between 10.0 nM and 500 nM, between 10.001 nM and 500 nM, between 10.01 nM and 500 nM between 12.0 nM and 400 nM, between 14.0 nM and 200 nM, between 15.0 nM and 100 nM, between 20 nM and 50 nM, between 30 nM and 40 nM, between 1 1.0 nM and 75 nM, between 12.0 nM and 60 nM, between 13.0 nM and 50 nM, between 14.0 nM and 40 nM, between 12.0 nM and 13.0 nM, between 1 1.0 nM and 13.5 nM, e.g.
- GLP-1 receptor potency assay when assessed using the GLP-1 receptor potency assay described in the Examples below.
- An alternative measure of GLP-1 agonist activity may be derived by comparing the potency of a dual agonist with the potency of a known (or reference) GLP-1 agonist when both are measured in the same assay.
- the relative potency at the GLP-1 receptor may be defined as:
- the reference GLP-1 agonist may, for example, be human GLP-1 (7-37), liraglutide (NN221 1 ; Victoza), or Exendin-4, but is preferably liraglutide.
- the relative potency will be between 0.00005 and 100, e.g. between 0.001 and 10, between 0.001 and 5, between 0.001 and 1 , between 0.001 and 0.5, between 0.001 and 0.1 , between 0.001 and 0.05, or between 0.001 and 0.01 ; between 0.003 and 10, between 0.003 and 5, between 0.003 and 1 , between 0.001 and 0.5, between 0.003 and 0.1 , between 0.003 and 0.05, or between 0.003 and 0.01 ; between 0.01 and 10, between 0.01 and 5, between 0.01 and 1 , between 0.01 and 0.5, between 0.01 and 0.1 , or between 0.01 and 0.05; between 0.05 and 10, between 0.05 and 5, between 0.05 and 1 , between 0.05 and 0.5, or between 0.05 and 0.1 ; between 0.1 and 10, between 0.1 and 5, between 0.1 and 1 , or between 0.1 and 0.5; between 0.5 and 10, between 0.5 and 5, or between 0.5 and 1 ; between 1 and 10, or between 1 and 5 and
- the dual agonists of the invention have higher potency at the GLP-1 receptor (e.g. the human GLP-1 receptor) than wild type human GLP-2 (hGLP-2 (1 - 33)) or [Gly2]-hGLP-2 (1 -33) (i.e. human GLP-2 having glycine at position 2, also known as teduglutide).
- the relative potency of the dual agonists at the GLP-1 receptor compared to hGLP-2 (1 -33) or teduglutide is greater than 1 , typically greater than 5 or greater than 10, and may be up to 100, up to 500, or even higher.
- GLP-2 activity e.g. the human GLP-1 receptor
- wild type human GLP-2 hGLP-2 (1 - 33
- [Gly2]-hGLP-2 (1 -33) i.e. human GLP-2 having glycine at position 2, also known as teduglutide.
- the dual agonist has an EC50 at the GLP-2 receptor (e.g. the human GLP-2 receptor) which is below 1.0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, or below 0.01 nM, e.g. when assessed using the GLP-1 receptor potency assay described in the Examples below.
- the GLP-2 receptor e.g. the human GLP-2 receptor
- the dual agonist has an EC50 at the GLP-2 receptor which is between 0.005 and 1 .0 nM, between 0.01 nM and 2.0 nM, between 0.025 and 2.0 nM, between 0.005 and 1.5 nM, between 0.01 nM and 1.5 nM, between 0.025 and 1 .5 nM, between 0.005 and 0.9 nM, between 0.01 nM and 1 .0 nM, between 0.025 and 1 .0 nM, between 0.005 and 0.5 nM, between 0.01 nM and 0.3 nM, between 0.025 and 0.5 nM, between 0.005 and 0.25 nM, between 0.01 nM and 0.25 nM, between 0.025 and 0.25 nM, e.g.
- the dual agonist has an EC50 at the GLP-2 receptor which is below 2nM or more preferably below 1 .0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, below 0.015, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, or below 0.005 nM, e.g. when assessed using the GLP-2 receptor potency assay described in the Examples below.
- the dual agonist has an EC50 at the GLP-2 receptor which is between 0.005 nM and 2 nM, between 0.006 nM and 1.7 nM, between 0.007 nM and 1 .5 nM, between 0.009 nM and 1.3 nM, 0.01 nM and 1.2 nM, between 0.005 nM and 1 .0 nM, between 0.006 nM and 0.9 nM, between 0.007 nM and 0.8 nM, between 0.008 nM and 0.85 nM, between 0.009 nM and 0.7 nM, between 0.01 nM and 0.65 nM, between 0.02 nM and 0.6 nM, between 0.023 nM and 0.59 nM between 0.03 nM and 0.55 nM, between 0.04 nM and 0.5 nM, between 0.05 nM and 0.45 nM, between 0.06 nM and 0.4 nM, between 0.005
- the dual agonist has an EC50 at the GLP-2 receptor which is below 2nM or more preferably below 1.0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, below 0.015, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, or below 0.005 nM, e.g. when assessed using the GLP-2 receptor potency assay described in the Examples below.
- the dual agonist has an EC50 at the GLP-2 receptor which is between 0.005 nM and 2 nM, between 0.006 nM and 1.7 nM, between 0.007 nM and 1 .5 nM, between 0.009 nM and 1.3 nM, 0.01 nM and 1.2 nM, between 0.005 nM and 1 .0 nM, between 0.006 nM and 0.9 nM, between 0.007 nM and 0.8 nM, between 0.008 nM and 0.85 nM, between 0.009 nM and 0.7 nM, between 0.01 nM and 0.65 nM, between 0.02 nM and 0.6 nM, between 0.023 nM and 0.59 nM between 0.03 nM and 0.55 nM, between 0.04 nM and 0.5 nM, between 0.05 nM and 0.45 nM, between 0.06 nM and 0.4 nM, between 0.005
- GLP-2 receptor potency assay when assessed using the GLP-2 receptor potency assay described in the Examples below.
- An alternative measure of GLP-2 agonist activity may be derived by comparing the potency of a dual agonist with the potency of a known (or reference) GLP-2 agonist when both are measured in the same assay.
- the relative potency at the GLP-2 receptor may be defined as: [EC5o(reference agonist)] / [ECso(dual agonist)].
- a value of 1 indicates that the dual agonist and reference agonist have equal potency
- a value of >1 indicates that the dual agonist has higher potency (i.e. lower EC50) than the reference agonist
- a value of ⁇ 1 indicates that the dual agonist has lower potency (i.e. higher EC50) than the reference agonist.
- the reference GLP-2 agonist may, for example, be human GLP-2(1 -33) or teduglutide ([Gly2]-hGLP-2 (1 -33)).
- the relative potency will be between 0.001 and 100, e.g.
- the dual agonists described in the examples below may have a relative potency (using teduglutide as a reference) a relative potency between 0.1 and 1 , between 0.1 and 0.5, or between 0.1 and 0.25, between 0.1 and 0.3, between 0.25 and 1 , or between 0.25 and 0.5;
- the dual agonists of the invention have higher potency at the GLP-2 receptor (e.g. the human GLP-2 receptor) than human GLP-1 (7-37), liraglutide (NN221 1 ; Victoza), or Exendin-4.
- the relative potency of the dual agonists at the GLP-1 receptor compared to human GLP-1 (7-37), liraglutide (NN221 1 ; Victoza), or Exendin-4 is greater than 1 , typically greater than 5 or greater than 10, and may be up to 100, up to 500, or even higher.
- a dual agonist of the invention may be synthesized or produced in a number of ways, including for example, a method which comprises
- Expression is typically performed from a nucleic acid encoding the precursor peptide, which may be performed in a cell or a cell-free expression system comprising such a nucleic acid.
- the nucleic acid fragments encoding the precursor peptide will normally be inserted in suitable vectors to form cloning or expression vectors.
- the vectors can, depending on purpose and type of application, be in the form of plasmids, phages, cosmids, mini-chromosomes, or virus, but also naked DNA which is only expressed transiently in certain cells is an important vector.
- Preferred cloning and expression vectors are capable of autonomous replication, thereby enabling high copy-numbers for the purposes of high-level expression or high-level replication for subsequent cloning.
- an expression vector comprises the following features in the 5' ⁇ 3' direction and in operable linkage: a promoter for driving expression of the nucleic acid fragment, optionally a nucleic acid sequence encoding a leader peptide enabling secretion (to the extracellular phase or, where applicable, into the periplasma), the nucleic acid fragment encoding the precursor peptide, and optionally a nucleic acid sequence encoding a terminator. They may comprise additional features such as selectable markers and origins of replication. When operating with expression vectors in producer strains or cell lines it may be preferred that the vector is capable of integrating into the host cell genome. The skilled person is very familiar with suitable vectors and is able to design one according to their specific requirements.
- the vectors of the invention are used to transform host cells to produce the precursor peptide.
- Such transformed cells can be cultured cells or cell lines used for propagation of the nucleic acid fragments and vectors, and/or used for recombinant production of the precursor peptides.
- Preferred transformed cells are micro-organisms such as bacteria [such as the species Escherichia (e.g. E. coli), Bacillus (e.g. Bacillus subtilis), Salmonella, or Mycobacterium (preferably non-pathogenic, e.g. M. bovis BCG), yeasts (e.g., Saccharomyces cerevisiae and Pichia pastoris), and protozoans.
- the transformed cells may be derived from a multicellular organism, i.e. it may be fungal cell, an insect cell, an algal cell, a plant cell, or an animal cell such as a mammalian cell.
- the transformed cell is capable of replicating the nucleic acid fragment of the invention.
- Cells expressing the nucleic fragment can be used for small-scale or large-scale preparation of the peptides of the invention.
- An aspect of the present invention relates to a composition comprising a dual agonist according to the invention, or a pharmaceutically acceptable salt or solvate thereof, together with a carrier.
- the composition is a pharmaceutical composition and the carrier is a pharmaceutically acceptable carrier.
- the present invention also relates to a pharmaceutical composition comprising a dual agonist according to the invention, or a salt or solvate thereof, together with a carrier, excipient or vehicle.
- the dual agonist of the present invention may be formulated as compositions or pharmaceutical compositions prepared for storage or administration, and which comprise a therapeutically effective amount of a dual agonist of the present invention, or a salt or solvate thereof.
- Suitable salts formed with bases include metal salts, such as alkali metal or alkaline earth metal salts, for example sodium, potassium or magnesium salts; ammonia salts and organic amine salts, such as those formed with morpholine, thiomorpholine, piperidine, pyrrolidine, a lower mono-, di- or tri-alkylamine (e.g., ethyl-tert-butyl-, diethyl-, diisopropyl-, triethyl-, tributyl- or dimethylpropylamine), or a lower mono-, di- or tri-(hydroxyalkyl)amine (e.g., mono-, di- or triethanolamine).
- Internal salts may also be formed.
- salts can be formed using organic or inorganic acids.
- salts can be formed from the following acids: formic, acetic, propionic, butyric, valeric, caproic, oxalic, lactic, citric, tartaric, succinic, fumaric, maleic, malonic, mandelic, malic, phthalic, hydrochloric, hydrobromic, phosphoric, nitric, sulphuric, benzoic, carbonic, uric, methanesulphonic, naphthalenesulphonic, benzenesulphonic, toluenesulphonic, p-toluenesulphonic (i.e.
- Amino acid addition salts can also be formed with amino acids, such as lysine, glycine, or phenylalanine.
- a pharmaceutical composition of the invention is one wherein the dual agonist is in the form of a pharmaceutically acceptable acid addition salt.
- a "therapeutically effective amount" of a dual agonist compound or pharmaceutical composition thereof of the present invention will vary depending upon, inter alia, the age, weight and/or gender of the subject (patient) to be treated. Other factors that may be of relevance include the physical characteristics of the specific patient under consideration, the patient's diet, the nature of any concurrent medication, the particular compound(s) employed, the particular mode of administration, the desired pharmacological effect(s) and the particular therapeutic indication.
- a therapeutically effective amount refers to an amount which reduces symptoms of a given condition or pathology, and preferably which normalizes physiological responses in an individual with that condition or pathology. Reduction of symptoms or normalization of physiological responses can be determined using methods routine in the art and may vary with a given condition or pathology.
- a therapeutically effective amount of one or more dual agonists, or pharmaceutical compositions thereof is an amount which restores a measurable physiological parameter to substantially the same value (preferably to within 30%, more preferably to within 20%, and still more preferably to within 10% of the value) of the parameter in an individual without the condition or pathology in question.
- such human doses of the active dual agonist may be between about 0.01 pmol/kg and 500 ⁇ /kg body weight, between about 0.01 pmol/kg and 300 ⁇ /kg body weight, between 0.01 pmol/kg and 100 ⁇ /kg body weight, between 0.1 pmol/kg and 50 ⁇ /kg body weight, between 1 pmol/kg and 10 ⁇ /kg body weight, between 5 pmol/kg and 5 ⁇ /kg body weight, between 10 pmol/kg and 1 ⁇ /kg body weight, between 50 pmol/kg and 0.1 ⁇ /kg body weight, between 100 pmol/kg and 0.01 ⁇ /kg body weight, between 0.001 ⁇ /kg and 0.5
- the therapeutic dosing and regimen most appropriate for patient treatment will of course vary with the disease or condition to be treated, and according to the patient's weight and other parameters. Without wishing to be bound by any particular theory, it is expected that doses, in the ⁇ 9 ⁇ 9 range, and shorter or longer duration or frequency of treatment may produce therapeutically useful results, such as a statistically significant increase particularly in small bowel mass.
- the therapeutic regimen may include the administration of maintenance doses appropriate for preventing tissue regression that occurs following cessation of initial treatment.
- the dosage sizes and dosing regimen most appropriate for human use may be guided by the results obtained by the present invention, and may be confirmed in properly designed clinical trials.
- An effective dosage and treatment protocol may be determined by conventional means, starting with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Numerous factors may be taken into consideration by a clinician when determining an optimal dosage for a given subject. Such considerations are known to the skilled person.
- the present invention provides a dual agonist of the invention for use as a medicament.
- the present invention relates to a dual agonist of the invention for use in therapy.
- the dual agonists described in this specification have biological activities of both GLP-1 and GLP-2.
- GLP-2 induces significant growth of the small intestinal mucosal epithelium via the stimulation of stem cell proliferation in the crypts and inhibition of apoptosis on the villi (Drucker et al. Proc Natl Acad Sci U S A. 1996, 93:791 1 -6). GLP-2 also has growth effects on the colon. GLP-2 also inhibits gastric emptying and gastric acid secretion (Wojdemann et al. J Clin Endocrinol Metab. 1999, 84:2513-7), enhances intestinal barrier function (Benjamin et al.Gut.
- GLP-2 has been shown to prevent or reduce mucosal epithelial damage in a wide number of preclinical models of gut injury, including chemotherapy-induced enteritis, ischemia-reperfusion injury, dextran sulfate-induced colitis and genetic models of inflammatory bowel disease (Sinclair and Drucker Physiology 2005: 357-65).
- the GLP-2 analogue teduglutide (Gly2- hGLP-2) is approved for treatment of short bowel syndrome under the trade names Gattex and Revestive.
- GLP-1 is a peptide hormone known for its important role in glucose homeostasis. When secreted from the gastrointestinal tract in response to nutrient ingestion, GLP-1 potentiates glucose-stimulated insulin secretion from the ⁇ -cells (Kim and Egan, 2008, Pharmacol. Rev. 470-512). Furthermore, GLP-1 or it analogues has been shown to increase somatostatin secretion and suppress glucagon secretion (Hoist JJ, 2007, Physiol Rev. 1409-1439).
- GLP-1 is also known as a key regulator of appetite, food intake, and body weight. Moreover, GLP-1 can inhibit gastric emptying and gastrointestinal motility in both rodents and humans, most likely through GLP-1 receptors present in the gastrointestinal tract (Hoist JJ, 2007, Physiol Rev. 1409-1439; Hellstrom et al., 2008, Neurogastroenterol Motil. Jun; 20(6):649-659). In addition, GLP-1 seems to have insulin-like effects in major extrapancreatic tissues, participating in glucose homeostasis and lipid metabolism in tissues such as muscle, liver, and adipose tissues (Kim and Egan, 2008, Pharmacol. Rev. 470-512).
- the dual agonist compounds of the present invention may be used to increase intestinal mass, improve intestinal function (especially intestinal barrier function), increase intestinal blood flow, or repair intestinal damage or dysfunction (whether structural or functional), e.g. damage to the intestinal epithelium. They may also be used in the prophylaxis or treatment of conditions which may be ameliorated by these effects, and in reducing the morbidity related to gastrointestinal damage.
- gastrointestinal is used here to include the entire gastrointestinal tract, including oesophagus, stomach, small intestine (duodenum, jejunum, ileum) and large intestine (cecum, colon, rectum), but especially the small intestine and colon.
- conditions in which the dual agonists may be of benefit include malabsorption, ulcers (which may be of any aetiology, e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, and ulcers related to infections or other pathogens), short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohn's disease and ulcerative colitis), irritable bowel syndrome, pouchitis, celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue,
- hypogammaglobulinemic sprue and mucositis or diarrhea induced by chemotherapy or radiation therapy hypogammaglobulinemic sprue and mucositis or diarrhea induced by chemotherapy or radiation therapy.
- the dual agonists may also find use in certain conditions which do not primarily affect gastrointestinal tissue but which may be caused or exacerbated by factors arising from intestinal dysfunction.
- impaired intestinal barrier function which may be referred to as "leakiness" of the intestine or gut
- these materials may include food molecules such as fats, which contribute to hepatitis and/or fatty liver diseases, including parenteral nutrition associated gut atrophy, PNALD (Parenteral Nutrition-Associated Liver Disease), NAFLD (Non-Alcoholic Fatty Liver Disease) and NASH (Non-Alcoholic
- the materials crossing into the bloodstream may also include pathogens such as bacteria, and toxins such as bacterial lipopolysaccharide (LPS), which may contribute to systemic inflammation (e.g. vascular inflammation).
- pathogens such as bacteria
- toxins such as bacterial lipopolysaccharide (LPS)
- LPS bacterial lipopolysaccharide
- Such inflammation is often referred to as “low grade inflammation” and is a contributing factor to the
- pathogenesis of metabolic endotoxemia (a condition seen in both diabetes and obesity, discussed further below), primary biliary cirrhosis and hepatitis. Entry of pathogens to the bloodstream may also result in conditions such as necrotising enterocolitis.
- Low grade inflammation is not characterised by the normal symptoms of acute inflammation such as pain, fever and redness, but can be detected via the presence of inflammatory markers in the blood, such as C-reactive protein and pro- inflammatory cytokines including TNF-alpha (tumour necrosis factor alpha).
- the dual agonists may also find use in conditions which primarily affect other tissues but have gastrointestinal side-effects.
- inflammatory conditions such as pancreatitis result in elevated levels of circulating inflammatory mediators which may in turn induce intestinal damage or intestinal dysfunction, such as impairment of barrier function.
- intestinal damage or intestinal dysfunction such as impairment of barrier function.
- this may lead to more severe systemic inflammatory conditions such as sepsis, or to surgical procedures or mechanical injuries (volvulus) where blood supply to the intestine is interrupted, ultimately leading to ischaemia-reperfusion injuries.
- graft versus host disease GVHD
- the dual agonists described may be useful for the dual agonists described may be useful for the dual agonists described.
- prophylaxis or treatment of intestinal dysfunction or damage caused by or associated with GVHD as well as prophylaxis or treatment of side effects such as diarrhea caused by or associated with GVHD.
- the dual agonist compounds described herein also find use, inter alia, in reducing or inhibiting weight gain, reducing rate of gastric emptying or intestinal transit, reducing food intake, reducing appetite, or promoting weight loss.
- the effect on body weight may be mediated in part or wholly via reducing food intake, appetite or intestinal transit.
- the dual agonists of the invention can be used for the prophylaxis or treatment of obesity, morbid obesity, obesity-linked gallbladder disease and obesity-induced sleep apnea.
- the dual agonists of the invention may have a beneficial effect on glucose tolerance and/or glucose control. They may also be used to modulate (e.g. improve) circulating cholesterol levels, being capable of lowering circulating triglyceride or LDL levels, and increasing HDL/LDL ratio.
- they may be used for the prophylaxis or treatment of inadequate glucose control, glucose tolerance or dyslipidaemia (e.g. elevated LDL levels or reduced HDL/LDL ratio) and associated conditions, including diabetes (e.g. Type 2 diabetes, gestational diabetes), pre-diabetes, metabolic syndrome and hypertension.
- inadequate glucose control e.g. glucose tolerance or dyslipidaemia (e.g. elevated LDL levels or reduced HDL/LDL ratio) and associated conditions, including diabetes (e.g. Type 2 diabetes, gestational diabetes), pre-diabetes, metabolic syndrome and hypertension.
- the effects of the dual agonists on these conditions may therefore follow from their effect on body weight, in whole or in part, or may be independent thereof. Effects on body weight may be therapeutic or cosmetic.
- the dual agonist activity of the compounds described herein may be particularly beneficial in many of the conditions described, as the two activities may complement one another.
- malabsorption is a condition arising from abnormality in the absorption of water and/or food nutrients, such as amino acids, sugars, fats, vitamins or minerals, via the gastrointestinal (Gl) tract, leading to malnutrition and/or dehydration.
- Malabsorption may be a result of physical (e.g. traumatic) or chemical damage to the intestinal tract.
- Dual agonists as described in this specification may be capable of improving intestinal barrier function, reducing gastric empting, and increasing intestinal absorption while at the same time normalising intestinal transit time. This would not only help patients to increase the absorption of nutrients and liquid, but would also alleviate patients' social problems related to meal- stimulated bowel movements.
- intestinal function and metabolic disorders may be closely inter-related, with each contributing to the development or symptoms of the other.
- obesity is linked with low grade inflammation (sometimes designated “obesity-linked inflammation”). It is also generally recognised that obesity (along with other syndromes) causes an increased vascular permeability which allows pathogens and toxins such as LPS to enter the cell wall of the intestinal tract and thereby initiate inflammation.
- pathogens and toxins such as LPS
- the changes that result from the inflammatory response are essentially the same regardless of the cause and regardless of where the insult arises.
- the inflammatory response may be acute (short lived) or chronic (longer lasting).
- mice e.g., obese mice (ob/ob and db/db mice) have a disrupted mucosal barrier function and exhibit increased low-grade inflammation
- LPS lipopolysaccharide
- ME metabolic endotoxemia
- the inflammatory process may also play a role in causing metabolic dysfunction in obese individuals, such as insulin resistance and other metabolic disturbances.
- the dual agonist compounds of the invention may be particularly useful for prophylaxis or treatment of low grade inflammation, especially in obese or overweight individuals, exerting beneficial effects via the GLP-1 agonist component of their activity and/or the GLP-2 component of their activity.
- the therapeutic efficacy of treatment with a dual agonist of the invention may be monitored by enteric biopsy to examine the villus morphology, by biochemical assessment of nutrient absorption, by non-invasive determination of intestinal permeability, by patient weight gain, or by amelioration of the symptoms associated with these conditions.
- a therapeutic kit comprising a dual agonist of the invention, or a pharmaceutically acceptable salt or solvate thereof.
- DIPEA Diisopropylethylamine Fluka / Sigma Aldrich Co.
- Peptides were synthesized batchwise on a peptide synthezier, such as a CEM Liberty Peptide Synthesizer or a Symphony X Synthesizer, according to solid phase peptide synthetic procedures using 9-fluorenylmethyloxycarbonyl (Fmoc) as N-oarmino protecting group and suitable common protection groups for side-chain functionalities.
- a peptide synthezier such as a CEM Liberty Peptide Synthesizer or a Symphony X Synthesizer
- polymeric support based resins such as e.g. TentaGelTM, was used.
- the synthesizer was loaded with resin that prior to usage was swelled in DMF.
- the coupling solutions were transferred to the reaction vessels in the following order: amino acid (4 equiv.), HATU (4 equiv.) and DIPEA (8 equiv.).
- the coupling time was 10 min at room temperature (RT) unless otherwise stated.
- the resin was washed with DMF (5 x 0,5 min). In case of repeated couplings the coupling time was in all cases 45 min at RT.
- the Fmoc group was deprotected using piperidine in DMF or other suitable solvents.
- the deprotection solution was added to the reaction vessel and the mixture was heated for 30 sec. reaching approx. 40°C.
- the reaction vessel was drained and fresh deprotection solution was added and subsequently heated to 70-75°C for 3 min. After draining the reaction vessel the resin was washed with DMF or other suitable solvents.
- Fmoc deprotection was performed for 2,5 minutes using 40% piperidine in DMF and repeated using the same conditions.
- the resin was washed with DMF (5 x 0,5 min).
- the dried peptide resin was treated with TFA and suitable scavengers for
- the crude peptide was purified by preparative reverse phase HPLC using a conventional HPLC apperatus, such as a Gilson GX-281 with 331/332 pump combination, for binary gradient application equipped with a column, such as 5 x 25 cm Gemini NX 5u C18 1 10A column, and a fraction collector using a flow 20-40 ml/min with a suitable gradient of buffer A (0.1 % Fomic acid, aq.) or A (0.1 % TFA, aq.) and buffer B (0.1 % Formic acid, 90% MeCN, aq.) or B (0.1 % TFA, 90% MeCN, aq.). Fractions were analyzed by analytical HPLC and MS and selected fractions were pooled and lyophilized. The final product was characterized by HPLC and MS.
- a conventional HPLC apperatus such as a Gilson GX-281 with 331/332 pump combination
- a column such as 5 x 25 cm Gemini NX 5u C18 1 10A column
- GLP-1 and GLP-2 receptor potency assays Peptides of the present invention act as both GLP-1 and GLP-2 agonists and thus activate the GLP-1 receptor and GLP-2 receptor, respectively.
- One useful in vitro assay for measuring GLP-1 receptor (GLP-1 R) and GLP-2 receptor (GLP-2 R) activation is quantification of cAMP, i.e. 3'-5'-cyclic adenosine monophosphate, which is a second messenger essential in many biological processes, and one of the most ubiquitous mechanisms for regulating cellular functions.
- cAMP AlphaScreen ® assay from Perkin Elmer which has been used to quantify the cAMP response upon GLP-1 and GLP-2 receptor activation in HEK293 cells stably expressing GLP-1 R or GLP-2 R.
- Test compounds eliciting an increase in the intracellular level of cAMP can be tested in these assays and the response normalized relative to a positive and negative control (vehicle) to calculate the EC50 and maximal response from the concentration - response curve using the 4- parameter logistic (4PL) nonlinear model for curve fitting.
- Example 1 Synthesis of the compounds
- Hy-H[Aib]DGSFSDELATILDGKAARDFIAWLIQHKITD-OH Solid phase peptide synthesis was performed on a Symphony X Synthesizer using standard Fmoc chemistry. TentaGel S PHB Asp(tBu)Fmoc (1 .15 g; 0.24 mmol/g) was swelled in DMF (10 ml) prior to use and the Fmoc-group was deprotected according to the procedure described above. Coupling
- Suitable protected Fmoc-amino acids were coupled as described above using HATU as coupling reagent. All couplings were performed at R.T. In order to facilitate the synthesis, a pseudoproline were used: in position 6 and 7 Fmoc-Phe-Ser(psi Me,Mepro)-OH.
- the peptide-resin was washed with EtOH (3 x 10 ml) and Et20 (3 x 10 ml) and dried to constant weight at room temperature (r.t.).
- the peptide was cleaved from the resin by treatment with TFA TIS/H 2 0 (95/2,5/2,5; 40 ml, 2 h; r.t.).
- the volume of the filtrate was reduced and the crude peptide was precipitated after addition of diethylether.
- the crude peptide precipitate was washed several times with diethylether and finally dried to constant weight at room temperature yield 850 mg crude peptide product (purity -45%).
- Suitable protected Fmoc-amino acids were coupled as described above using HATU as coupling reagent. All couplings were performed at R.T. In order to facilitate the synthesis, a pseudoproline were used: in position 6 and 7 Fmoc-Phe-Ser(psi Me,Mepro)-OH, in position 1 1 -12 Fmoc-Ala-Thr(psi Me, Me pro)- OH. Deprotection
- the peptide-resin was washed with EtOH (3 x 10 ml) and Et20 (3 x 10 ml) and dried to constant weight at room temperature (r.t.).
- the peptide was cleaved from the resin by treatment with TFA TIS/H 2 0 (95/2,5/2,5; 40 ml, 2 h; r.t.).
- the volume of the filtrate was reduced and the crude peptide was precipitated after addition of diethylether.
- the crude peptide precipitate was washed several times with diethylether and finally dried to constant weight at room temperature yield 1000 mg crude peptide product (purity -30%).
- the crude peptide was purified by preparative reverse phase HPLC using a Gilson GX-281with 331/332 pump combination for binary gradient application equipped with a 5 x 25 cm Gemini NX 5u C18 1 10A, column and a fraction collector and run at 35 ml/min with a gradient of buffer A (0.1 % TFA, aq.) and buffer B (0.1 % TFA, 90% MeCN, aq.) gradient from 20%B to 45%B in 47 min.
- Example 2 GLP-1 R and GLP-2R EC 5 o measurements
- the cDNA encoding the human glucagon-like peptide 1 receptor (GLP-1 R) was cloned from the cDNA BC1 12126
- the DNA encoding the GLP-1 -R was amplified by PCR using primers encoding terminal restriction sites for subcloning. The 5'-end primers additionally encoded a near Kozak consensus sequence to ensure efficient translation. The fidelity of the DNA encoding the GLP-1 -R was confirmed by DNA sequencing.
- the PCR products encoding the GLP-1 -R were subcloned into a mammalian expression vector containing a neomycin (G418) resistance marker.
- the mammalian expression vectors encoding the GLP-1 -R were transfected into HEK293 cells by a standard calcium phosphate transfection method.
- the hGLP2-R was purchased from MRC-geneservice, Babraham, Cambridge as an Image clone: 5363415 (1 1924-117).
- primers for subcloning were obtained from DNA-Technology, Risskov,
- the 5' and 3' primers used for the PCR reaction include terminal restriction sites for cloning and the context of the 5' primer is modified to a Kozak consensus without changing the sequence of the product encoded by the ORF.
- a standard PCR reaction was run using Image clone 5363415 (1 1924-117) as a template with the above mentioned primers and Polymerase Herculase II Fusion in a total vol. of 50 ⁇ .
- the generated PCR product was purified using GFX PCR and Gel band purification kit, digested with restriction enzymes and cloned into the mammalian expression vector using Rapid DNA Ligation Kit. Ligation reaction was transformed to XL10 Gold Ultracompetent cells and colonies were picked for DNA production using Endofree Plasmid maxi kit. Subsequent sequence analysis was conducted by MWG Eurofins, Germany. The clone was confirmed to be the hGLP-2 (1 -33) receptor, splice variant rs17681684.
- HEK293 cells were transfected using the Lipofectamine PLUS transfection method. The day before transfection, HEK293 cells were seeded in two T75 flasks at a density of 2x10 6 cells / T75 flask in cell culturing medium without antibiotics. On the day of transfection, cells were washed with 1x DPBS and medium was replaced with Optimem to a volume of 5 mL / T75 flask before addition of Lipofectamine-plasmid complexes were added gently and drop wise to the cells in T75 flasks and replaced with growth medium after 3 hours and again to growth medium supplemented with 50C ⁇ g/ml_ G418 after 24 hours. Following 4 weeks in G418 selection, clones were picked and tested in a functional GLP-2 receptor potency assay as described below. One clone was selected for use in compound profiling.
- the cAMP AlphaScreen ® assay from Perkin Elmer was used to quantitate the cAMP response to activation of the GLP1 and GLP2 receptor, respectively.
- Exendin-4 was used as reference compound for GLP1 receptor activation and Teduglutide as reference compound for GLP2 receptor activation.
- Data from test compounds eliciting an increase in the intracellular level of cAMP were normalized relative to the positive and negative control (vehicle) to calculate the EC50 and maximal response from the concentration response curve. The results are listed in Table 2.1.
- mice Normal chow-fed C57BL/6J male mice were used. The mice were kept in standard housing conditions, light-, temperature-, and humidity-controlled room (12:12 h light- dark cycle, with lights on at 06.00-18.00 h; 20-22°C; 50-80% relative humidity). Each dosing group consisted of 6 animals. Mice were dosed twice daily with 250 nmol/kg of the test compound or vehicle for 4 days (day 0 - day3) via subcutaneous
- mice were fasted and blood glucose levels measured after a single s.c. injection with peptides. Animals were sacrificed after final dosing on day 3, and small intestinal wet weights were measured.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
L'invention concerne des composés ayant une activité agoniste au niveau des récepteurs GLP-1 (peptide 1 apparenté au glucagon) et GLP-2 (peptide 2 apparenté au glucagon). Les composés trouvent une utilisation, entre autres, dans la prophylaxie ou le traitement d'un dommage intestinal et d'un dysfonctionnement, dans la régulation du poids corporel et dans la prophylaxie ou le traitement d'un dysfonctionnement métabolique.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DKPA201600754 | 2016-12-09 | ||
DKPA201600754 | 2016-12-09 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2018104559A1 true WO2018104559A1 (fr) | 2018-06-14 |
Family
ID=60813832
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2017/082288 WO2018104559A1 (fr) | 2016-12-09 | 2017-12-11 | Agonistes doubles de glp-1/glp-2 |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2018104559A1 (fr) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10905745B2 (en) | 2016-12-09 | 2021-02-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
US11279702B2 (en) | 2020-05-19 | 2022-03-22 | Kallyope, Inc. | AMPK activators |
US11407768B2 (en) | 2020-06-26 | 2022-08-09 | Kallyope, Inc. | AMPK activators |
US11512065B2 (en) | 2019-10-07 | 2022-11-29 | Kallyope, Inc. | GPR119 agonists |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1998011125A1 (fr) | 1996-09-09 | 1998-03-19 | Zealand Pharmaceuticals A/S | Amelioration apportee a une synthese de peptides en phase solide et agent utilise dans ladite synthese |
WO2006117565A2 (fr) * | 2005-05-04 | 2006-11-09 | Zealand Pharma A/S | Analogues du glp-2 (glucagon-like-peptide-2) |
EP1767545A1 (fr) * | 2005-09-22 | 2007-03-28 | Biocompatibles UK Limited | Polypeptides de fusion de glp-1 (peptide 1 de type glucagon) ayant une resistance accrue a la peptidase |
WO2011143335A2 (fr) * | 2010-05-11 | 2011-11-17 | Nps Pharmaceuticals, Inc. | Méthodes de traitement ou de prophylaxie d'un dysfonctionnement rénal ou hépatique |
WO2013164484A1 (fr) | 2012-05-03 | 2013-11-07 | Zealand Pharma A/S | Analogues du glucagon-like peptide 2 (glp-2) |
WO2016066818A1 (fr) | 2014-10-31 | 2016-05-06 | Gubra Aps | Compositions et peptides ayant une activité agoniste double pour glp-1r et glp-2r |
-
2017
- 2017-12-11 WO PCT/EP2017/082288 patent/WO2018104559A1/fr active Application Filing
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1998011125A1 (fr) | 1996-09-09 | 1998-03-19 | Zealand Pharmaceuticals A/S | Amelioration apportee a une synthese de peptides en phase solide et agent utilise dans ladite synthese |
WO2006117565A2 (fr) * | 2005-05-04 | 2006-11-09 | Zealand Pharma A/S | Analogues du glp-2 (glucagon-like-peptide-2) |
EP1767545A1 (fr) * | 2005-09-22 | 2007-03-28 | Biocompatibles UK Limited | Polypeptides de fusion de glp-1 (peptide 1 de type glucagon) ayant une resistance accrue a la peptidase |
WO2011143335A2 (fr) * | 2010-05-11 | 2011-11-17 | Nps Pharmaceuticals, Inc. | Méthodes de traitement ou de prophylaxie d'un dysfonctionnement rénal ou hépatique |
WO2013164484A1 (fr) | 2012-05-03 | 2013-11-07 | Zealand Pharma A/S | Analogues du glucagon-like peptide 2 (glp-2) |
WO2016066818A1 (fr) | 2014-10-31 | 2016-05-06 | Gubra Aps | Compositions et peptides ayant une activité agoniste double pour glp-1r et glp-2r |
Non-Patent Citations (21)
Title |
---|
ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 266, 1996, pages 460 - 480 |
BENJAMIN ET AL., GUT, vol. 47, 2000, pages 112 - 119 |
BENJAMIN ET AL., GUT., vol. 47, 2000, pages 112 - 119 |
BRUN ET AL., AM. J. PHYSIOL. GASTROINTEST. LIVER PHYSIOL., vol. 292, 2007, pages G518 - G525 |
CANI ET AL., DIABETES, vol. 57, 2008, pages 1470 - 1481 |
CHEESEMAN, AM. J. PHYSIOL., 1997, pages R1965 - R1971 |
DACAMBRA M P ET AL: "Structural determinants for activity of glucagon-like peptide-2", BIOCHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 39, no. 30, 1 August 2000 (2000-08-01), pages 8888 - 8894, XP002293748, ISSN: 0006-2960, DOI: 10.1021/BI000497P * |
DRUCKER ET AL., PROC NATL ACAD SCI USA., vol. 93, 1996, pages 7911 - 7916 |
DRUCKER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 7911 - 7916 |
FIELDS, G.B ET AL.: "Synthetic Peptides. 2nd ed.", 2002, article "Principles and practice of solid-phase peptide synthesis" |
GUAN ET AL., GASTROENTEROLOGY, vol. 125, 2003, pages 136 - 147 |
GUT, vol. 58, 2009, pages 1091 - 1103 |
HADJIYANNI ET AL., ENDOCRINOLOGY, vol. 150, no. 2, 2009, pages 592 - 599 |
HELLSTROM ET AL., NEUROGASTROENTEROL MOTIL., vol. 20, no. 6, June 2008 (2008-06-01), pages 649 - 659 |
HOLST JJ, PHYSIOL REV., 2007, pages 1409 - 1439 |
KIM; EGAN, PHARMACOL.REV., 2008, pages 470 - 512 |
PEARSON ET AL., GENOMICS, vol. 46, 1997, pages 24 - 36 |
SINCLAIR AND DRUCKER, PHYSIOLOGY, 2005, pages 357 - 365 |
TOLESSA ET AL., DIG. DIS. SCI., vol. 43, no. 10, 1998, pages 2284 - 2290 |
WOJDEMANN ET AL., J CLIN ENDOCRINOL METAB., vol. 84, 1999, pages 2513 - 2517 |
WOJDEMANN ET AL., J. CLIN. ENDOCRINOL. METAB., vol. 84, 1999, pages 2513 - 2517 |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10905745B2 (en) | 2016-12-09 | 2021-02-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
US11395847B2 (en) | 2016-12-09 | 2022-07-26 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
US11512065B2 (en) | 2019-10-07 | 2022-11-29 | Kallyope, Inc. | GPR119 agonists |
US11279702B2 (en) | 2020-05-19 | 2022-03-22 | Kallyope, Inc. | AMPK activators |
US11851429B2 (en) | 2020-05-19 | 2023-12-26 | Kallyope, Inc. | AMPK activators |
US11407768B2 (en) | 2020-06-26 | 2022-08-09 | Kallyope, Inc. | AMPK activators |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10905745B2 (en) | Acylated GLP-1/GLP-2 dual agonists | |
AU2017373901B2 (en) | GLP-1/GLP-2 dual agonists | |
WO2018104558A1 (fr) | Agonistes doubles de glp-1/glp-2 acylés | |
JP6298044B2 (ja) | グルカゴン様ペプチド−2(glp−2)類似体 | |
WO2018103868A1 (fr) | Agonistes doubles de glp-1/glp-2 acylés | |
WO2018104559A1 (fr) | Agonistes doubles de glp-1/glp-2 | |
EP4392054A1 (fr) | Régime posologique |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17821852 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 17821852 Country of ref document: EP Kind code of ref document: A1 |