WO2018100558A2 - Cyclic dinucleotide - Google Patents

Cyclic dinucleotide Download PDF

Info

Publication number
WO2018100558A2
WO2018100558A2 PCT/IB2017/057588 IB2017057588W WO2018100558A2 WO 2018100558 A2 WO2018100558 A2 WO 2018100558A2 IB 2017057588 W IB2017057588 W IB 2017057588W WO 2018100558 A2 WO2018100558 A2 WO 2018100558A2
Authority
WO
WIPO (PCT)
Prior art keywords
compound
pharmaceutically acceptable
acceptable salt
group
formula
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2017/057588
Other languages
French (fr)
Other versions
WO2018100558A3 (en
WO2018100558A8 (en
WO2018100558A9 (en
Inventor
Masato Yoshikawa
Morihisa Saitoh
Taisuke Kato
Yayoi YOSHITOMI
Tomohiro Seki
Yasuo Nakagawa
Yusuke Tominari
Masaki Seto
Yusuke Sasaki
Masanori Okaniwa
Tsuneo Oda
Akito SHIBUYA
Kosuke HIDAKA
Zenyu Shiokawa
Shumpei Murata
Atsutoshi OKABE
Yoshihisa Nakada
Michiyo Mochizuki
Brian Scott Freeze
Taisuke Tawaraishi
Yasufumi Wada
Paul D. Greenspan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Takeda Pharmaceutical Co Ltd
Original Assignee
Takeda Pharmaceutical Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from JP2017107216A external-priority patent/JP2018090562A/en
Priority to SI201730756T priority Critical patent/SI3512861T1/en
Priority to MYPI2019003124A priority patent/MY190460A/en
Priority to RS20210562A priority patent/RS61818B1/en
Priority to KR1020197019077A priority patent/KR102640802B1/en
Priority to LTEP17817176.5T priority patent/LT3512861T/en
Priority to DK17817176.5T priority patent/DK3512861T3/en
Priority to PL17817176T priority patent/PL3512861T3/en
Priority to AU2017370004A priority patent/AU2017370004B2/en
Priority to UAA201907162A priority patent/UA126390C2/en
Priority to CA3045762A priority patent/CA3045762A1/en
Priority to JP2019527462A priority patent/JP6633255B1/en
Priority to ES17817176T priority patent/ES2866948T3/en
Priority to EP17817176.5A priority patent/EP3512861B1/en
Priority to MX2019006397A priority patent/MX2019006397A/en
Priority to CN201780074714.9A priority patent/CN110325543B/en
Priority to HRP20210726TT priority patent/HRP20210726T1/en
Priority to NZ754737A priority patent/NZ754737B2/en
Application filed by Takeda Pharmaceutical Co Ltd filed Critical Takeda Pharmaceutical Co Ltd
Priority to EA201991315A priority patent/EA038805B1/en
Priority to PE2019001164A priority patent/PE20210255A1/en
Priority to BR112019011120-4A priority patent/BR112019011120B1/en
Priority to EP21157239.1A priority patent/EP3868384B1/en
Publication of WO2018100558A2 publication Critical patent/WO2018100558A2/en
Publication of WO2018100558A3 publication Critical patent/WO2018100558A3/en
Priority to US16/185,258 priority patent/US10980825B2/en
Publication of WO2018100558A9 publication Critical patent/WO2018100558A9/en
Priority to IL267020A priority patent/IL267020B/en
Priority to PH12019501222A priority patent/PH12019501222A1/en
Anticipated expiration legal-status Critical
Publication of WO2018100558A8 publication Critical patent/WO2018100558A8/en
Priority to ZA2019/04311A priority patent/ZA201904311B/en
Priority to CONC2019/0007032A priority patent/CO2019007032A2/en
Priority to US17/065,242 priority patent/US11666594B2/en
Priority to CY20211100384T priority patent/CY1124196T1/en
Priority to US18/310,467 priority patent/US12171777B2/en
Priority to US18/936,247 priority patent/US20250205270A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H21/00Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
    • C07H21/02Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7084Compounds having two nucleosides or nucleotides, e.g. nicotinamide-adenine dinucleotide, flavine-adenine dinucleotide
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6807Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6871Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting an enzyme
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H21/00Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids

Definitions

  • the present disclosure provides a cyclic dinucleotide having a STING (stimulator of interferon genes) agonistic activity, which may be useful as an agent for the prophylaxis or treatment of cancer and other diseases.
  • STING stimulator of interferon genes
  • STING is a receptor recognizing nucleic acid different from TLR (toll-like receptor).
  • Examples of the natural ligand to be recognized include bacteria/protozoa-derived cyclic dinucleotides (CDNs), 2',3'-cGAMP synthesized by the upstream cGAS (cyclic GMP-AMP synthase), and the like (Trends in Immunology 35:88-93 (2014)).
  • CDNs bacteria/protozoa-derived cyclic dinucleotides
  • 2',3'-cGAMP synthesized by the upstream cGAS cyclic GMP-AMP synthase
  • STING is activated by these natural ligands, and induces the phosphorylation of TBK1 (TANK binding kinase 1) in the downstream, and activates IRF3 (Interferon regulatory factor 3) signal and NFkB signal in the further downstream, and thereby type-I interferon (IFN) response is induced (Trends in Immunology 35:88-93 (2014)).
  • IRF3 Interferon regulatory factor 3
  • IFN type-I interferon
  • STING STING agonist
  • Patent Document 1 discloses a compound represented by the following formula:
  • Patent Document 1 which according to Patent Document 1 is a STING-dependent TBKl activator, and is useful for the treatment of cancer (particularly solid cancer) and the like, and also useful as an adjuvant.
  • Patent Document 2 discloses a compound represented by the following formula:
  • Patent Document 2 which according to Patent Document 2 is an immune stimulator via STING, and is useful for the treatment of cancer and the like.
  • Patent Document 3 (WO 2015/077354) and Non-Patent Document 8 (Cell reports 11,
  • Patent Document 3 which according to Patent Document 3 is a STING agonist, and is useful for the treatment of cancer and the like.
  • Patent Document 4 (WO 2013/185052) and Non-Patent Document 9 (Sci. Transl.
  • Patent Document 5 discloses a compound represented by the following formula:
  • Patent Document 5 inhibits STING-dependent signal transduction, and is useful for the treatment of autoimmune disease and the like.
  • Patent Document 6 discloses a compound represented by the following formula:
  • Patent Document 6 which according to Patent Document 6 is a STING modulator, and is useful for the treatment of inflammation, allergic autoimmune disease, cancer and the like, and also useful as a vaccine adjuvant.
  • Patent Document 7 discloses a compound represented by the follo ing formula:
  • Patent Document 7 wherein each symbol is as defined in Patent Document 7, which according to Patent Document 7 can increase Type I interferon production, and is useful for the treatment of cancer, autoimmune disease, allergic reaction and the like, and also useful as an adjuvant.
  • Patent Document 8 (WO 2014/179335) and Non-Patent Document 10 (Mol. Cell 154,
  • Patent Document 8 which according to Patent Document 8 can increases Type I interferon production, and is useful for the treatment of diseases characterized by inflammation, autoimmune disease, Sjogren's syndrome and the like.
  • Patent Document 9 discloses a compound represented by the following formula:
  • Patent Document 9 which according to Patent Document 9 is a STING modulator, and is useful for the treatment of cancer, autoimmune disease and the like, and also useful as a vaccine.
  • Patent Document 10 discloses a compound represented by the following formula:
  • Patent Document 10 which according to Patent Document 10 is a STING agonist, and is useful for the treatment of cancer (particularly solid pancreatic cancer) and the like.
  • Patent Document 11 discloses a compound represented by the following formula:
  • Patent Document 12 discloses a compound represented by the following formula:
  • Patent Document 12 which according to Patent Document 12 is a STING agonist.
  • Patent Document 13 discloses a compound represented by the following formula:
  • Patent Document 14 discloses a compound represented by the following formula:
  • Patent Document 14 which according to Patent Document 14 is a STING agonist.
  • Patent Document 15 discloses a compound represented by the following formula:
  • Patent Document 16 discloses a compound represented by the following formula:
  • Patent Document 16 wherein each symbol is as defined in Patent Document 16, which according to Patent Document 16 is a STING agonist.
  • Patent Document 17 discloses a compound represented by the following formula:
  • Patent Document 17 wherein each symbol is as defined in Patent Document 17, which according to Patent Document 17 is a STING agonist.
  • R 1 and R 2 are each independently a hydroxy group or a halogen atom
  • B 1 is a group represented by
  • R 13 , R 14 , R 15 , R 16 and R 17 are each independently a hydrogen atom or a substituent
  • Y 11 , Y 12 , Y 13 , Y 14 , Y 15 and Y 16 are each independently N or CR la ;
  • Z n , Z 12 , Z 13 , Z 14 , Z 15 and Z 16 are each independently N or C;
  • R la is a hydrogen atom or a substituent
  • B 2 is a group represented by
  • R , R , R and R are each independently a hydrogen atom or a substituent
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 are each independently N or CR 2a ;
  • Z 21 , Z 22 , Z 23 , Z 24 , Z 25 and Z 26 are each independently N or C;
  • R 2a is a hydrogen atom or a substituent
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is C R2a , or
  • Q 1 , Q 2 , Q3 and Q 4 are each independently an oxygen atom or a sulfur atom
  • compound (I) a salt thereof (hereinafter sometimes to be referred to as compound (I)).
  • the disclosure provides a compound represented by the formula (I),
  • R is hydrogen or CI -6 alkyl
  • R 19 is a halogen atom, or a salt thereof.
  • X 1 and X 2 are O.
  • the disclosure provides a compound represented by the formula (I), wherein
  • X 1 and X 2 are O.
  • the disclosure provides 7-((5R,7R,8R,12aR,14R,15R,15aR,16R)-
  • the disclosure provides 7-
  • the disclosure provides 2-amino-9-
  • the disclosure provides 7-
  • CD is a group represented by any one of Formula (XX) - (XXIX), see below;
  • L is a linker
  • A is an antibody, antibody fragment, or antigen-binding fragment
  • n 1-10.
  • the disclosure provides a compound having Formula (XIV), or a pharmaceutically acceptable salt thereof, wherein A is an antibody.
  • the disclosure provides a compound having Formula (XIV), or a pharmaceutically acceptable salt thereof, wherein A is an antigen-binding fragment.
  • the disclosure provides medicament comprising the compound or salt of formula (I).
  • the medicament is a STING agonist.
  • the medicament is an agent for the prophylaxis or treatment of cancer.
  • the disclosure provides a method of activating a STING in a mammal, which comprises administering an effective amount of a compound having formula (I), or a salt thereof, to the mammal.
  • the disclosure provides a method for the prophylaxis or treatment of cancer in a mammal, which comprises administering an effective amount of the compound having formula (I), or a salt thereof, to the mammal.
  • the disclosure provides a compound having formula (I), or a salt thereof, for use in prevention or treatment of cancer.
  • the disclosure provides the use of the compound having formula (I), or a salt thereof, for the production of an agent for the prophylaxis or treatment of cancer.
  • Fig. 1 is a line graph showing Payload 1 release from ADCl.
  • Fig. 2 is a line graph showing Payload 1 release from ADC2.
  • Fig. 3 is a line graph showing Payload 2 release from ADC3.
  • Fig. 4 is a bar graph showing that HEK293 cells that express the surface receptor targets for ADCl exhibit the expected increase in the STING pathway marker phospho-IRF3
  • Fig. 5 is a bar graph showing that HEK293 cells that express the surface receptor targets for ADC2 exhibit the expected increase in the STING pathway marker phospho-IRF3
  • Fig. 6 is a bar graph showing that HEK293 cells that express the surface receptor targets for ADC3 exhibit the expected increase in the STING pathway marker phospho-IRF3
  • Fig. 7 is a bar graph showing the Western blot analyses of downstream signaling pathway activation (TBKl and IRF3) for compound Ex. 14.
  • Fig. 8 is line graph showing the anti-tumor activity of compound Ex. 3a in the colon carcinoma CT-26 syngeneic mice model.
  • Fig. 9 is line graph showing the anti-tumor activity of compound Ex. 14 in the colon carcinoma CT-26 syngeneic mice model.
  • Fig. 10 is line graph showing the anti-tumor activity of compound Ex. 3a in the colon carcinoma B16F10 syngeneic mice model.
  • Fig. 11 is line graph showing the anti -tumor activity of compound Ex. 14 in the colon carcinoma B16F10 syngeneic mice model.
  • halogen atom examples include fluorine, chlorine, bromine and iodine.
  • examples of the "Ci-6 alkyl group” include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, neopentyl, 1- ethylpropyl, hexyl, isohexyl, 1 , 1 -dimethylbutyl, 2,2-dimethylbutyl, 3,3-dimethylbutyl and 2- ethylbutyl.
  • examples of the "optionally halogenated C 1-6 alkyl group” include a C 1-6 alkyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methyl, chloromethyl, difluoromethyl, trichloromethyl, trifluoromethyl, ethyl, 2-bromoethyl, 2,2,2-trifluoroethyl, tetrafluoroethyl, pentafluoroethyl, propyl, 2,2-difluoropropyl, 3,3,3-trifluoropropyl, isopropyl, butyl, 4,4,4-trifluorobutyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, neopentyl, 5,5,5-trifluoropentyl, hexyl and 6, 6, 6-tr ifluor ohexy
  • examples of the "C2-6 alkenyl group” include ethenyl, 1- propenyl, 2-propenyl, 2-methyl- 1 -propenyl, 1-butenyl, 2-butenyl, 3-butenyl, 3-methyl-2- butenyl, 1-pentenyl, 2-pentenyl, 3-pentenyl, 4-pentenyl, 4-methyl-3-pentenyl, 1-hexenyl, 3- hexenyl and 5-hexenyl.
  • examples of the "C2-6 alkynyl group” include ethynyl, 1- propynyl, 2-propynyl, 1-butynyl, 2-butynyl, 3-butynyl, 1-pentynyl, 2-pentynyl, 3-pentynyl, 4-pentynyl, 1-hexynyl, 2-hexynyl, 3-hexynyl, 4-hexynyl, 5-hexynyl and 4-methyl-2- pentynyl.
  • examples of the "C3-10 cycloalkyl group” include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, bicyclo[2.2.1]heptyl, bicyclo[2.2.2]octyl, bicyclo[3.2.1]octyl and adamantyl.
  • examples of the "optionally halogenated C3-10 cycloalkyl group” include a C3-10 cycloalkyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include cyclopropyl, 2,2-difluorocyclopropyl, 2,3- difluorocyclopropyl, cyclobutyl, difluorocyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and cyclooctyl.
  • examples of the "C3-10 cycloalkenyl group” include cyclopropenyl, cyclobutenyl, cyclopentenyl, cyclohexenyl, cycloheptenyl and cyclooctenyl.
  • examples of the "Ce-u aryl group” include phenyl, 1- naphthyl, 2-naphthyl, 1-anthryl, 2-anthryl and 9-anthryl.
  • examples of the "C 7-1 6 aralkyl group” include benzyl, phenethyl, naphthylmethyl and phenylpropyl.
  • examples of the "Ci-6 alkoxy group” include methoxy, ethoxy, propoxy, isopropoxy, butoxy, isobutoxy, sec-butoxy, tert-butoxy, pentyloxy and hexyloxy.
  • examples of the "optionally halogenated C 1-6 alkoxy group” include a C 1-6 alkoxy group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methoxy, difluoromethoxy, trifluoromethoxy, ethoxy, 2,2,2-trifluoroethoxy, propoxy, isopropoxy, butoxy, 4,4,4-trifluorobutoxy, isobutoxy, sec- butoxy, pentyloxy and hexyloxy.
  • examples of the " C3-10 cycloalkyloxy group” include cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, cycloheptyloxy and cyclooctyloxy.
  • examples of the "C ⁇ alkylthio group” include methylthio, ethylthio, propylthio, isopropylthio, butylthio, sec-butylthio, tert-butylthio, pentylthio and hexylthio.
  • examples of the "optionally halogenated C 1-6 alkylthio group” include a C 1-6 alkylthio group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methylthio, difluoromethylthio, trifluoromethylthio, ethylthio, propylthio, isopropylthio, butylthio, 4,4,4-trifluorobutylthio, pentylthio and hexylthio.
  • examples of the "Ci-6 alkyl-carbonyl group” include acetyl, propanoyl, butanoyl, 2-methylpropanoyl, pentanoyl, 3-methylbutanoyl, 2- methylbutanoyl, 2,2-dimethylpropanoyl, hexanoyl and heptanoyl.
  • examples of the "optionally halogenated C 1-6 alkyl- carbonyl group” include a C 1-6 alkyl-carbonyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include acetyl, chloroacetyl, trifluoroacetyl, trichloroacetyl, propanoyl, butanoyl, pentanoyl and hexanoyl.
  • examples of the "Ci-6 alkoxy- carbonyl group” include methoxycarbonyl, ethoxycarbonyl, propoxycarbonyl, isopropoxycarbonyl, butoxycarbonyl, isobutoxycarbonyl, sec-butoxycarbonyl, tert-butoxycarbonyl, pentyloxycarbonyl and hexyloxy carbonyl.
  • examples of the "Ce-u aryl-carbonyl group” include benzoyl, 1-naphthoyl and 2-naphthoyl.
  • examples of the "C 7-1 6 aralkyl-carbonyl group” include phenylacetyl and phenylpropionyl.
  • examples of the "5- to 14-membered aromatic heterocyclylcarbonyl group” include nicotinoyl, isonicotinoyl, thenoyl and furoyl.
  • examples of the "3- to 14-membered non-aromatic heterocyclylcarbonyl group” include morpholinylcarbonyl, piperidinylcarbonyl and pyrrolidinylcarbonyl.
  • examples of the "mono- or di-Ci-6 alkyl-carbamoyl group” include methylcarbamoyl, ethylcarbamoyl, dimethylcarbamoyl, diethylcarbamoyl and N-ethyl-N-methylcarbamoyl.
  • examples of the "mono- or di-Cy-i6 aralkyl-carbamoyl group” include benzylcarbamoyl and phenethylcarbamoyl.
  • examples of the "Ci-6 alkylsulfonyl group” include methylsulfonyl, ethylsulfonyl, propylsulfonyl, isopropylsulfonyl, butylsulfonyl, sec- butylsulfonyl and tert-butylsulfonyl.
  • examples of the "optionally halogenated C 1-6 alkylsulfonyl group” include a C 1-6 alkylsulfonyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methylsulfonyl, difluoromethylsulfonyl, trifluoromethylsulfonyl, ethylsulfonyl, propylsulfonyl, isopropylsulfonyl, butylsulfonyl, 4,4,4-trifluorobutylsulfonyl, pentylsulfonyl and hexylsulfonyl.
  • examples of the "C -u arylsulfonyl group” include phenylsulfonyl, 1 -naphthylsulfonyl and 2-naphthylsulfonyl.
  • examples of the "substituent” include a halogen atom, a cyano group, a nitro group, an optionally substituted hydrocarbon group, an optionally substituted heterocyclic group, an acyl group, an optionally substituted amino group, an optionally substituted carbamoyl group, an optionally substituted thiocarbamoyl group, an optionally substituted sulfamoyl group, an optionally substituted hydroxy group, an optionally substituted sulfanyl (SH) group and an optionally substituted silyl group.
  • examples of the "hydrocarbon group” including
  • hydrocarbon group of “optionally substituted hydrocarbon group” include a C 1-6 alkyl group, a C 2 -6 alkenyl group, a C2-6 alkynyl group, a C3-10 cycloalkyl group, a C3-10 cycloalkenyl group, a C 6 -i4 aryl group and a C 7-16 aralkyl group.
  • examples of the "optionally substituted hydrocarbon group” include a hydrocarbon group optionally having substituent(s) selected from the following Substituent group A.
  • a 3- to 14-membered non-aromatic heterocyclyloxy group e.g., morpholinyloxy, piperidinyloxy
  • Ci-6 alkyl-carbonyloxy group e.g., acetoxy, propanoyloxy
  • a C 6 -i4 aryl-carbonyloxy group e.g., benzoyloxy, 1 -naphthoyloxy, 2- naphthoyloxy
  • Ci-6 alkoxy-carbonyloxy group e.g., methoxycarbonyloxy, ethoxycarbonyloxy, propoxycarbonyloxy, butoxycarbonyloxy
  • a Ci-6 alkoxy-carbonyloxy group e.g., methoxycarbonyloxy, ethoxycarbonyloxy, propoxycarbonyloxy, butoxycarbonyloxy
  • a mono- or di-Ci-6 alkyl-carbamoyloxy group e.g., methylcarbamoyloxy, ethylcarbamoyloxy, dimethylcarbamoyloxy, diethylcarbamoyloxy
  • a mono- or di-Ci-6 alkyl-carbamoyloxy group e.g., methylcarbamoyloxy, ethylcarbamoyloxy, dimethylcarbamoyloxy, diethylcarbamoyloxy
  • a C 6 -i4 aryl-carbamoyloxy group e.g., phenylcarbamoyloxy, naphthylcarbamoyloxy
  • a 5- to 14-membered aromatic heterocyclylcarbonyloxy group e.g., nicotinoyloxy
  • a 3- to 14-membered non-aromatic heterocyclylcarbonyloxy group e.g., morpholinylcarbonyloxy, piperidinylcarbonyloxy
  • an optionally halogenated C 1-6 alkylsulfonyloxy group e.g., methylsulfonyloxy, trifluoromethylsulfonyloxy
  • a C 6 -i4 arylsulfonyloxy group optionally substituted by a C 1-6 alkyl group (e.g., phenylsulfonyloxy, toluenesulfonyloxy),
  • a C 6 -i4 aryloxy-carbonyl group e.g., phenyloxycarbonyl, 1- naphthyloxy carbonyl, 2-naphthyloxy carbonyl
  • aryloxy-carbonyl group e.g., phenyloxycarbonyl, 1- naphthyloxy carbonyl, 2-naphthyloxy carbonyl
  • a C7-16 aralkyloxy-carbonyl group e.g., benzyloxycarbonyl, phenethyloxy carbonyl
  • a C 6 -i4 aryl-carbamoyl group e.g., phenylcarbamoyl
  • a 5- to 14-membered aromatic heterocyclylcarbamoyl group e.g., pyridylcarbamoyl, thienylcarbamoyl
  • (37) a 3- to 14-membered non-aromatic heterocyclylcarbamoyl group (e.g., morpholinylcarbamoyl, piperidinylcarbamoyl),
  • a 3- to 14-membered non-aromatic heterocyclylcarbamoyl group e.g., morpholinylcarbamoyl, piperidinylcarbamoyl
  • a C 6 -i4 arylsulfonyl group (40) a 5- to 14-membered aromatic heterocyclylsulfonyl group (e.g., pyridylsulfonyl, thienylsulfonyl),
  • arylsulfinyl group e.g., phenylsulfinyl, 1 -naphthylsulfinyl, 2- naphthylsulfinyl
  • arylsulfinyl group e.g., phenylsulfinyl, 1 -naphthylsulfinyl, 2- naphthylsulfinyl
  • a 5- to 14-membered aromatic heterocyclylsulfinyl group e.g., pyridylsulfinyl, thienylsulfinyl
  • a mono- or di-Ci-6 alkylamino group e.g., methylamino, ethylamino, propylamino, isopropylamino, butylamino, dimethylamino, diethylamino, dipropylamino, dibutylamino, N-ethyl-N-methylamino
  • a mono- or di-Ci-6 alkylamino group e.g., methylamino, ethylamino, propylamino, isopropylamino, butylamino, dimethylamino, diethylamino, dipropylamino, dibutylamino, N-ethyl-N-methylamino
  • a mono- or di-C 6 -i4 arylamino group e.g., phenylamino
  • Ci-6 alkyl-carbonylamino group e.g., acetylamino, propanoylamino, butanoylamino
  • a C 6 -i4 aryl-carbonylamino group e.g., phenylcarbonylamino, naphthylcarbonylamino
  • Ci-6 alkoxy-carbonylamino group e.g., methoxycarbonylamino, ethoxycarbonylamino, propoxycarbonylamino, butoxycarbonylamino, tert- butoxycarbonylamino
  • a Ci-6 alkoxy-carbonylamino group e.g., methoxycarbonylamino, ethoxycarbonylamino, propoxycarbonylamino, butoxycarbonylamino, tert- butoxycarbonylamino
  • a C7-16 aralkyloxy-carbonylamino group e.g., benzyloxycarbonylamino
  • Ci-6 alkylsulfonylamino group e.g., methylsulfonylamino, ethylsulfonylamino
  • a C 6 -i4 arylsulfonylamino group optionally substituted by a Ci-6 alkyl group e.g., phenylsulfonylamino, toluenesulfonylamino
  • the number of the above-mentioned substituents in the "optionally substituted hydrocarbon group” is, for example, 1 to 5, preferably 1 to 3.
  • the respective substituents may be the same or different.
  • heterocyclic group of “optionally substituted heterocyclic group” include (i) an aromatic heterocyclic group, (ii) a non-aromatic heterocyclic group and (iii) a 7- to 10-membered bridged heterocyclic group, each containing, as a ring-constituting atom besides carbon atom, 1 to 4 heteroatoms selected from a nitrogen atom, a sulfur atom and an oxygen atom.
  • 5- to 14-membered aromatic heterocyclic group include a 5- to 14-membered (preferably 5- to 10-membered) aromatic heterocyclic group containing, as a ring-constituting atom besides carbon atom, 1 to 4 heteroatoms selected from a nitrogen atom, a sulfur atom and an oxygen atom.
  • aromatic heterocyclic group examples include 5- or 6-membered monocyclic aromatic heterocyclic groups such as thienyl, furyl, pyrrolyl, imidazolyl, pyrazolyl, thiazolyl, isothiazolyl, oxazolyl, isoxazolyl, pyridyl, pyrazinyl, pyrimidinyl, pyridazinyl, 1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl, 1,2,4-thiadiazolyl, 1,3,4-thiadiazolyl, triazolyl, tetrazolyl, triazinyl and the like; and
  • 8- to 14-membered fused polycyclic (preferably bi or tricyclic) aromatic heterocyclic groups such as benzothiophenyl, benzofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzothiazolyl, benzisothiazolyl, benzotriazolyl, imidazopyridinyl, thienopyridinyl, furopyridinyl, pyrrolopyridinyl, pyrazolopyridinyl, oxazolopyridinyl, thiazolopyridinyl, imidazopyrazinyl, imidazopyrimidinyl, thienopyrimidinyl, furopyrimidinyl, pyrrolopyrimidinyl, pyrazolopyrimidinyl, oxazolopyrimidinyl, thiazolopyrimidinyl, pyrazolotriazinyl, naphth
  • 3- to 14-membered non-aromatic heterocyclic group include a 3- to 14- membered (preferably 4- to 10-membered) non-aromatic heterocyclic group containing, as a ring-constituting atom besides carbon atom, 1 to 4 heteroatoms selected from a nitrogen atom, a sulfur atom and an oxygen atom.
  • non-aromatic heterocyclic group include 3- to 8- membered monocyclic non-aromatic heterocyclic groups such as aziridinyl, oxiranyl, thiiranyl, azetidinyl, oxetanyl, thietanyl, tetrahydrothienyl, tetrahydrofuranyl, pyrrolinyl, pyrrolidinyl, imidazolinyl, imidazolidinyl, oxazolinyl, oxazolidinyl, pyrazolinyl, pyrazolidinyl, thiazolinyl, thiazolidinyl, tetrahydroisothiazolyl, tetrahydrooxazolyl, tetrahydroisooxazolyl, piperidinyl, piperazinyl, tetrahydropyridinyl, dihydro
  • 9- to 14-membered fused poly cyclic (preferably bi or tricyclic) non-aromatic heterocyclic groups such as dihydrobenzofuranyl, dihydrobenzimidazolyl, dihydrobenzoxazolyl, dihydrobenzothiazolyl, dihydrobenzisothiazolyl, dihydronaphtho[2,3- b]thienyl, tetrahydroisoquinolyl, tetrahydroquinolyl, 4H-quinolizinyl, indolinyl, isoindolinyl, tetrahydrothieno[2,3-c]pyridinyl, tetrahydrobenzazepinyl, tetrahydroquinoxalinyl, tetrahydrophenanthridinyl, hexahydrophenothiazinyl, hexahydrophenoxazinyl, tetrahydrophthalazinyl, te
  • preferable examples of the "7- to 10-membered bridged heterocyclic group” include quinuclidinyl and 7-azabicyclo[2.2.1]heptanyl.
  • examples of the "nitrogen-containing heterocyclic group” include a “heterocyclic group” containing at least one nitrogen atom as a ring-constituting atom.
  • examples of the "optionally substituted heterocyclic group” include a heterocyclic group optionally having substituent(s) selected from the above- mentioned "Substituent group A.
  • the number of the substituents in the "optionally substituted heterocyclic group” is, for example, 1 to 3. When the number of the substituents is two or more, the respective substituents may be the same or different.
  • examples of the "acyl group” include a formyl group, a carboxy group, a carbamoyl group, a thiocarbamoyl group, a sulfino group, a sulfo group, a sulfamoyl group and a phosphono group, each optionally having " 1 or 2 substituents selected from a C 1-6 alkyl group, a C 2 - 6 alkenyl group, a C3-10 cycloalkyl group, a C3-10 cycloalkenyl group, a C 6 -i4 aryl group, a C 7-16 aralkyl group, a 5- to 14-membered aromatic heterocyclic group and a 3- to 14-membered non-aromatic heterocyclic group, each of which optionally has 1 to 3 substituents selected from a halogen atom, an optionally halogenated C 1-6 alkoxy group, a hydroxy
  • acyl group also include a hydrocarbon-sulfonyl group, a heterocyclylsulfonyl group, a hydrocarbon-sulfinyl group and a heterocyclylsulfinyl group.
  • the hydrocarbon-sulfonyl group means a hydrocarbon group-bonded sulfonyl group
  • the heterocyclylsulfonyl group means a heterocyclic group-bonded sulfonyl group
  • the hydrocarbon-sulfinyl group means a hydrocarbon group-bonded sulfinyl group
  • the heterocyclylsulfinyl group means a heterocyclic group-bonded sulfinyl group.
  • acyl group examples include a formyl group, a carboxy group, a
  • Ci-6 alkyl-carbonyl group a C 2- 6 alkenyl-carbonyl group (e.g., crotonoyl), a C3-10 cycloalkyl- carbonyl group (e.g., cyclobutanecarbonyl, cyclopentanecarbonyl, cyclohexanecarbonyl, cycloheptanecarbonyl), a C3-10 cycloalkenyl-carbonyl group (e.g., 2-cyclohexenecarbonyl), a C 6 -i4 aryl-carbonyl group, a C 7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a Ci-6 alkoxy-carbonyl group, a C 6 -i4 aryloxy-carbonyl group (e.g., phenyloxycarbony
  • examples of the "optionally substituted amino group” include an amino group optionally having " 1 or 2 substituents selected from a Ci_6 alkyl group, a C 2 -6 alkenyl group, a C3-10 cycloalkyl group, a C 6 -i 4 aryl group, a C7-16 aralkyl group, a Ci-6 alkyl-carbonyl group, a C 6 -i 4 aryl-carbonyl group, a C7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a Ci-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C7-i6
  • the optionally substituted amino group include an amino group, a mono- or di-(optionally halogenated Ci-6 alkyl) amino group (e.g., methylamino, trifluoromethylamino, dimethylamino, ethylamino, diethylamino, propylamino, dibutylamino), a mono- or di-C2-6 alkenylamino group (e.g., diallylamino), a mono- or di-C3_ 10 cycloalkylamino group (e.g., cyclopropylamino, cyclohexylamino), a mono- or di-C6-i 4 arylamino group (e.g., phenylamino), a mono- or di-Cy-i6 aralkylamino group (e.g., benzylamino, dibenzylamino), a mono- or di-(optionally halogenated Ci-6 alkyl)
  • examples of the "optionally substituted carbamoyl group” include a carbamoyl group optionally having " 1 or 2 substituents selected from a C 1-6 alkyl group, a C 2 -6 alkenyl group, a C3-10 cycloalkyl group, a Ce-u aryl group, a C 7-16 aralkyl group, a Ci-6 alkyl-carbonyl group, a C 6 -i 4 aryl-carbonyl group, a C 7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a C 1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group and a mono- or
  • the optionally substituted carbamoyl group include a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C 2 -6 alkenyl- carbamoyl group (e.g., diallylcarbamoyl), a mono- or di-C3.io cycloalkyl-carbamoyl group (e.g., cyclopropylcarbamoyl, cyclohexylcarbamoyl), a mono- or di-C 6 -i 4 aryl-carbamoyl group (e.g., phenylcarbamoyl), a mono- or di-Cy-16 aralkyl-carbamoyl group, a mono- or di- C 1 -6 alkyl-carbonyl-carbamoyl group (e.g., acetylcarbamoy
  • examples of the "optionally substituted thiocarbamoyl group” include a thiocarbamoyl group optionally having " 1 or 2 substituents selected from a Ci-6 alkyl group, a C 2 - 6 alkenyl group, a C3-10 cycloalkyl group, a C 6 -i 4 aryl group, a C 7-16 aralkyl group, a C 1-6 alkyl-carbonyl group, a C 6 -i 4 aryl-carbonyl group, a C 7-16 aralkyl- carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14- membered non-aromatic heterocyclylcarbonyl group, a C 1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci -6 alkyl-
  • thiocarbamoyl group examples include a thiocarbamoyl group, a mono- or di-Ci-6 alkyl-thiocarbamoyl group (e.g., methylthiocarbamoyl, ethylthiocarbamoyl, dimethylthiocarbamoyl, diethylthiocarbamoyl, N- ethyl-N-methylthiocarbamoyl), a mono- or di-C 2 -6 alkenyl-thiocarbamoyl group (e.g., diallylthiocarbamoyl), a mono- or di-C3.io cycloalkyl-thiocarbamoyl group (e.g., cyclopropylthiocarbamoyl, cyclohexylthiocarbamoyl), a mono- or di-C6-i 4
  • examples of the "optionally substituted sulfamoyl group” include a sulfamoyl group optionally having " 1 or 2 substituents selected from a C 1-6 alkyl group, a C 2- 6 alkenyl group, a C3-10 cycloalkyl group, a Ce-u aryl group, a C 7-16 aralkyl group, a Ci-6 alkyl-carbonyl group, a C 6 -i 4 aryl-carbonyl group, a C 7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a C 1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group and
  • the optionally substituted sulfamoyl group include a sulfamoyl group, a mono- or di-Ci-6 alkyl-sulfamoyl group (e.g., methylsulfamoyl, ethylsulfamoyl, dimethylsulfamoyl, diethylsulfamoyl, N-ethyl-N-methylsulfamoyl), a mono- or di-C 2- 6 alkenyl-sulfamoyl group (e.g., diallylsulfamoyl), a mono- or di-C3.io cycloalkyl- sulfamoyl group (e.g., cyclopropylsulfamoyl, cyclohexylsulfamoyl), a mono- or di-C 6 -i 4 aryl- sulfamoyl group
  • examples of the "optionally substituted hydroxy group” include a hydroxy group optionally having "a substituent selected from a C 1-6 alkyl group, a C 2 -6 alkenyl group, a C3-10 cycloalkyl group, a C 6 -i 4 aryl group, a C 7-16 aralkyl group, a C 1-6 alkyl-carbonyl group, a C 6 -i 4 aryl-carbonyl group, a C 7-16 aralkyl-carbonyl group, a 5- to 14- membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a C 1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C7-
  • Preferable examples of the optionally substituted hydroxy group include a hydroxy group, a Ci-6 alkoxy group, a C 2 -6 alkenyloxy group (e.g., allyloxy, 2-butenyloxy, 2- pentenyloxy, 3-hexenyloxy), a C3- 10 cycloalkyloxy group (e.g., cyclohexyloxy), a C 6 -i 4 aryloxy group (e.g., phenoxy, naphthyloxy), a C 7-16 aralkyloxy group (e.g., benzyloxy, phenethyloxy), a C 1-6 alkyl-carbonyloxy group (e.g., acetyloxy, propionyloxy, butyryloxy, isobutyryloxy, pivaloyloxy), a C 6 -i 4 aryl-carbonyloxy group (e.g., benzoyloxy), a C 7-16
  • examples of the "optionally substituted sulfanyl group” include a sulfanyl group optionally having "a substituent selected from a C 1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C 6 -i4 aryl group, a C 7-16 aralkyl group, a C 1-6 alkyl-carbonyl group, a C 6 -i4 aryl-carbonyl group and a 5- to 14-membered aromatic heterocyclic group, each of which optionally has 1 to 3 substituents selected from "Substituent group A" and a halogenated sulfanyl group.
  • Preferable examples of the optionally substituted sulfanyl group include a sulfanyl (-
  • SH group, a C 1-6 alkylthio group, a C2-6 alkenylthio group (e.g., allylthio, 2-butenylthio, 2- pentenylthio, 3-hexenylthio), a C3-10 cycloalkylthio group (e.g., cyclohexylthio), a C 6 -i4 arylthio group (e.g., phenylthio, naphthylthio), a C 7-16 aralkylthio group (e.g., benzylthio, phenethylthio), a C 1-6 alkyl-carbonylthio group (e.g., acetylthio, propionylthio, butyrylthio, isobutyrylthio, pivaloylthio), a C 6 -i4 aryl-carbonylthio group (e.g., benzoylthio),
  • examples of the "optionally substituted silyl group” include a silyl group optionally having " 1 to 3 substituents selected from a C 1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C 6 -i4 aryl group and a C 7-16 aralkyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A”.
  • examples of the optionally substituted silyl group include a tri-Ci-6 alkylsilyl group (e.g., trimethylsilyl, tert-butyl(dimethyl)silyl).
  • ADC antibody-drug conjugate
  • CD is a group represented by any one of Formula (XX) - (XXIX), see below, L is a linker, A is a protein, e.g., an antibody, and n is 1-10.
  • the linker is represented by -X -T-Z-Q-, wherein X is a divalent radical that connects CD to the rest of linker, or is absent, T is a peptide, or is absent, Z is a spacer, and Q is heterobifunctional group or a heterotrifunctional group.
  • the following generic formula shows an ADC of the disclosure having a para-aminobenzyl-based connector, an alanine-alanine-based dipeptide, a propanone-based spacer, and a succinimide thioether-based heterobifunctional group:
  • linker refers to any chemical moiety capable of linking a protein, e.g., antibody, antibody fragment (e.g., antigen binding fragments) or functional equivalent to a cyclic dinucleotide.
  • Linkers may be susceptible to cleavage (a "cleavable linker") thereby facilitating release of the cyclic dinucleotide.
  • cleavable linkers may be susceptible to acid-induced cleavage, photo-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the cyclic dinucleotide and/or the antibody remains active.
  • linkers may be substantially resistant to cleavage (a "noncleavable linker").
  • non-cleavable linkers are any chemical moiety capable of linking a cyclic dinucleotide to an antibody in a stable, covalent manner and does not fall off under the categories listed above for cleavable linkers.
  • non-cleavable linkers are substantially resistant to acid-induced cleavage, photo-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage and disulfide bond cleavage.
  • non- cleavable refers to the ability of the chemical bond in the linker or adjoining to the linker to withstand cleavage induced by an acid, photolabile-cleaving agent, a peptidase, an esterase, or a chemical or physiological compound that cleaves a disulfide bond, at conditions under which a cyclic dinucleotide and/or the antibody does not lose its activity.
  • cleavable linkers are cleaved by peptidases ("peptidase cleavable linkers").
  • peptides are composed of a-amino acid units and peptidic bonds, which chemically are amide bonds between the carboxylate of one amino acid and the amino group of a second amino acid.
  • Other amide bonds such as the bond between a carboxylate and the a-amino acid group of lysine, are understood not to be peptidic bonds and are considered non-cleavable.
  • linkers are cleaved by esterases ("esterase cleavable linkers"). Only certain esters can be cleaved by esterases present inside or outside of cells. Esters are formed by the condensation of a carboxylic acid and an alcohol. Simple esters are esters produced with simple alcohols, such as aliphatic alcohols, and small cyclic and small aromatic alcohols.
  • the cleavable linker component comprises a peptide comprising one to ten amino acid residues.
  • the peptide allows for cleavage of the linker by a protease, thereby facilitating release of the cyclic dinucleotide upon exposure to intracellular proteases, such as lysosomal enzymes (Doronina et al. (2003) Nat. Biotechnol. 21 :778-784).
  • Exemplary peptides include, but are not limited to, dipeptides, tripeptides, tetrapeptides, and pentapeptides.
  • Exemplary dipeptides include, but are not limited to, alanine-alanine (ala-ala), valine-citrulline (vc or val-cit), alanine-phenylalanine (af or ala-phe); phenylalanine-lysine (fk or phe-lys); phenylalanine-homolysine (phe-homolys); and N-methyl-valine-citrulline (Me-val-cit).
  • Exemplary tripeptides include, but are not limited to, glycine- valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly-gly).
  • a peptide may comprise naturally-occurring and/or non-natural amino acid residues.
  • Naturally-occurring amino acid refers to Ala, Asp, Cys, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Val, Trp, and Tyr.
  • Non-natural amino acids include, by way of non-limiting example, homoserine, homoarginine, citrulline, phenylglycine, taurine, iodotyrosine, seleno- cysteine, norleucine ("Nle”), norvaline (“Nva”), beta-alanine, L- or D-naphthalanine, ornithine ("Orn”), and the like.
  • Peptides can be designed and optimized for enzymatic cleavage by a particular enzyme, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.
  • Amino acids also include the D-forms of natural and non-natural amino acids.
  • D- designates an amino acid having the “D” (dextrorotary) configuration, as opposed to the configuration in the naturally occurring (“L-") amino acids.
  • Natural and non-natural amino acids can be purchased commercially (Sigma Chemical Co., Advanced Chemtech) or synthesized using methods known in the art.
  • heterotrifunctional group refers to a chemical moiety that connects a linker and another therapeutically active molecule, e.g., protein, e.g., an antibody. See, e.g., WO 2017/191579. Heterobi- and tri-functional groups are characterized as having different reactive groups at either end of the chemical moiety. Non-limiting exemplary heterobifunctional groups include: wherein the "*" indicates the attachment point to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the antibody. In embodiment, the heterobifunctional group is
  • a non-limiting exemplary heterotrifunctional roup is:
  • spacer refers to chemical moiety that connects a heterobi- and tri-functional group to the rest of the linker, e.g., a peptide, or, if a heterobi- or tri-functional group is absent, connects the rest of the linker or the cyclic dinucleotide to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the antibody.
  • PEG polyethylene glycol
  • drug antibody ratio refers to the number of CDs linked to A
  • the DAR is defined by the variable "n.”
  • the DAR refers to the number of CDs linked to the individual A, e.g., n is an integer of 1 to 10.
  • the DAR refers to the average number of cyclic dinucleotides linked to the As, e.g., n is an integer or fraction of 1 to 10).
  • n is an integer or fraction of 1 to 10.
  • a compound having formula (CD-L) n -A comprising a first ADC with 3 cyclic dinucleotides per A and a second ADC with 4 cyclic dinucleotides per A would have a DAR, i.e., an "n," of 3.5
  • polypeptide polypeptide
  • peptide protein
  • the terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • the polypeptides of this disclosure are based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains.
  • a "monoclonal” antibody or antigen-binding fragment thereof refers to a homogeneous antibody or antigen-binding fragment population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
  • the term "monoclonal” antibody or antigen-binding fragment thereof encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
  • monoclonal antibody or antigen- binding fragment thereof refers to such antibodies and antigen-binding fragments thereof made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals.
  • humanized antibody or antigen-binding fragment thereof refers to forms of non-human (e.g. murine) antibodies or antigen-binding fragments that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences.
  • humanized antibodies or antigen- binding fragments thereof are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non- human species (e.g.
  • CDR grafted mouse, rat, rabbit, hamster
  • Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody or fragment from a non-human species that has the desired specificity, affinity, and capability.
  • the humanized antibody or antigen- binding fragment thereof can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody or antigen-binding fragment thereof specificity, affinity, and/or capability.
  • the humanized antibody or antigen-binding fragment thereof will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody or antigen-binding fragment thereof can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
  • a "humanized antibody” is a resurfaced antibody.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
  • the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies.
  • CDRs complementarity determining regions
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Unless explicitly indicated otherwise, the numbering system used herein is the Kabat numbering system.
  • the amino acid position numbering as in Kabat refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
  • a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g.
  • residues 82a, 82b, and 82c, etc. according to Kabat after heavy chain FR residue 82.
  • the Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
  • the CDRs of an antibody or antigen-binding fragment thereof can be determined according to the Chothia numbering scheme, which refers to the location of immunoglobulin structural loops (see, e.g., Chothia C & Lesk AM, (1987), J Mol Biol 196: 901-917; Al-Lazikani B et al, (1997) J Mol Biol 273: 927-948; Chothia C et al, (1992) J Mol Biol 227: 799-817; Tramontano A et al, (1990) J Mol Biol 215(1): 175-82; and U.S. Patent No. 7,709,226).
  • Chothia numbering scheme refers to the location of immunoglobulin structural loops
  • the Chothia CDR-H1 loop is present at heavy chain amino acids 26 to 32, 33, or 34
  • the Chothia CDR-H2 loop is present at heavy chain amino acids 52 to 56
  • the Chothia CDR-H3 loop is present at heavy chain amino acids 95 to 102
  • the Chothia CDR-Ll loop is present at light chain amino acids 24 to 34
  • the Chothia CDR-L2 loop is present at light chain amino acids 50 to 56
  • the Chothia CDR-L3 loop is present at light chain amino acids 89 to 97.
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the CDRs of an antibody or antigen-binding fragment thereof can be determined according to the IMGT numbering system as described in Lefranc M-P, (1999) The Immunologist 7: 132-136 and Lefranc M-P et al, (1999) Nucleic Acids Res 27: 209-212.
  • VH-CDR1 is at positions 26 to 35
  • VH-CDR2 is at positions 51 to 57
  • VH-CDR3 is at positions 93 to 102
  • VL-CDRl is at positions 27 to 32
  • VL-CDR2 is at positions 50 to 52
  • VL-CDR3 is at positions 89 to 97.
  • the CDRs of an antibody or antigen-binding fragment thereof can be determined according to MacCallum RM et al, (1996) J Mol Biol 262: 732-745. See also, e.g., Martin A. "Protein Sequence and Structure Analysis of Antibody Variable Domains," in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer- Verlag, Berlin (2001).
  • the CDRs of an antibody or antigen-binding fragment thereof can be determined according to the AbM numbering scheme, which refers AbM hypervariable regions which represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software (Oxford Molecular Group, Inc.).
  • human antibody means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art.
  • This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
  • chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
  • the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g. mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies derived from another (usually human) to avoid eliciting an immune response in that species.
  • epitopes or "antigenic determinant” are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
  • the antigen is a polypeptide
  • epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
  • Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
  • a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present disclosure. Specific illustrative embodiments are described in the following.
  • binding affinity refers to a stronger binding between a molecule and its binding partner.
  • Or better when used herein refers to a stronger binding, represented by a smaller numerical Kd value.
  • an antibody which has an affinity for an antigen of "0.6 nM or better” the antibody's affinity for the antigen is ⁇ 0.6 nM, i.e. 0.59 nM, 0.58 nM, 0.57 nM etc. or any value less than 0.6 nM.
  • an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind” to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope.
  • the term “specificity” is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope.
  • antibody “A” may be deemed to have a higher specificity for a given epitope than antibody "B,” or antibody “A” may be said to bind to epitope “C” with a higher specificity than it has for related epitope “D.”
  • preferentially binds it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope.
  • an antibody which "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
  • An antibody is said to "competitively inhibit" binding of a reference antibody to a given epitope if the antibody preferentially binds to that epitope or an overlapping epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope.
  • Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays.
  • An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
  • the phrase "substantially similar,” or “substantially the same”, as used herein, denotes a sufficiently high degree of similarity between two numeric values (generally one associated with an antibody of the disclosure and the other associated with a reference/comparator antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values (e.g., Kd values).
  • the difference between said two values can be less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% as a function of the value for the reference/comparator antibody.
  • isolated is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature.
  • Isolated polypeptides, antibodies, polynucleotides, vectors, cell or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
  • antibody refers an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
  • a target such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
  • antibody encompasses intact polyclonal antibodies, intact monoclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antibody, and any other modified immunoglobulin molecule so long as the antibodies exhibit the desired biological activity.
  • An antibody can be of any the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g. IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
  • the different classes of immunoglobulins have different and well known subunit structures and three- dimensional configurations.
  • Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
  • the term "antibody" encompasses bispecific and multispecific antibodies.
  • antibody fragment refers to a portion of an intact antibody.
  • An "antigen- binding fragment” refers to a portion of an intact antibody that binds to an antigen.
  • An antigen-binding fragment can contain the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, and single chain antibodies.
  • An "antigen-binding fragment” can be a bispecific or multispecific antigen-binding fragment.
  • drug delivery agent refers to a chemical moiety that alters the distribution, targeting, or lifetime of the molecule into which it is incorporated.
  • a drug delivery agent provides an enhanced affinity for a selected target, e.g., molecule, cell or cell type, compartment, receptor e.g., a cellular or organ compartment, tissue, organ or region of the body, as compared to a species absent such a drug delivery agent.
  • Drug delivery agents providing enhanced affinity for a selected target are termed targeting drug delivery agents. See, e.g., WO 2013/075035 Al. All patents, patent applications, and publications cited herein are fully incorporated by reference in their entirety.
  • drug delivery conjugate refers to a compound comprising any one of Formula (XX)-(XXIX), a drug delivery agent and, optionally, a covalent linker.
  • Some drug delivery agents have endosomolytic properties. Endosomolytic drug delivery agents promote the lysis of the endosome and/or transport of any one of Formula (XX)-(XXIX), from the endosome to the cytoplasm of the cell.
  • the endosomolytic drug delivery agent may be a polyanionic peptide or peptidomimetic which shows pH- dependent membrane activity and fusogenicity. In one embodiment, the endosomolytic drug delivery agent assumes its active conformation at endosomal pH.
  • the "active" conformation is that conformation in which the endosomolytic drug delivery agent promotes lysis of the endosome and/or transport of Formula (XX)-(XXIX) from the endosome to the cytoplasm of the cell.
  • exemplary endosomolytic drug delivery agents include the GALA peptide (Subbarao et al., Biochemistry, 1987, 26: 2964-2972), the EALA peptide (Vogel et al., J. Am. Chem. Soc, 1996, 118: 1581-1586), and their derivatives (Turk et al., Biochem. Biophys. Acta, 2002, 1559: 56-68).
  • the endosomolytic component may contain a chemical group, e.g., an amino acid, which will undergo a change in charge or protonation in response to a change in pH.
  • the endosomolytic component may be linear or branched.
  • Drug delivery agents can improve transport, hybridization, and specificity properties of the resultant drug delivery conjugate.
  • Drug delivery agents can include therapeutic modifiers, e.g., for enhancing uptake; diagnostic compounds or reporter groups e.g., for monitoring distribution; and cross-linking agents.
  • therapeutic modifiers e.g., for enhancing uptake
  • diagnostic compounds or reporter groups e.g., for monitoring distribution
  • cross-linking agents lipids, steroids, vitamins, carbohydrates, proteins, peptides, polyamines, synthetic polymers or oligomers (such as PEG's), peptidomimetics, or any combinations thereof.
  • Drug delivery agents can include a naturally occurring substance, such as a protein, e.g., human serum albumin (HSA), low-density lipoprotein (LDL), high-density lipoprotein (HDL), or globulin; a carbohydrate, e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid; or a lipid.
  • a protein e.g., human serum albumin (HSA), low-density lipoprotein (LDL), high-density lipoprotein (HDL), or globulin
  • a carbohydrate e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid
  • a lipid e.g., a naturally occurring substance, such as a protein, e.g., human serum album
  • the drug delivery agent may also be a recombinant or synthetic molecule, such as a synthetic polymer or oligomer, e.g., a synthetic polyamino acid, an oligonucleotide, e.g., an aptamer.
  • a synthetic polymer or oligomer e.g., a synthetic polyamino acid, an oligonucleotide, e.g., an aptamer.
  • polyamino acids include a polylysine (PLL), poly L-aspartic acid, poly L-glutamic acid.
  • synthetic polymers or oligomers include styrene-maleic acid anhydride copolymer, poly(L-lactide-co- glycolied) copolymer, divinyl ether-maleic anhydride copolymer, N-(2- hydroxypropyl)methacrylamide copolymer (HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA), polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide polymers, or polyphosphazine.
  • HMPA N-(2- hydroxypropyl)methacrylamide copolymer
  • PEG polyethylene glycol
  • PVA polyvinyl alcohol
  • polyurethane poly(2-ethylacryllic acid)
  • N-isopropylacrylamide polymers or polyphosphazine.
  • polyamines include: polyethylenimine, polylysine (PLL), spermine, spermidine, polyamine, pseudopeptide-polyamine, peptidomimetic polyamine, dendrimer polyamine, arginine, amidine, protamine, cationic lipid, cationic porphyrin, quaternary salt of a polyamine, or an alpha helical peptide.
  • Drug delivery agents can also include targeting groups, e.g., a cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type .
  • a cell or tissue targeting agent e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type .
  • a targeting group can be a thyrotropin, melanotropin, lectin, glycoprotein, surfactant protein A, Mucin carbohydrate, multivalent lactose, multivalent galactose, N- acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, glycosylated polyaminoacids, multivalent galactose, transferrin, bisphosphonate, polyglutamate, polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate, vitamin B 12, biotin, an RGD peptide, an RGD peptide mimetic or an aptamer.
  • drug delivery agents include dyes, intercalating agents (e.g., acridines), cross-linkers (e.g., psoralene, mitomycin C), porphyrins (TPPC4, texaphyrin, Sapphyrin), polycyclic aromatic hydrocarbons (e.g., phenazine, dihydrophenazine), artificial endonucl eases or a chelator (e.g., EDTA), lipophilic molecules, e.g., cholesterol, cholic acid, adamantane acetic acid, 1-pyrene butyric acid, dihydrotestosterone, 1,3 -Bis- 0(hexadecyl)glycerol, geranyloxyhexyl group, hexadecylglycerol, borneol, menthol, 1,3- propanediol, heptadecyl group, palmitic acid, myristic acid,
  • intercalating agents
  • Drug delivery agents may also include hormones and hormone receptors. They can also include non-peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, or aptamers.
  • the drug delivery agent can be, for example, a lipopolysaccharide, an activator of p38 MAP kinase, or an activator of NF-KB.
  • the drug delivery agent can be a substance, which can increase the uptake of any one of Formula (XX)-(XXIX)into the cell, for example, by disrupting the cell's cytoskeleton, e.g., by disrupting the cell's microtubules, microfilaments, and/or intermediate filaments.
  • the drug delivery agent can increase the uptake of any one of
  • exemplary drug delivery agents that would have such an effect include tumor necrosis factor alpha (TNFalpha), interleukin- 1 beta, or gamma interferon.
  • the drug delivery agent is a lipid or lipid-based molecule.
  • a lipid or lipid-based molecule can bind a serum protein, e.g., human serum albumin (HSA).
  • HSA human serum albumin
  • An HSA binding drug delivery agent allows for distribution of the drug delivery conjugate to a target tissue, e.g. , a non-kidney target tissue of the body.
  • Other molecules that can bind HSA can also be used as drug delivery agents. For example, naproxen or aspirin can be used.
  • a lipid or lipid-based drug delivery agent can (a) increase resistance to degradation of the drug delivery conjugate, (b) increase targeting or transport into a target cell or cell membrane, and/or (c) can be used to adjust binding to a serum protein, e.g. , HSA.
  • a lipid or lipid-based drug delivery agent can also enable the formation of nanoparticles, such as micelles, which can impact the biodistribution of any one of Formula (XX)-(XXIX).
  • a lipid based drug delivery agent can be used to modulate, e.g., control the binding of the drug delivery conjugate to a target tissue.
  • a lipid or lipid-based drug delivery agent that binds to HSA more strongly will be less likely to be targeted to the kidney and therefore less likely to be cleared from the body.
  • a lipid or lipid-based drug delivery agent that binds to HSA less strongly can be used to target the conjugate to the kidney.
  • the lipid based drug delivery agent binds HSA with a sufficient affinity such that the drug delivery conjugate is distributed to a non-kidney tissue. In one embodiment, the affinity is not so strong that the HSA-drug delivery agent binding cannot be reversed.
  • the lipid based drug delivery agent binds HSA weakly or not at all, such that the drug delivery conjugate is distributed to the kidney.
  • Other moieties that target to kidney cells can also be used in place of or in addition to the lipid based drug delivery agent.
  • the drug delivery agent is a moiety, e.g., a vitamin, which is taken up by a target cell, e.g., a proliferating cell.
  • a target cell e.g., a proliferating cell.
  • vitamins include vitamin A, E, and K.
  • B vitamins e.g., folic acid, B 12, riboflavin, biotin, pyridoxal or other vitamins or nutrients taken up by cancer cells.
  • HAS low density lipoprotein
  • HDL high-density lipoprotein
  • the drug delivery agent is a cell-permeation agent, e.g., a helical cell-permeation agent.
  • the agent is amphipathic.
  • Exemplary amphipathic agents include a peptide such as tat or antennopedia, and a lipid-PEG conjugate. If the agent is a peptide, it can be modified, including a peptidylmimetic, invertomers, non- peptide or pseudo-peptide linkages, and use of D-amino acids.
  • the helical agent is an alpha-helical agent having a lipophilic and a lipophobic phase.
  • the drug delivery agent can be a peptide or peptidomimetic.
  • a peptidomimetic also referred to herein as an oligopeptidomimetic is a molecule capable of folding into a defined three-dimensional structure similar to a natural peptide.
  • the peptide or peptidomimetic moiety can be about 5-50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
  • a peptide or peptidomimetic can be, for example, a cell permeation peptide, cationic peptide, amphipathic peptide, or hydrophobic peptide (e.g. , consisting primarily of Tyr, Trp or Phe).
  • the peptide moiety can be a dendrimer peptide, constrained peptide or crosslinked peptide.
  • the peptide moiety can include a hydrophobic membrane translocation sequence (MTS).
  • An exemplary hydrophobic MTS- containing peptide is RFGF.
  • An RFGF analogue containing a hydrophobic MTS can also be a targeting moiety.
  • the peptide moiety can be a "delivery" peptide, which can carry large polar molecules including peptides, oligonucleotides, and protein across cell membranes. For example, certain sequences from the HIV Tat protein and the Drosophila Antennapedia have been found to be capable of functioning as delivery peptides.
  • a peptide or peptidomimetic can be encoded by a random sequence of DNA, such as a peptide identified from a phage- display library, or one-bead-one-compound (OBOC) combinatorial library (Lam et ah, Nature, 354:82-84, 1991).
  • the peptide or peptidomimetic is a cell targeting peptide such as an arginine-glycine-aspartic acid (RGD)-peptide, or RGD mimic.
  • RGD arginine-glycine-aspartic acid
  • a peptide moiety can range in length from about 5 amino acids to about 40 amino acids.
  • the peptide moieties can have a structural modification, such as to increase stability or direct conformational properties. Any of the structural modifications described below can be utilized.
  • An RGD peptide moiety can be used to target a tumor cell, such as an endothelial tumor cell or a breast cancer tumor cell (Zitzmann et ah, Cancer Res., 62:5139-43, 2002).
  • An RGD peptide can facilitate targeting of any one of Formula (XX)-(XXIX)to tumors of a variety of other tissues, including the lung, kidney, spleen, or liver (Aoki et ah, Cancer Gene Therapy 8:783-787, 2001).
  • the RGD peptide will facilitate targeting of a drug delivery conjugate to the kidney.
  • the RGD peptide can be linear or cyclic, and can be modified, e.g., glycosylated or methylated to facilitate targeting to specific tissues.
  • a glycosylated RGD peptide can deliver a drug delivery conjugate to a tumor cell expressing civB3 (Haubner et ah, Jour. Nucl. Med., 42:326-336, 2001).
  • Peptides that target markers enriched in proliferating cells can be used.
  • RGD containing peptides and peptidomimetic s can target cancer cells, in particular cells that exhibit an integrin.
  • RGD peptides cyclic peptides containing RGD, RGD peptides that include D- amino acids, as well as synthetic RGD mimics.
  • RGD one can use other moieties that target the integrin drug delivery agent.
  • drug delivery agents can be used to control proliferating cells and angiogeneis.
  • Preferred conjugates of this type of drug delivery agent target PECAM-1, VEGF, or other cancer gene, e.g., a cancer gene described herein.
  • a "cell permeation peptide” is capable of permeating a cell, e.g., a mammalian cell, such as a human cell.
  • a cell permeation peptide can include a RALA peptide. (Molecular Therapy: Nucleic Acids, 2017, 6, 249-258; J Control Release. 2014, 189: 141-9; and Nanomedicine (Lond). 2015, 10(19): 2989-3001).
  • a cell permeation peptide can also include a nuclear localization signal (NLS).
  • a cell permeation peptide can be a bipartite amphipathic peptide, such as MPG, which is derived from the fusion peptide domain of FflV-1 gp41 and the NLS of SV40 large T antigen (Simeoni et al, Nucl. Acids Res. 31 :2717-2724, 2003).
  • a cell permeation peptide may form a nano particle.
  • a targeting peptide can be an amphipathic a-helical peptide.
  • amphipathic a-helical peptides include, but are not limited to, cecropins, lycotoxins, paradaxins, buforin, CPF, bombinin-like peptide (BLP), cathelicidins, ceratotoxins, S. clava peptides, hagfish intestinal antimicrobial peptides (HFIAPs), magainines, brevinins-2, dermaseptins, melittins, pleurocidin, H2A peptides, Xenopus peptides, esculentinis- 1, and caerins.
  • a number of factors will preferably be considered to maintain the integrity of helix stability.
  • helix stabilization residues e.g., leu, ala, or lys
  • a minimum number helix destabilization residues will be utilized (e.g. , proline, or cyclic monomeric units.
  • the capping residue will be considered (for example Gly is an exemplary N-capping residue and/or C-terminal amidation can be used to provide an extra H-bond to stabilize the helix.
  • Formation of salt bridges between residues with opposite charges, separated by i + 3, or i + 4 positions can provide stability.
  • cationic residues such as lysine, arginine, homo- arginine, ornithine or histidine can form salt bridges with the anionic residues glutamate or aspartate.
  • Peptide and peptidomimetic drug delivery agents include those having naturally occurring or modified peptides, e.g., D or L peptides; ⁇ , ⁇ , or ⁇ peptides; N-methyl peptides; azapeptides; peptides having one or more amide, i.e. , peptide, linkages replaced with one or more urea, thiourea, carbamate, or sulfonyl urea linkages; or cyclic peptides.
  • D or L peptides e.g., D or L peptides
  • ⁇ , ⁇ , or ⁇ peptides N-methyl peptides
  • azapeptides peptides having one or more amide, i.e. , peptide, linkages replaced with one or more urea, thiourea, carbamate, or sulfonyl urea linkages
  • cyclic peptides e.g.
  • the targeting drug delivery agent can be any drug delivery agent that is capable of targeting a specific receptor. Examples are: folate, GalNAc, galactose, mannose, mannose- 6P, clusters of sugars such as GalNAc cluster, mannose cluster, galactose cluster, or an apatamer. A cluster is a combination of two or more sugar units.
  • the targeting drug delivery agents also include integrin receptor drug delivery agents, Chemokine receptor drug delivery agents, transferrin, biotin, serotonin receptor drug delivery agents, PSMA, endothelin, GCPII, somatostatin, LDL and HDL drug delivery agents.
  • the drug delivery agents can also be based on nucleic acid, e.g., an aptamer.
  • the aptamer can be unmodified or have any combination of modifications disclosed herein.
  • Endosomal release agents include imidazoles, poly or oligoimidazoles, PEIs, peptides, fusogenic peptides, polycaboxylates, polyacations, masked oligo or poly cations or anions, acetals, polyacetals, ketals/polyketyals, orthoesters, polymers with masked or unmasked cationic or anionic charges, dendrimers with masked or unmasked cationic or anionic charges.
  • Drug delivery agent can be a PK modulator (pharmacokinetic modulator).
  • PK modulators include lipophiles, bile acids, steroids, phospholipid analogues, peptides, protein binding agents, PEG, vitamins etc.
  • Exemplary PK modulators include, but are not limited to, cholesterol, fatty acids, cholic acid, lithocholic acid, dialkylglycerides, diacylglyceride, phospholipids, sphingolipids, naproxen, ibuprofen, vitamin E, biotin etc.
  • Oligonucleotides that comprise a number of phosphorothioate linkages are also known to bind to serum protein, thus short oligonucleotides, e.g., oligonucleotides of about 5 bases, 10 bases, 15 bases or 20 bases, comprising multiple phosphorothioate linkages in the backbaone are also amenable to the present invention as drug delivery agents (e.g., as PK modulating drug delivery agents).
  • aptamers that bind serum components are also amenable to the present disclosure as PK modulating drug delivery agents.
  • the drug delivery agent comprises a combination of two or more moieties, e.g., a lipid and a carbohydrate, e.g., a lipid and a peptide
  • the two or more moieties can all have the same properties, all have different properties, or some moieties have the same properties while others have different properties.
  • a drug delivery agent can have targeting properties, endosomolytic activity, and/or PK modulating properties.
  • one moiety of a drug delivery agent can be hydrophilic, and another can be hydrophobic.
  • the moieties have different properties.
  • the partial structure [0199] in one embodiment, the partial structure:
  • the partial structure [0200] in another embodiment, the partial structure:
  • the partial structure [0205] in another embodiment, the partial structure:
  • the partial structure [0206] in another embodiment, the partial structure:
  • R 1 and R 2 are each independently a hydroxy group or a halogen atom.
  • R 1 and R 2 are each independently a hydroxy group or a fluorine atom.
  • R 1 is a hydroxy group.
  • R 2 is a hydroxy group or a fluorine atom.
  • B 1 is a group represented by
  • R 13 , R 14 , R 15 , R 16 and R 17 are each independently a hydrog atom or a substituent.
  • Y 11 , Y 12 , Y 13 , Y 14 , Y 15 and Y 16 are each independently N
  • Z 11 , Z 12 , Z 13 , Z 14 , Z 15 and Z 16 are each independently N or C.
  • R la is a hydrogen atom or a substituent.
  • R 13 is a hydrogen atom.
  • R 14 is a hydrogen atom or an optionally substituted amino group
  • R 14 is a hydrogen atom or an amino group.
  • R 14 is a hydrogen atom.
  • R 15 is preferably a hydrogen atom.
  • R 13 and R 15 are both hydrogen atoms, and R 14 is a hydrogen atom or an optionally substituted amino group (particularly a hydrogen atom or an amino group).
  • R 13 , R 14 and R 15 are all hydrogen atoms.
  • R 16 is a hydrogen atom.
  • R 17 is a hydrogen atom.
  • Y 11 is N.
  • Y 12 is N or CH
  • Y 12 is N.
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom).
  • Y 13 is N or CF.
  • Y 13 is CF.
  • Y 11 is N
  • Y 12 is N or CH
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom).
  • Y 11 is N
  • Y 12 is N or CH
  • Y 13 is N or CF.
  • Y 11 is N, Y 12 is N, and Y 13 is CF, Y 11 is N, Y 12 is N, and Y 13 is N, or Y 11 is N, Y 12 is CH, and Y 13 is N.
  • Y 11 is N
  • Y 12 is N
  • Y 13 is CF
  • Y 14 is N.
  • Y 15 is N.
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom).
  • R la is a halogen atom (e.g., a fluorine atom).
  • Y 16 is N or CF.
  • Y 16 is N.
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom).
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N or CF.
  • Y 14 is N, Y 15 is N, and Y 16 is N, or Y 14 is N, Y 15 is N, and
  • Y 16 is CF.
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N
  • Z 11 is C.
  • Z 12 is C.
  • Z 13 is N.
  • Z 11 is C
  • Z 12 is C
  • Z 13 is N
  • Z 14 is preferably C.
  • Z 15 is preferably C.
  • Z 16 is preferably N.
  • Z 14 is C
  • Z 15 is C
  • Z 16 is N
  • R , R , R , R and R are each independently a hydrogen atom or a substituent.
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 are each independently N or CR 2a .
  • Z 21 , Z 22 , Z 23 , Z 24 , Z 25 and Z 26 are each independently N or C.
  • R 2a is a hydrogen atom or a substituent.
  • R 23 is a hydrogen atom.
  • R 24 is a hydrogen atom or an optionally substituted amino group.
  • R 24 is a hydrogen atom or an amino group.
  • R 24 is a hydrogen atom.
  • R 25 is a hydrogen atom.
  • R 26 is a hydrogen atom.
  • R 27 is a hydrogen atom.
  • Y 21 is N.
  • Y 22 is N.
  • Y 23 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom).
  • Y 23 is N or CF.
  • Y 23 is CF.
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom).
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CF.
  • Y 21 is N
  • Y 22 is N
  • Y 23 is CF
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N.
  • Y 21 is N
  • Y 22 is N
  • Y 23 is CF
  • Y 24 is N.
  • Y 25 is N or CH.
  • Y 25 is N.
  • Y 26 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom).
  • Y 26 is N or CF.
  • Y 26 is N.
  • Y 24 is N
  • Y 25 is N or CH
  • Y 26 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom).
  • Y 24 is N
  • Y 25 is N or CH
  • Y 26 is N or CF.
  • Y 24 is N, Y 25 is N, and Y 26 is N; Y 24 is N, Y 25 is N, and Y 26 is
  • Y 24 is N, Y 25 is CH, and Y 26 is N.
  • Y 24 is N, Y 25 is N, and Y 26 is N.
  • Z 21 is N or C
  • Z 23 is N or C.
  • Z 23 is N.
  • Z 21 is N or C
  • Z 22 is C
  • Z 23 is N or C
  • Z 21 is C
  • Z 22 is C
  • Z 23 is N
  • Z 21 is N
  • Z 22 is C
  • Z : is C
  • Z 21 is C
  • Z 22 is C
  • Z 23 is N.
  • Z 24 is N or C.
  • Z 24 is C.
  • Z 25 is C.
  • Z 26 is N or C.
  • Z 26 is N.
  • Z 24 is N or C
  • Z 25 is C
  • Z 26 is N or C
  • Z 24 is C, Z 25 is C, and Z 26 is N, or Z 24 is N, Z 25 is C, and Z
  • Z is C
  • Z is C
  • Z is N
  • B 1 and B 2 are each independently
  • At least one of B 1 and B 2 is
  • B 1 is
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are each independently an oxygen atom or a sulfur atom.
  • X 1 and X 2 are both oxygen atoms.
  • Q 1 , Q 2 , Q 3 and Q 4 are each independently an oxygen atom or a sulfur atom.
  • Q 1 is an oxygen atom.
  • Q 3 is an oxygen atom.
  • Q 1 and Q 3 are both oxygen atoms
  • Q 2 and Q 4 are each independently an oxygen atom or a sulfur atom.
  • Q 1 is an oxygen atom
  • Q 2 is an oxygen atom or a sulfur atom
  • Q 3 is an oxygen atom
  • Q 4 is an oxygen atom or a sulfur atom
  • Q 1 is an oxygen atom
  • Q 2 is a sulfur atom
  • Q 3 is an oxygen atom
  • Q 4 is a sulfur atom
  • Compound (I) is a compound represented by the formula (la):
  • compound (la) a salt thereof (hereinafter sometimes to be referred to as compound (la)).
  • Compound (I) is a compound represented by formula (lb):
  • Examples of compound (I) include the following compounds.
  • Compound Al is a compound having formula I , wherein the partial structure:
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
  • B 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an optionally substituted amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y 12 is N or CH
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Y 15 is N
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Z 11 is C
  • Z 12 is C
  • Z 13 is N
  • Z 14 is C
  • Z 15 is C
  • Z 16 is N
  • R is a hydrogen atom
  • R 24 is a hydrogen atom
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • ⁇ 21 is N
  • ⁇ 22 is N
  • ⁇ 23 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • ⁇ 24 is N
  • ⁇ 25 is N or CH
  • ⁇ 26 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • ⁇ 21 is N or C
  • ⁇ 22 is C
  • ⁇ 23 is N or C
  • ⁇ 24 is N or C
  • ⁇ 25 is C
  • ⁇ 26 is N or C
  • At least one of Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or in) at least one of Z 13 , Z 16 , Z 23 and Z 26 is C;
  • X 1 and X 2 are each independently an oxygen atom or a sulfur atom
  • Q 1 , Q 2 , Q 3 and Q 4 are each independently an oxygen atom or a sulfur atom.
  • Compound Bl is a compound having formula (I), wherein
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a fluorine atom
  • B 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an amino group
  • R 1 * is a hydrogen atom
  • R is a hydrogen atom
  • R is a hydrogen atom
  • Y is N
  • Y is N or CH
  • Y 11 is N, Y 12 is N, and Y 13 is CF; Y 11 is N, Y 12 is N, and Y 13 is N; or Y 11 is N,
  • Y 12 is CH, and Y 1J is N);
  • Y 14 is N
  • Y 15 is N
  • Y is N or CF
  • Y 14 is N, Y 15 is N, and Y 16 is N; or Y 14 is N, Y 15 is N, and Y 16 is CF;
  • Z 15 is C
  • Z 16 is N
  • R is a hydrogen atom
  • R 24 is a hydrogen atom
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CF
  • Y 21 is N, Y 22 is N, and Y 23 is CF; or Y 21 is N, Y 22 is N, and Y 23 is N);
  • Y 24 is N
  • Y 25 is N or CH
  • Y 26 is N or CF
  • Y 24 is N, Y 25 is N, and Y 26 is N; Y 24 is N, Y 25 is N, and Y 26 is CF; or Y 24 is N,
  • Y 25 is CH, and Y 26 is N);
  • Z 21 is N or C
  • Z 23 is N or C
  • Z 24 is N or C
  • Z 25 is C
  • Z 26 is N or C; [0402] (e.g., Z 24 is C, Z 25 is C, and Z 26 is N; or Z 24 is N, Z 25 is C, and Z : provided that
  • X 1 and X 2 are both oxygen atoms
  • Q 1 is an oxygen atom
  • Q 2 is an oxygen atom or a sulfur atom
  • Q 3 is an oxygen atom
  • Q 4 is an oxygen atom or a sulfur atom.
  • Compound Al-a is a compound having formula (la) wherein
  • R 1 is a hydroxy group
  • R is a hydroxy group or a halogen atom (preferably a fluorine atom);
  • B 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an optionally substituted amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y 12 is N or CH
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Z 11 is C
  • Z 12 is C
  • Z 13 is N
  • Z 16 is N
  • R is a hydrogen atom
  • R 24 is a hydrogen atom
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • ⁇ 21 is N
  • ⁇ 22 is N
  • ⁇ 23 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • ⁇ 24 is N
  • ⁇ 25 is N or CH
  • ⁇ 26 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • ⁇ 21 is N or C
  • ⁇ 23 is N or C
  • ⁇ 24 is N or C
  • ⁇ 25 is C
  • ⁇ 26 is N or C
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are each independently an oxygen atom or a sulfur atom
  • Q 1 , Q 2 , Q 3 an d Q 4 are each independently an oxygen atom or a sulfur atom.
  • Compound Bl-a is a compound having formula (la) wherein the partial structure:
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a fluorine atom
  • [0454] 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y 11 is N
  • Y 12 is N or CH
  • Y 13 is N or CF
  • Y 11 is N, Y 12 is N, and Y 13 is CF; Y 11 is N, Y 12 is N, and Y 13 is N; or Y 11 is N, ⁇ 12 is CH, and Y 13 is N);
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N or CF
  • Y 14 is N, Y 15 is N, and Y 16 is N; or Y 14 is N, Y 15 is N, and Y 16 is CF;
  • Z 11 is C
  • Z 12 is C
  • Z 13 is N; [0471] Z 14 is C;
  • Z 15 is C
  • Z 16 is N
  • R is a hydrogen atom
  • R 24 is a hydrogen atom
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 2 ' is a hydrogen atom
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CF
  • Y 24 is N
  • Y 25 is N or CH
  • Y 26 is N or CF
  • Y 24 is N, Y 25 is N, and Y 26 is N; Y 24 is N, Y 25 is N, and Y 26 is CF; or Y 24 is N,
  • Y 25 is CH, and Y 26 is N);
  • Z 21 is N or C
  • Z 22 is C
  • Z 23 is N or C
  • Z 24 is N or C
  • Z 25 is C
  • Z 26 is N or C; [0495] (e.g., Z 24 is C, Z 25 is C, and Z 26 is N, or Z 24 is N, Z 25 is C, and Z 26 is C);
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are both oxygen atoms
  • Q 1 is an oxygen atom
  • Q 2 is an oxygen atom or a sulfur atom
  • Q 3 is an oxygen atom
  • Q 4 is an oxygen atom or a sulfur atom.
  • Compound Al-b is a compound having formula lb) wherein the partial structure:
  • [0502] is a partial structure represented b the formula (DAb):
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
  • B 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an optionally substituted amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y 12 is N or CH
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Y 15 is N
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Z 13 is N
  • Z 15 is C
  • Z 16 is N
  • R is a hydrogen atom
  • R 24 is a hydrogen atom
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • ⁇ 21 is N
  • ⁇ 22 is N
  • ⁇ 23 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • ⁇ 24 is N
  • ⁇ 25 is N or CH
  • ⁇ 26 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • ⁇ 21 is N or C
  • ⁇ 23 is N or C
  • ⁇ 24 is N or C
  • ⁇ 25 is C
  • ⁇ 26 is N or C
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are each independently an oxygen atom or a sulfur atom
  • Q 1 , Q 2 , Q 3 an d Q 4 are each independently an oxygen atom or a sulfur atom.
  • Compound Bl-b is a compound having formula (lb) wherein the partial structure:
  • [0544] is a partial structure represented by the formula (DAb):
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a fluorine atom
  • [0547] 1 is a group represented by
  • R 1 is a hydrogen atom
  • R 14 is a hydrogen atom or an amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y 11 is N
  • Y 12 is N or CH
  • Y 13 is N or CF
  • Y 11 is N, Y 12 is N, and Y 13 is CF; Y 11 is N, Y 12 is N, and Y 13 is N; or Y 11 is N, ⁇ 12 is CH, and Y 13 is N);
  • Y 15 is N
  • Y 16 is N or CF
  • Y 14 is N, Y 15 is N, and Y 16 is N; or Y 14 is N, Y 15 is N, and Y 16 is CF;
  • Z 11 is C
  • Z 12 is C
  • Z 15 is C
  • Z 16 is N
  • [0567] 2 is a group represented by
  • R J is a hydrogen atom
  • R 24 is a hydrogen atom
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CF
  • Y 25 is N or CH
  • Y 26 is N or CF
  • Y 24 is N, Y 25 is N, and Y 26 is N; Y 24 is N, Y 25 is N, and Y 26 is CF, or Y 24 is N,
  • Y 25 is CH, and Y 26 is N);
  • Z 21 is N or C
  • Z 22 is C
  • Z 23 is N or C
  • Z 24 is N or C
  • Z 25 is C
  • Z 26 is N or C; [0588] (e.g., Z 24 is C, Z 25 is C, and Z 26 is N; or Z 24 is N, Z 25 is C, and Z 26 is C);
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are both oxygen atoms
  • Q 1 is an oxygen atom
  • Q is an oxygen atom or a sulfur atom
  • Q is an oxygen atom
  • Q 4 is an oxygen atom or a sulfur atom.
  • Compound A2 is a compound having formula (I) wherein the partial structure:
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
  • [0599] 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an optionally substituted amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y n is N
  • Y 12 is N or CH
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Y 15 is N
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Z 11 is C
  • Z 12 is C
  • Z 13 is N
  • Z 16 is N
  • B 2 is a group represented by
  • R is a hydrogen atom
  • R is a hydrogen atom or an optionally substituted amino group
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • Y 24 is N
  • Y 25 is N or CH
  • Y 26 is N or CR 2a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • Z 21 is N or C
  • Z 23 is N or C
  • Z 24 is N or C
  • Z 25 is C
  • Z 26 is N or C
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are each independently an oxygen atom or a sulfur atom
  • Q 1 , Q 2 , Q 3 and Q 4 are each independently an oxygen atom or a sulfur atom.
  • Compound B2 is a compound having formula (I) wherein the partial structure:
  • R 1 is a hydroxy group
  • R is a hydroxy group or a fluorine atom
  • [0642] 1 is a group represented by
  • R is a hydrogen atom
  • R 14 is a hydrogen atom or an amino group
  • R 15 is a hydrogen atom
  • R 16 is a hydrogen atom
  • R 17 is a hydrogen atom
  • Y n is N
  • Y 12 is N or CH
  • Y 13 is N or CF
  • Y 11 is N, Y 12 is N, and Y 13 is CF; Y 11 is N, Y 12 is N, and Y 13 is N; or Y 11 is N,
  • Y 12 is CH, and Y 13 is N);
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N or CF
  • Y 14 is N, Y 15 is N, and Y 16 is N; or Y 14 is N, Y 15 is N, and Y 16 is CF;
  • Z 16 is N
  • [0661] 2 is a group represented by
  • R is a hydrogen atom
  • R 24 is a hydrogen atom or an amino group
  • [0664] is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • Y 21 is N
  • Y 22 is N
  • Y 23 is N or CF
  • Y 21 is N, Y 22 is N, and Y 23 is CF; or Y 21 is N, Y 22 is N, and Y 23 is N);
  • Y 24 is N;
  • Y 25 is N or CH
  • Y 26 is N or CF
  • Y 24 is N, Y 25 is N, and Y 26 is N; Y 24 is N, Y 25 is N, and Y 26 is CF, or Y 24 is
  • Y 25 is CH, and Y 26 is N);
  • Z 21 is N or C
  • Z 23 is N or C
  • Z 24 is N or C
  • Z 25 is C
  • Z 26 is N or C
  • Y 21 , Y 22 , Y 23 , Y 24 , Y 25 and Y 26 is CR 2a , or
  • X 1 and X 2 are both oxygen atoms
  • Q 1 is an oxygen atom
  • Q 2 is an oxygen atom or a sulfur atom
  • Q 3 is an oxygen atom
  • Q 4 is an oxygen atom or a sulfur atom.
  • Compound A2-a is a compound having formula (la) wherein the partial structure:
  • R 1 is a hydroxy group
  • R 2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
  • B 1 is a group represented by
  • R 13 is a hydrogen atom
  • R is a hydrogen atom or an optionally substituted amino group
  • R 13 is a hydrogen atom
  • R is a hydrogen atom
  • R is a hydrogen atom
  • Y 12 is N or CH
  • Y 13 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom);
  • Y 14 is N
  • Y 15 is N
  • Y 16 is N or CR la wherein R la is a halogen atom (e.g., a fluorine atom); [0705] Z 11 is C;
  • Z 12 is C
  • Z 16 is N
  • [0711] 2 is a group represented by
  • [0712] is a hydrogen atom
  • R 24 is a hydrogen atom or an optionally substituted amino group
  • R 25 is a hydrogen atom
  • R 26 is a hydrogen atom
  • R 27 is a hydrogen atom
  • ⁇ 21 is N
  • Y 2 is N
  • Y 23 is N or CR a wherein R 2a is a halogen atom (e.g., a fluorine atom);
  • Y 24 is N
  • Y 25 is N or CH
  • ⁇ 26 is N or CR a wherein R a is a halogen atom (e.g., a fluorine atom);
  • z 21 is N or C
  • z 23 is N or C
  • z 24 is N or C
  • z 26 is N or C
  • Y 11 , Y 12 , Y 13 , Y 14 , Y 15 and Y 16 is CR la

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Saccharide Compounds (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present disclosure provides a compound having a STING agonistic activity, which may be expected to be useful as an agent for the prophylaxis or treatment of STING-related diseases. The present disclosure relates to a compound represented by the formula (I), wherein each symbol is as defined in the description, or a salt thereof.

Description

CYCLIC DINUCLEOTIDE
TECHNICAL FIELD
[0001] The present disclosure provides a cyclic dinucleotide having a STING (stimulator of interferon genes) agonistic activity, which may be useful as an agent for the prophylaxis or treatment of cancer and other diseases.
BACKGROUND OF THE INVENTION
[0002] STING is a receptor recognizing nucleic acid different from TLR (toll-like receptor).
Examples of the natural ligand to be recognized include bacteria/protozoa-derived cyclic dinucleotides (CDNs), 2',3'-cGAMP synthesized by the upstream cGAS (cyclic GMP-AMP synthase), and the like (Trends in Immunology 35:88-93 (2014)). It is reported that 2',3'-cGAMP, which is one of natural ligands, is decomposed by ENPPl (ecto-nucleotide-pyrophosphatase/phosphodiesterase), which is one of pyrophosphatases/phosphodiesterases, and that the other CDNs are decomposed by phosphodiesterase (Nat Chem Biol 70: 1043-1048 (2014); Cell Res 25:539-550 (2015); Biochemistry 55:837-849 (2016)). STING is activated by these natural ligands, and induces the phosphorylation of TBK1 (TANK binding kinase 1) in the downstream, and activates IRF3 (Interferon regulatory factor 3) signal and NFkB signal in the further downstream, and thereby type-I interferon (IFN) response is induced (Trends in Immunology 35:88-93 (2014)). The importance of STING signal on cancer are indicated by a test using a knockout mouse. It is reported that in tumor-allografted mice using knockout mice for STING and its downstream signal, IRF3, the cancer cells grow by suppression of cancer immune system, compared with in wild-type mouse (Immunity 41: 830-842 (2014)). In addition, it is also reported that the cancer cell growth in a tumor-allografted mouse is suppressed by radiation therapy, but in knockout mice for STING and IFNARl (interferon (alpha and beta) receptor 1, receptor of type-I IFN produced by the downstream signal), the effect by the radiation therapy is reduced (Immunity 7:843-852 (2014)). For those reasons, it is considered that STING plays an important role on suppression of cancer cell growth, and the activation of the immune signal, which is induced by the activation of STING, leads to anticancer activity. Therefore, STING agonist may be used as an anticancer agent targeting cancer immunity. In addition, the activation of STING is considered to plays an important role on immune effect of vaccine, since the activation activates natural immunity (Ther Adv Vaccines 7: 131-143 (2013)). Therefore, STING agonist may be used as an adjuvant for various vaccines.
[0003] The following cyclicdinucleotides are known.
[0004] Patent Document 1 (WO 2014/093936) discloses a compound represented by the following formula:
Figure imgf000004_0001
wherein each symbol is as defined in Patent Document 1, which according to Patent Document 1 is a STING-dependent TBKl activator, and is useful for the treatment of cancer (particularly solid cancer) and the like, and also useful as an adjuvant.
[0005] Patent Document 2 (WO 2014/189805) discloses a compound represented by the following formula:
Figure imgf000004_0002
wherein each symbol is as defined in Patent Document 2,which according to Patent Document 2 is an immune stimulator via STING, and is useful for the treatment of cancer and the like.
[0006] Patent Document 3 (WO 2015/077354) and Non-Patent Document 8 (Cell reports 11,
1018-1030 (2015)) disclose a compound represented by the following formula:
Figure imgf000005_0001
wherein each symbol is as defined in Patent Document 3, which according to Patent Document 3 is a STING agonist, and is useful for the treatment of cancer and the like.
[0007] Patent Document 4 (WO 2013/185052) and Non-Patent Document 9 (Sci. Transl.
Med. 283, 283ra52 (2015)) disclose c-di-AMP, c-di-GMP, c-di-IMP, c-AMP-GMP, c- AMP- IMP and c-GMP-IMP, which according to Patent Document 4 are STING-dependent TBKl activators.
[0008] Patent Document 5 (WO 2014/189806) discloses a compound represented by the following formula:
Figure imgf000005_0002
wherein each symbol is as defined in Patent Document 5,
which according to Patent Document 5 inhibits STING-dependent signal transduction, and is useful for the treatment of autoimmune disease and the like.
[0009] Patent Document 6 (WO 2015/185565) discloses a compound represented by the following formula:
Figure imgf000006_0001
wherein each symbol is as defined in Patent Document 6, which according to Patent Document 6 is a STING modulator, and is useful for the treatment of inflammation, allergic autoimmune disease, cancer and the like, and also useful as a vaccine adjuvant.
[0010] Patent Document 7 (WO 2014/179760) discloses a compound represented by the follo ing formula:
Figure imgf000006_0002
wherein each symbol is as defined in Patent Document 7, which according to Patent Document 7 can increase Type I interferon production, and is useful for the treatment of cancer, autoimmune disease, allergic reaction and the like, and also useful as an adjuvant.
[0011] Patent Document 8 (WO 2014/179335) and Non-Patent Document 10 (Mol. Cell 154,
748-762 (2013)) disclose a compound represented by the following formula:
Figure imgf000007_0001
wherein each symbol is as defined in Patent Document 8,which according to Patent Document 8 can increases Type I interferon production, and is useful for the treatment of diseases characterized by inflammation, autoimmune disease, Sjogren's syndrome and the like.
[0012] Patent Document 9 (WO 2015/017652) discloses a compound represented by the following formula:
Figure imgf000007_0002
which according to Patent Document 9 is a STING modulator, and is useful for the treatment of cancer, autoimmune disease and the like, and also useful as a vaccine.
[0013] Patent Document 10 (WO 2016/096577) discloses a compound represented by the following formula:
Figure imgf000008_0001
which according to Patent Document 10 is a STING agonist, and is useful for the treatment of cancer (particularly solid pancreatic cancer) and the like.
[0014] Patent Document 11 (WO 2011/003025) discloses a compound represented by the following formula:
Figure imgf000008_0002
Which according to Patent Document 11 is a STING agonist.
[0015] Patent Document 12 (WO 2016/096174) discloses a compound represented by the following formula:
Figure imgf000008_0003
Formula 0)
which according to Patent Document 12 is a STING agonist.
[0016] Patent Document 13 (WO 2016/120305) discloses a compound represented by the following formula:
Figure imgf000009_0001
which according to Patent Document 13 is a STING agonist.
[0017] Patent Document 14 (WO 2016/145102) discloses a compound represented by the following formula:
Figure imgf000009_0002
wherein each symbol is as defined in Patent Document 14, which according to Patent Document 14 is a STING agonist.
[0018] Patent Document 15 (WO 2017/027646) discloses a compound represented by the following formula:
Figure imgf000009_0003
CI")
wherein each symbol is as defined in Patent Document 15, which according to Patent Document 15 is a STING agonist. [0019] Patent Document 16 WO 2017/075477) discloses a compound represented by the following formula:
Figure imgf000010_0001
wherein each symbol is as defined in Patent Document 16, which according to Patent Document 16 is a STING agonist.
[0020] Patent Document 17 (WO 2017/027645) discloses a compound represented by the following formula:
Figure imgf000010_0002
wherein each symbol is as defined in Patent Document 17, which according to Patent Document 17 is a STING agonist.
BRIEF SUMMARY OF THE INVENTION [0021] In one aspect, the disclosure provides a compound represented by the formula (I):
Figure imgf000010_0003
wherein:
[0022] the partial structure represented by formula (A-1):
Figure imgf000011_0001
1),
[0023] is a partial structure represented b formula (IIA):
Figure imgf000011_0002
[0024] a partial structure represented by formula (IIB):
Figure imgf000011_0003
[0025] R1 and R2 are each independently a hydroxy group or a halogen atom
[0026] B1 is a group represented by
Figure imgf000011_0004
[0027] R13, R14, R15, R16 and R17 are each independently a hydrogen atom or a substituent;
[0028] Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
[0029] Zn, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
[0030] Rla is a hydrogen atom or a substituent;
[0031] B2 is a group represented by
Figure imgf000012_0001
[0032] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[0033] Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
[0034] Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
[0035] R2a is a hydrogen atom or a substituent;
provided that
i) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
13 16 23 26 1 2
iii) at least one of Z , Z , Z and Z is C;X and X are each independently an oxygen atom or a sulfur atom; and
[0036] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom,
or a salt thereof (hereinafter sometimes to be referred to as compound (I)).
[0037] In another aspect, the disclosure provides a compound represented by the formula (I),
1 2
wherein at least one of B1 and Bz is
Figure imgf000012_0002
[0038] R is hydrogen or CI -6 alkyl; and
[0039] R19 is a halogen atom, or a salt thereof.
[0040] In another aspect, X1 and X2 are O.
[0041] In another aspect, the disclosure provides a compound represented by the formula (I), wherein
Figure imgf000013_0001
[0043]
Figure imgf000013_0002
or a salt thereof. In another aspect, X1 and X2 are O.
[0044] In another aspect, the disclosure provides 7-((5R,7R,8R,12aR,14R,15R,15aR,16R)-
14-(6-amino-9H-purin-9-yl)- 15-fluoro-2, 10,16-trihydroxy-2, 10-dioxidooctahydro- 12H-5, 8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one, or a salt thereof.
[0045] In another aspect, the disclosure provides 7-
((2R, 5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -fluoro- 10,16- dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one, or a salt thereof.
[0046] In another aspect, the disclosure provides 2-amino-9-
((5R,7R,8R,12aR,14S,15S,15aS,16R)-14-(4-aminopyrazolo[l,5-a][l,3,5]tnazin-8-yl)- 2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro- 12H-5,8-methanofuro[3 ,2- 1][1,3,6,9,1 l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-l,9-dihydro-6H-purin-6-one, or a salt thereof.
[0047] In another aspect, the disclosure provides 7-
((2R, 5R, 7R, 8R, 1 OR, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15 -fluoro- 16- hydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one, or a salt thereof.
[0048] In another aspect, the disclosure provides a compound having Formula (XIV):
(CD-L)n-A (XIV)
or a pharmaceutically acceptable salt thereof, wherein:
[0049] CD is a group represented by any one of Formula (XX) - (XXIX), see below;
[0050] L is a linker;
[0051] A is an antibody, antibody fragment, or antigen-binding fragment;
[0052] n is 1-10.
[0053] In another aspect, the disclosure provides a compound having Formula (XIV), or a pharmaceutically acceptable salt thereof, wherein A is an antibody.
[0054] In another aspect, the disclosure provides a compound having Formula (XIV), or a pharmaceutically acceptable salt thereof, wherein A is an antigen-binding fragment.
[0055] In another aspect, the disclosure provides medicament comprising the compound or salt of formula (I). In another embodiment, the medicament is a STING agonist. In another embodiment, the medicament is an agent for the prophylaxis or treatment of cancer.
[0056] In another aspect, the disclosure provides a method of activating a STING in a mammal, which comprises administering an effective amount of a compound having formula (I), or a salt thereof, to the mammal.
[0057] In another aspect, the disclosure provides a method for the prophylaxis or treatment of cancer in a mammal, which comprises administering an effective amount of the compound having formula (I), or a salt thereof, to the mammal.
[0058] In another aspect, the disclosure provides a compound having formula (I), or a salt thereof, for use in prevention or treatment of cancer.
[0059] In another aspect, the disclosure provides the use of the compound having formula (I), or a salt thereof, for the production of an agent for the prophylaxis or treatment of cancer.
BRIEF DESCRIPTION OF THE DRAWINGS
[0060] Fig. 1 is a line graph showing Payload 1 release from ADCl.
[0061] Fig. 2 is a line graph showing Payload 1 release from ADC2. [0062] Fig. 3 is a line graph showing Payload 2 release from ADC3.
[0063] Fig. 4 is a bar graph showing that HEK293 cells that express the surface receptor targets for ADCl exhibit the expected increase in the STING pathway marker phospho-IRF3
(pIRF3) when treated with the ADCl.
[0064] Fig. 5 is a bar graph showing that HEK293 cells that express the surface receptor targets for ADC2 exhibit the expected increase in the STING pathway marker phospho-IRF3
(pIRF3) when treated with the ADC2.
[0065] Fig. 6 is a bar graph showing that HEK293 cells that express the surface receptor targets for ADC3 exhibit the expected increase in the STING pathway marker phospho-IRF3
(pIRF3) when treated with the ADC3.
[0066] Fig. 7 is a bar graph showing the Western blot analyses of downstream signaling pathway activation (TBKl and IRF3) for compound Ex. 14.
[0067] Fig. 8 is line graph showing the anti-tumor activity of compound Ex. 3a in the colon carcinoma CT-26 syngeneic mice model.
[0068] Fig. 9 is line graph showing the anti-tumor activity of compound Ex. 14 in the colon carcinoma CT-26 syngeneic mice model.
[0069] Fig. 10 is line graph showing the anti-tumor activity of compound Ex. 3a in the colon carcinoma B16F10 syngeneic mice model.
[0070] Fig. 11 is line graph showing the anti -tumor activity of compound Ex. 14 in the colon carcinoma B16F10 syngeneic mice model.
DETAILED DESCRIPTION OF THE INVENTION [0071] The present disclosure is explained in detail below.
[0072] The definition of each substituent used in the present specification is described in detail in the following. Unless otherwise specified, each substituent has the following definition.
[0073] In the present specification, examples of the "halogen atom" include fluorine, chlorine, bromine and iodine.
[0074] In the present specification, examples of the "Ci-6 alkyl group" include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, neopentyl, 1- ethylpropyl, hexyl, isohexyl, 1 , 1 -dimethylbutyl, 2,2-dimethylbutyl, 3,3-dimethylbutyl and 2- ethylbutyl.
[0075] In the present specification, examples of the "optionally halogenated C1-6 alkyl group" include a C1-6 alkyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methyl, chloromethyl, difluoromethyl, trichloromethyl, trifluoromethyl, ethyl, 2-bromoethyl, 2,2,2-trifluoroethyl, tetrafluoroethyl, pentafluoroethyl, propyl, 2,2-difluoropropyl, 3,3,3-trifluoropropyl, isopropyl, butyl, 4,4,4-trifluorobutyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, neopentyl, 5,5,5-trifluoropentyl, hexyl and 6, 6, 6-tr ifluor ohexy 1.
[0076] In the present specification, examples of the "C2-6 alkenyl group" include ethenyl, 1- propenyl, 2-propenyl, 2-methyl- 1 -propenyl, 1-butenyl, 2-butenyl, 3-butenyl, 3-methyl-2- butenyl, 1-pentenyl, 2-pentenyl, 3-pentenyl, 4-pentenyl, 4-methyl-3-pentenyl, 1-hexenyl, 3- hexenyl and 5-hexenyl.
[0077] In the present specification, examples of the "C2-6 alkynyl group" include ethynyl, 1- propynyl, 2-propynyl, 1-butynyl, 2-butynyl, 3-butynyl, 1-pentynyl, 2-pentynyl, 3-pentynyl, 4-pentynyl, 1-hexynyl, 2-hexynyl, 3-hexynyl, 4-hexynyl, 5-hexynyl and 4-methyl-2- pentynyl.
[0078] In the present specification, examples of the "C3-10 cycloalkyl group" include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, bicyclo[2.2.1]heptyl, bicyclo[2.2.2]octyl, bicyclo[3.2.1]octyl and adamantyl.
[0079] In the present specification, examples of the "optionally halogenated C3-10 cycloalkyl group" include a C3-10 cycloalkyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include cyclopropyl, 2,2-difluorocyclopropyl, 2,3- difluorocyclopropyl, cyclobutyl, difluorocyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and cyclooctyl.
[0080] In the present specification, examples of the "C3-10 cycloalkenyl group" include cyclopropenyl, cyclobutenyl, cyclopentenyl, cyclohexenyl, cycloheptenyl and cyclooctenyl.
[0081] In the present specification, examples of the "Ce-u aryl group" include phenyl, 1- naphthyl, 2-naphthyl, 1-anthryl, 2-anthryl and 9-anthryl.
[0082] In the present specification, examples of the "C7-16 aralkyl group" include benzyl, phenethyl, naphthylmethyl and phenylpropyl. [0083] In the present specification, examples of the "Ci-6 alkoxy group" include methoxy, ethoxy, propoxy, isopropoxy, butoxy, isobutoxy, sec-butoxy, tert-butoxy, pentyloxy and hexyloxy.
[0084] In the present specification, examples of the "optionally halogenated C1-6 alkoxy group" include a C1-6 alkoxy group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methoxy, difluoromethoxy, trifluoromethoxy, ethoxy, 2,2,2-trifluoroethoxy, propoxy, isopropoxy, butoxy, 4,4,4-trifluorobutoxy, isobutoxy, sec- butoxy, pentyloxy and hexyloxy.
[0085] In the present specification, examples of the " C3-10 cycloalkyloxy group" include cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, cycloheptyloxy and cyclooctyloxy.
[0086] In the present specification, examples of the "C^ alkylthio group" include methylthio, ethylthio, propylthio, isopropylthio, butylthio, sec-butylthio, tert-butylthio, pentylthio and hexylthio.
[0087] In the present specification, examples of the "optionally halogenated C1-6 alkylthio group" include a C1-6 alkylthio group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methylthio, difluoromethylthio, trifluoromethylthio, ethylthio, propylthio, isopropylthio, butylthio, 4,4,4-trifluorobutylthio, pentylthio and hexylthio.
[0088] In the present specification, examples of the "Ci-6 alkyl-carbonyl group" include acetyl, propanoyl, butanoyl, 2-methylpropanoyl, pentanoyl, 3-methylbutanoyl, 2- methylbutanoyl, 2,2-dimethylpropanoyl, hexanoyl and heptanoyl.
[0089] In the present specification, examples of the "optionally halogenated C1-6 alkyl- carbonyl group" include a C1-6 alkyl-carbonyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include acetyl, chloroacetyl, trifluoroacetyl, trichloroacetyl, propanoyl, butanoyl, pentanoyl and hexanoyl.
[0090] In the present specification, examples of the "Ci-6 alkoxy- carbonyl group" include methoxycarbonyl, ethoxycarbonyl, propoxycarbonyl, isopropoxycarbonyl, butoxycarbonyl, isobutoxycarbonyl, sec-butoxycarbonyl, tert-butoxycarbonyl, pentyloxycarbonyl and hexyloxy carbonyl. [0091] In the present specification, examples of the "Ce-u aryl-carbonyl group" include benzoyl, 1-naphthoyl and 2-naphthoyl.
[0092] In the present specification, examples of the "C7-16 aralkyl-carbonyl group" include phenylacetyl and phenylpropionyl.
[0093] In the present specification, examples of the "5- to 14-membered aromatic heterocyclylcarbonyl group" include nicotinoyl, isonicotinoyl, thenoyl and furoyl.
[0094] In the present specification, examples of the "3- to 14-membered non-aromatic heterocyclylcarbonyl group" include morpholinylcarbonyl, piperidinylcarbonyl and pyrrolidinylcarbonyl.
[0095] In the present specification, examples of the "mono- or di-Ci-6 alkyl-carbamoyl group" include methylcarbamoyl, ethylcarbamoyl, dimethylcarbamoyl, diethylcarbamoyl and N-ethyl-N-methylcarbamoyl.
[0096] In the present specification, examples of the "mono- or di-Cy-i6 aralkyl-carbamoyl group" include benzylcarbamoyl and phenethylcarbamoyl.
[0097] In the present specification, examples of the "Ci-6 alkylsulfonyl group" include methylsulfonyl, ethylsulfonyl, propylsulfonyl, isopropylsulfonyl, butylsulfonyl, sec- butylsulfonyl and tert-butylsulfonyl.
[0098] In the present specification, examples of the "optionally halogenated C1-6 alkylsulfonyl group" include a C1-6 alkylsulfonyl group optionally having 1 to 7, preferably 1 to 5, halogen atoms. Specific examples thereof include methylsulfonyl, difluoromethylsulfonyl, trifluoromethylsulfonyl, ethylsulfonyl, propylsulfonyl, isopropylsulfonyl, butylsulfonyl, 4,4,4-trifluorobutylsulfonyl, pentylsulfonyl and hexylsulfonyl.
[0099] In the present specification, examples of the "C -u arylsulfonyl group" include phenylsulfonyl, 1 -naphthylsulfonyl and 2-naphthylsulfonyl.
[0100] In the present specification, examples of the "substituent" include a halogen atom, a cyano group, a nitro group, an optionally substituted hydrocarbon group, an optionally substituted heterocyclic group, an acyl group, an optionally substituted amino group, an optionally substituted carbamoyl group, an optionally substituted thiocarbamoyl group, an optionally substituted sulfamoyl group, an optionally substituted hydroxy group, an optionally substituted sulfanyl (SH) group and an optionally substituted silyl group. [0101] In the present specification, examples of the "hydrocarbon group" (including
"hydrocarbon group" of "optionally substituted hydrocarbon group") include a C1-6 alkyl group, a C2-6 alkenyl group, a C2-6 alkynyl group, a C3-10 cycloalkyl group, a C3-10 cycloalkenyl group, a C6-i4 aryl group and a C7-16 aralkyl group.
[0102] In the present specification, examples of the "optionally substituted hydrocarbon group" include a hydrocarbon group optionally having substituent(s) selected from the following Substituent group A.
"Substituent group A:"
(1) a halogen atom,
(2) a nitro group,
(3) a cyano group,
(4) an oxo group,
(5) a hydroxy group,
(6) an optionally halogenated C1-6 alkoxy group,
(V) a C6-i4 aryloxy group (e.g., phenoxy, naphthoxy),
(8) a C7-16 aralkyloxy group (e.g., benzyloxy),
(9) a 5- to 14-membered aromatic heterocyclyloxy group (e.g., pyridyloxy),
(10) a 3- to 14-membered non-aromatic heterocyclyloxy group (e.g., morpholinyloxy, piperidinyloxy),
(11) a Ci-6 alkyl-carbonyloxy group (e.g., acetoxy, propanoyloxy),
(12) a C6-i4 aryl-carbonyloxy group (e.g., benzoyloxy, 1 -naphthoyloxy, 2- naphthoyloxy),
(13) a Ci-6 alkoxy-carbonyloxy group (e.g., methoxycarbonyloxy, ethoxycarbonyloxy, propoxycarbonyloxy, butoxycarbonyloxy),
(14) a mono- or di-Ci-6 alkyl-carbamoyloxy group (e.g., methylcarbamoyloxy, ethylcarbamoyloxy, dimethylcarbamoyloxy, diethylcarbamoyloxy),
(15) a C6-i4 aryl-carbamoyloxy group (e.g., phenylcarbamoyloxy, naphthylcarbamoyloxy),
(16) a 5- to 14-membered aromatic heterocyclylcarbonyloxy group (e.g., nicotinoyloxy), (17) a 3- to 14-membered non-aromatic heterocyclylcarbonyloxy group (e.g., morpholinylcarbonyloxy, piperidinylcarbonyloxy),
(18) an optionally halogenated C1-6 alkylsulfonyloxy group (e.g., methylsulfonyloxy, trifluoromethylsulfonyloxy),
(19) a C6-i4 arylsulfonyloxy group optionally substituted by a C1-6 alkyl group (e.g., phenylsulfonyloxy, toluenesulfonyloxy),
(20) an optionally halogenated C1-6 alkylthio group,
(21) a 5- to 14-membered aromatic heterocyclic group,
(22) a 3- to 14-membered non-aromatic heterocyclic group,
(23) a formyl group,
(24) a carboxy group,
(25) an optionally halogenated C1-6 alkyl- carbonyl group,
(26) a C6-i4 aryl-carbonyl group,
(27) a 5- to 14-membered aromatic heterocyclylcarbonyl group,
(28) a 3- to 14-membered non-aromatic heterocyclylcarbonyl group,
(29) a Ci-6 alkoxy-carbonyl group,
(30) a C6-i4 aryloxy-carbonyl group (e.g., phenyloxycarbonyl, 1- naphthyloxy carbonyl, 2-naphthyloxy carbonyl),
(31) a C7-16 aralkyloxy-carbonyl group (e.g., benzyloxycarbonyl, phenethyloxy carbonyl),
(32) a carbamoyl group,
(33) a thiocarbamoyl group,
(34) a mono- or di-Ci-6 alkyl-carbamoyl group,
(35) a C6-i4 aryl-carbamoyl group (e.g., phenylcarbamoyl),
(36) a 5- to 14-membered aromatic heterocyclylcarbamoyl group (e.g., pyridylcarbamoyl, thienylcarbamoyl),
(37) a 3- to 14-membered non-aromatic heterocyclylcarbamoyl group (e.g., morpholinylcarbamoyl, piperidinylcarbamoyl),
(38) an optionally halogenated C1-6 alkylsulfonyl group,
(39) a C6-i4 arylsulfonyl group, (40) a 5- to 14-membered aromatic heterocyclylsulfonyl group (e.g., pyridylsulfonyl, thienylsulfonyl),
(41) an optionally halogenated C1-6 alkylsulfinyl group,
(42) a C6-i4 arylsulfinyl group (e.g., phenylsulfinyl, 1 -naphthylsulfinyl, 2- naphthylsulfinyl),
(43) a 5- to 14-membered aromatic heterocyclylsulfinyl group (e.g., pyridylsulfinyl, thienylsulfinyl),
(44) an amino group,
(45) a mono- or di-Ci-6 alkylamino group (e.g., methylamino, ethylamino, propylamino, isopropylamino, butylamino, dimethylamino, diethylamino, dipropylamino, dibutylamino, N-ethyl-N-methylamino),
(46) a mono- or di-C6-i4 arylamino group (e.g., phenylamino),
(47) a 5- to 14-membered aromatic heterocyclylamino group (e.g., pyridylamino),
(48) a C7-16 aralkylamino group (e.g., benzylamino),
(49) a formylamino group,
(50) a Ci-6 alkyl-carbonylamino group (e.g., acetylamino, propanoylamino, butanoylamino),
(51) a (Ci-6 alkyl)(Ci-6 alkyl-carbonyl) amino group (e.g., N-acetyl-N- methylamino),
(52) a C6-i4 aryl-carbonylamino group (e.g., phenylcarbonylamino, naphthylcarbonylamino),
(53) a Ci-6 alkoxy-carbonylamino group (e.g., methoxycarbonylamino, ethoxycarbonylamino, propoxycarbonylamino, butoxycarbonylamino, tert- butoxycarbonylamino),
(54) a C7-16 aralkyloxy-carbonylamino group (e.g., benzyloxycarbonylamino),
(55) a Ci-6 alkylsulfonylamino group (e.g., methylsulfonylamino, ethylsulfonylamino),
(56) a C6-i4 arylsulfonylamino group optionally substituted by a Ci-6 alkyl group (e.g., phenylsulfonylamino, toluenesulfonylamino),
(57) an optionally halogenated Ci-6 alkyl group,
(58) a C2-6 alkenyl group, (59) a C2-6 alkynyl group,
(60) a C3-10 cycloalkyl group,
(61) a C3-10 cycloalkenyl group, and
(62) a C6-i4 aryl group.
[0103] The number of the above-mentioned substituents in the "optionally substituted hydrocarbon group" is, for example, 1 to 5, preferably 1 to 3. When the number of the substituents is two or more, the respective substituents may be the same or different.
[0104] In the present specification, examples of the "heterocyclic group" (including
"heterocyclic group" of "optionally substituted heterocyclic group") include (i) an aromatic heterocyclic group, (ii) a non-aromatic heterocyclic group and (iii) a 7- to 10-membered bridged heterocyclic group, each containing, as a ring-constituting atom besides carbon atom, 1 to 4 heteroatoms selected from a nitrogen atom, a sulfur atom and an oxygen atom.
[0105] In the present specification, examples of the "aromatic heterocyclic group" (including
"5- to 14-membered aromatic heterocyclic group") include a 5- to 14-membered (preferably 5- to 10-membered) aromatic heterocyclic group containing, as a ring-constituting atom besides carbon atom, 1 to 4 heteroatoms selected from a nitrogen atom, a sulfur atom and an oxygen atom.
[0106] Preferable examples of the "aromatic heterocyclic group" include 5- or 6-membered monocyclic aromatic heterocyclic groups such as thienyl, furyl, pyrrolyl, imidazolyl, pyrazolyl, thiazolyl, isothiazolyl, oxazolyl, isoxazolyl, pyridyl, pyrazinyl, pyrimidinyl, pyridazinyl, 1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl, 1,2,4-thiadiazolyl, 1,3,4-thiadiazolyl, triazolyl, tetrazolyl, triazinyl and the like; and
[0107] 8- to 14-membered fused polycyclic (preferably bi or tricyclic) aromatic heterocyclic groups such as benzothiophenyl, benzofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzothiazolyl, benzisothiazolyl, benzotriazolyl, imidazopyridinyl, thienopyridinyl, furopyridinyl, pyrrolopyridinyl, pyrazolopyridinyl, oxazolopyridinyl, thiazolopyridinyl, imidazopyrazinyl, imidazopyrimidinyl, thienopyrimidinyl, furopyrimidinyl, pyrrolopyrimidinyl, pyrazolopyrimidinyl, oxazolopyrimidinyl, thiazolopyrimidinyl, pyrazolotriazinyl, naphtho[2,3-b]thienyl, phenoxathiinyl, indolyl, isoindolyl, lH-indazolyl, purinyl, isoquinolyl, quinolyl, phthalazinyl, naphthyridinyl, quinoxalinyl, quinazolinyl, cinnolinyl, carbazolyl, β-carbolinyl, phenanthridinyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl and the like.
[0108] In the present specification, examples of the "non-aromatic heterocyclic group"
(including "3- to 14-membered non-aromatic heterocyclic group") include a 3- to 14- membered (preferably 4- to 10-membered) non-aromatic heterocyclic group containing, as a ring-constituting atom besides carbon atom, 1 to 4 heteroatoms selected from a nitrogen atom, a sulfur atom and an oxygen atom.
[0109] Preferable examples of the "non-aromatic heterocyclic group" include 3- to 8- membered monocyclic non-aromatic heterocyclic groups such as aziridinyl, oxiranyl, thiiranyl, azetidinyl, oxetanyl, thietanyl, tetrahydrothienyl, tetrahydrofuranyl, pyrrolinyl, pyrrolidinyl, imidazolinyl, imidazolidinyl, oxazolinyl, oxazolidinyl, pyrazolinyl, pyrazolidinyl, thiazolinyl, thiazolidinyl, tetrahydroisothiazolyl, tetrahydrooxazolyl, tetrahydroisooxazolyl, piperidinyl, piperazinyl, tetrahydropyridinyl, dihydropyridinyl, dihydrothiopyranyl, tetrahydropyrimidinyl, tetrahydropyridazinyl, dihydropyranyl, tetrahydropyranyl, tetrahydrothiopyranyl, morpholinyl, thiomorpholinyl, azepanyl, diazepanyl, azepinyl, oxepanyl, azocanyl, diazocanyl and the like; and
[0110] 9- to 14-membered fused poly cyclic (preferably bi or tricyclic) non-aromatic heterocyclic groups such as dihydrobenzofuranyl, dihydrobenzimidazolyl, dihydrobenzoxazolyl, dihydrobenzothiazolyl, dihydrobenzisothiazolyl, dihydronaphtho[2,3- b]thienyl, tetrahydroisoquinolyl, tetrahydroquinolyl, 4H-quinolizinyl, indolinyl, isoindolinyl, tetrahydrothieno[2,3-c]pyridinyl, tetrahydrobenzazepinyl, tetrahydroquinoxalinyl, tetrahydrophenanthridinyl, hexahydrophenothiazinyl, hexahydrophenoxazinyl, tetrahydrophthalazinyl, tetrahydronaphthyridinyl, tetrahydroquinazolinyl, tetrahydrocinnolinyl, tetrahydrocarbazolyl, tetrahydro-P-carbolinyl, tetrahydroacrydinyl, tetrahydrophenazinyl, tetrahydrothioxanthenyl, octahydroisoquinolyl and the like.
[0111] In the present specification, preferable examples of the "7- to 10-membered bridged heterocyclic group" include quinuclidinyl and 7-azabicyclo[2.2.1]heptanyl.
[0112] In the present specification, examples of the "nitrogen-containing heterocyclic group" include a "heterocyclic group" containing at least one nitrogen atom as a ring-constituting atom. [0113] In the present specification, examples of the "optionally substituted heterocyclic group" include a heterocyclic group optionally having substituent(s) selected from the above- mentioned "Substituent group A.
[0114] The number of the substituents in the "optionally substituted heterocyclic group" is, for example, 1 to 3. When the number of the substituents is two or more, the respective substituents may be the same or different.
[0115] In the present specification, examples of the "acyl group" include a formyl group, a carboxy group, a carbamoyl group, a thiocarbamoyl group, a sulfino group, a sulfo group, a sulfamoyl group and a phosphono group, each optionally having " 1 or 2 substituents selected from a C1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C3-10 cycloalkenyl group, a C6-i4 aryl group, a C7-16 aralkyl group, a 5- to 14-membered aromatic heterocyclic group and a 3- to 14-membered non-aromatic heterocyclic group, each of which optionally has 1 to 3 substituents selected from a halogen atom, an optionally halogenated C1-6 alkoxy group, a hydroxy group, a nitro group, a cyano group, an amino group and a carbamoyl group".
[0116] Examples of the "acyl group" also include a hydrocarbon-sulfonyl group, a heterocyclylsulfonyl group, a hydrocarbon-sulfinyl group and a heterocyclylsulfinyl group.
[0117] Here, the hydrocarbon-sulfonyl group means a hydrocarbon group-bonded sulfonyl group, the heterocyclylsulfonyl group means a heterocyclic group-bonded sulfonyl group, the hydrocarbon-sulfinyl group means a hydrocarbon group-bonded sulfinyl group and the heterocyclylsulfinyl group means a heterocyclic group-bonded sulfinyl group.
[0118] Preferable examples of the "acyl group" include a formyl group, a carboxy group, a
Ci-6 alkyl-carbonyl group, a C2-6 alkenyl-carbonyl group (e.g., crotonoyl), a C3-10 cycloalkyl- carbonyl group (e.g., cyclobutanecarbonyl, cyclopentanecarbonyl, cyclohexanecarbonyl, cycloheptanecarbonyl), a C3-10 cycloalkenyl-carbonyl group (e.g., 2-cyclohexenecarbonyl), a C6-i4 aryl-carbonyl group, a C7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a Ci-6 alkoxy-carbonyl group, a C6-i4 aryloxy-carbonyl group (e.g., phenyloxycarbonyl, naphthyloxycarbonyl), a C7-16 aralkyloxy-carbonyl group (e.g., benzyloxycarbonyl, phenethyloxycarbonyl), a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C2-6 alkenyl-carbamoyl group (e.g., diallylcarbamoyl), a mono- or di-C3.io cycloalkyl-carbamoyl group (e.g., cyclopropylcarbamoyl), a mono- or di-C6-i4 aryl- carbamoyl group (e.g., phenylcarbamoyl), a mono- or di-Cy-i6 aralkyl-carbamoyl group, a 5- to 14-membered aromatic heterocyclylcarbamoyl group (e.g., pyridylcarbamoyl), a thiocarbamoyl group, a mono- or di-Ci-6 alkyl-thiocarbamoyl group (e.g., methylthiocarbamoyl, N-ethyl-N-methylthiocarbamoyl), a mono- or di-C2-6 alkenyl- thiocarbamoyl group (e.g., diallylthiocarbamoyl), a mono- or di-C3_io cycloalkyl- thiocarbamoyl group (e.g., cyclopropylthiocarbamoyl, cyclohexylthiocarbamoyl), a mono- or di-C6-i4 aryl-thiocarbamoyl group (e.g., phenylthiocarbamoyl), a mono- or di-Cy-i6 aralkyl- thiocarbamoyl group (e.g., benzylthiocarbamoyl, phenethylthiocarbamoyl), a 5- to 14- membered aromatic heterocyclylthiocarbamoyl group (e.g., pyridylthiocarbamoyl), a sulfino group, a Ci-6 alkylsulfinyl group (e.g., methylsulfinyl, ethylsulfinyl), a sulfo group, a Ci_6 alkylsulfonyl group, a C6-i4 arylsulfonyl group, a phosphono group and a mono- or di-Ci-6 alkylphosphono group (e.g., dimethylphosphono, diethylphosphono, diisopropylphosphono, dibutylphosphono).
[0119] In the present specification, examples of the "optionally substituted amino group" include an amino group optionally having " 1 or 2 substituents selected from a Ci_6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C6-i4 aryl group, a C7-16 aralkyl group, a Ci-6 alkyl-carbonyl group, a C6-i4 aryl-carbonyl group, a C7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a Ci-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C7-i6 aralkyl-carbamoyl group, a Ci-6 alkylsulfonyl group and a C6-i4 arylsulfonyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A".
[0120] Preferable examples of the optionally substituted amino group include an amino group, a mono- or di-(optionally halogenated Ci-6 alkyl) amino group (e.g., methylamino, trifluoromethylamino, dimethylamino, ethylamino, diethylamino, propylamino, dibutylamino), a mono- or di-C2-6 alkenylamino group (e.g., diallylamino), a mono- or di-C3_ 10 cycloalkylamino group (e.g., cyclopropylamino, cyclohexylamino), a mono- or di-C6-i4 arylamino group (e.g., phenylamino), a mono- or di-Cy-i6 aralkylamino group (e.g., benzylamino, dibenzylamino), a mono- or di-(optionally halogenated Ci-6 alkyl)- carbonylamino group (e.g., acetylamino, propionylamino), a mono- or di-C6-i4 aryl- carbonylamino group (e.g., benzoylamino), a mono- or di-Cy-i6 aralkyl-carbonylamino group (e.g., benzylcarbonylamino), a mono- or di-5- to 14-membered aromatic heterocyclylcarbonylamino group (e.g., nicotinoylamino, isonicotinoylamino), a mono- or di- 3- to 14-membered non-aromatic heterocyclylcarbonylamino group (e.g., piperidinylcarbonylamino), a mono- or di-Ci-6 alkoxy-carbonylamino group (e.g., tert- butoxycarbonylamino), a 5- to 14-membered aromatic heterocyclylamino group (e.g., pyridylamino), a carbamoylamino group, a (mono- or di-Ci-6 alky 1- carbamoyl) amino group (e.g., methylcarbamoylamino), a (mono- or di-Cy-i6 aralkyl- carbamoyl) amino group (e.g., benzylcarbamoylamino), a C1-6 alkylsulfonylamino group (e.g., methylsulfonylamino, ethylsulfonylamino), a C6-i4 arylsulfonylamino group (e.g., phenylsulfonylamino), a (C1-6 alkyl)(Ci-6 alkyl-carbonyl) amino group (e.g., N-acetyl-N-methylamino) and a (C1-6 alkyl)(C6-i4 aryl-carbonyl) amino group (e.g., N-benzoyl-N-methylamino).
[0121] In the present specification, examples of the "optionally substituted carbamoyl group" include a carbamoyl group optionally having " 1 or 2 substituents selected from a C1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a Ce-u aryl group, a C7-16 aralkyl group, a Ci-6 alkyl-carbonyl group, a C6-i4 aryl-carbonyl group, a C7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a C1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group and a mono- or di-Cy-16 aralkyl-carbamoyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A".
[0122] Preferable examples of the optionally substituted carbamoyl group include a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C2-6 alkenyl- carbamoyl group (e.g., diallylcarbamoyl), a mono- or di-C3.io cycloalkyl-carbamoyl group (e.g., cyclopropylcarbamoyl, cyclohexylcarbamoyl), a mono- or di-C6-i4 aryl-carbamoyl group (e.g., phenylcarbamoyl), a mono- or di-Cy-16 aralkyl-carbamoyl group, a mono- or di- C1-6 alkyl-carbonyl-carbamoyl group (e.g., acetylcarbamoyl, propionylcarbamoyl), a mono- or di-C6-i4 aryl-carbonyl-carbamoyl group (e.g., benzoylcarbamoyl) and a 5- to 14-membered aromatic heterocyclylcarbamoyl group (e.g., pyridylcarbamoyl).
[0123] In the present specification, examples of the "optionally substituted thiocarbamoyl group" include a thiocarbamoyl group optionally having " 1 or 2 substituents selected from a Ci-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C6-i4 aryl group, a C7-16 aralkyl group, a C1-6 alkyl-carbonyl group, a C6-i4 aryl-carbonyl group, a C7-16 aralkyl- carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14- membered non-aromatic heterocyclylcarbonyl group, a C1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl- carbamoyl group and a mono- or di-Cy-i6 aralkyl-carbamoyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A".
[0124] Preferable examples of the optionally substituted thiocarbamoyl group include a thiocarbamoyl group, a mono- or di-Ci-6 alkyl-thiocarbamoyl group (e.g., methylthiocarbamoyl, ethylthiocarbamoyl, dimethylthiocarbamoyl, diethylthiocarbamoyl, N- ethyl-N-methylthiocarbamoyl), a mono- or di-C2-6 alkenyl-thiocarbamoyl group (e.g., diallylthiocarbamoyl), a mono- or di-C3.io cycloalkyl-thiocarbamoyl group (e.g., cyclopropylthiocarbamoyl, cyclohexylthiocarbamoyl), a mono- or di-C6-i4 aryl- thiocarbamoyl group (e.g., phenylthiocarbamoyl), a mono- or di-Cy-i6 aralkyl-thiocarbamoyl group (e.g., benzylthiocarbamoyl, phenethylthiocarbamoyl), a mono- or di-Ci-6 alkyl- carbonyl-thiocarbamoyl group (e.g., acetylthiocarbamoyl, propionylthiocarbamoyl), a mono- or di-C6-i4 aryl-carbonyl-thiocarbamoyl group (e.g., benzoylthiocarbamoyl) and a 5- to 14- membered aromatic heterocyclylthiocarbamoyl group (e.g., pyridylthiocarbamoyl).
[0125] In the present specification, examples of the "optionally substituted sulfamoyl group" include a sulfamoyl group optionally having " 1 or 2 substituents selected from a C1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a Ce-u aryl group, a C7-16 aralkyl group, a Ci-6 alkyl-carbonyl group, a C6-i4 aryl-carbonyl group, a C7-16 aralkyl-carbonyl group, a 5- to 14-membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a C1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group and a mono- or di-Cy-i6 aralkyl-carbamoyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A".
[0126] Preferable examples of the optionally substituted sulfamoyl group include a sulfamoyl group, a mono- or di-Ci-6 alkyl-sulfamoyl group (e.g., methylsulfamoyl, ethylsulfamoyl, dimethylsulfamoyl, diethylsulfamoyl, N-ethyl-N-methylsulfamoyl), a mono- or di-C2-6 alkenyl-sulfamoyl group (e.g., diallylsulfamoyl), a mono- or di-C3.io cycloalkyl- sulfamoyl group (e.g., cyclopropylsulfamoyl, cyclohexylsulfamoyl), a mono- or di-C6-i4 aryl- sulfamoyl group (e.g., phenylsulfamoyl), a mono- or di-Cy-i6 aralkyl-sulfamoyl group (e.g., benzylsulfamoyl, phenethylsulfamoyl), a mono- or di-Ci-6 alkyl-carbonyl-sulfamoyl group (e.g., acetylsulfamoyl, propionylsulfamoyl), a mono- or di-C6-i4 aryl-carbonyl-sulfamoyl group (e.g., benzoylsulfamoyl) and a 5- to 14-membered aromatic heterocyclylsulfamoyl group (e.g., pyridylsulfamoyl).
[0127] In the present specification, examples of the "optionally substituted hydroxy group" include a hydroxy group optionally having "a substituent selected from a C1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C6-i4 aryl group, a C7-16 aralkyl group, a C1-6 alkyl-carbonyl group, a C6-i4 aryl-carbonyl group, a C7-16 aralkyl-carbonyl group, a 5- to 14- membered aromatic heterocyclylcarbonyl group, a 3- to 14-membered non-aromatic heterocyclylcarbonyl group, a C1-6 alkoxy-carbonyl group, a 5- to 14-membered aromatic heterocyclic group, a carbamoyl group, a mono- or di-Ci-6 alkyl-carbamoyl group, a mono- or di-C7-i6 aralkyl-carbamoyl group, a C1-6 alkylsulfonyl group and a C6-i4 arylsulfonyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A".
[0128] Preferable examples of the optionally substituted hydroxy group include a hydroxy group, a Ci-6 alkoxy group, a C2-6 alkenyloxy group (e.g., allyloxy, 2-butenyloxy, 2- pentenyloxy, 3-hexenyloxy), a C3-10 cycloalkyloxy group (e.g., cyclohexyloxy), a C6-i4 aryloxy group (e.g., phenoxy, naphthyloxy), a C7-16 aralkyloxy group (e.g., benzyloxy, phenethyloxy), a C1-6 alkyl-carbonyloxy group (e.g., acetyloxy, propionyloxy, butyryloxy, isobutyryloxy, pivaloyloxy), a C6-i4 aryl-carbonyloxy group (e.g., benzoyloxy), a C7-16 aralkyl-carbonyloxy group (e.g., benzylcarbonyloxy), a 5- to 14-membered aromatic heterocyclylcarbonyloxy group (e.g., nicotinoyloxy), a 3- to 14-membered non-aromatic heterocyclylcarbonyloxy group (e.g., piperidinylcarbonyloxy), a C1-6 alkoxy-carbonyloxy group (e.g., tert-butoxycarbonyloxy), a 5- to 14-membered aromatic heterocyclyloxy group (e.g., pyridyloxy), a carbamoyloxy group, a C1-6 alkyl-carbamoyloxy group (e.g., methylcarbamoyloxy), a C7-16 aralkyl-carbamoyloxy group (e.g., benzylcarbamoyloxy), a Ci_ 6 alkylsulfonyloxy group (e.g., methylsulfonyloxy, ethylsulfonyloxy) and a C6-i4 arylsulfonyloxy group (e.g., phenylsulfonyloxy).
[0129] In the present specification, examples of the "optionally substituted sulfanyl group" include a sulfanyl group optionally having "a substituent selected from a C1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C6-i4 aryl group, a C7-16 aralkyl group, a C1-6 alkyl-carbonyl group, a C6-i4 aryl-carbonyl group and a 5- to 14-membered aromatic heterocyclic group, each of which optionally has 1 to 3 substituents selected from "Substituent group A" and a halogenated sulfanyl group.
[0130] Preferable examples of the optionally substituted sulfanyl group include a sulfanyl (-
SH) group, a C1-6 alkylthio group, a C2-6 alkenylthio group (e.g., allylthio, 2-butenylthio, 2- pentenylthio, 3-hexenylthio), a C3-10 cycloalkylthio group (e.g., cyclohexylthio), a C6-i4 arylthio group (e.g., phenylthio, naphthylthio), a C7-16 aralkylthio group (e.g., benzylthio, phenethylthio), a C1-6 alkyl-carbonylthio group (e.g., acetylthio, propionylthio, butyrylthio, isobutyrylthio, pivaloylthio), a C6-i4 aryl-carbonylthio group (e.g., benzoylthio), a 5- to 14- membered aromatic heterocyclylthio group (e.g., pyridylthio) and a halogenated thio group (e.g., pentafluorothio).
[0131] In the present specification, examples of the "optionally substituted silyl group" include a silyl group optionally having " 1 to 3 substituents selected from a C1-6 alkyl group, a C2-6 alkenyl group, a C3-10 cycloalkyl group, a C6-i4 aryl group and a C7-16 aralkyl group, each of which optionally has 1 to 3 substituents selected from "Substituent group A". Examples of the optionally substituted silyl group include a tri-Ci-6 alkylsilyl group (e.g., trimethylsilyl, tert-butyl(dimethyl)silyl).
[0132] The term "antibody-drug conjugate" or "ADC" as used herein refers to a compound that is linked to an antibody and is defined by the formula (CD-L)n-A, wherein CD is a group represented by any one of Formula (XX) - (XXIX), see below, L is a linker, A is a protein, e.g., an antibody, and n is 1-10. In one embodiment, the linker is represented by -X -T-Z-Q-, wherein X is a divalent radical that connects CD to the rest of linker, or is absent, T is a peptide, or is absent, Z is a spacer, and Q is heterobifunctional group or a heterotrifunctional group. By way of illustration, the following generic formula shows an ADC of the disclosure having a para-aminobenzyl-based connector, an alanine-alanine-based dipeptide, a propanone-based spacer, and a succinimide thioether-based heterobifunctional group:
Figure imgf000029_0001
[0133] In the present disclosure, the term "linker" refers to any chemical moiety capable of linking a protein, e.g., antibody, antibody fragment (e.g., antigen binding fragments) or functional equivalent to a cyclic dinucleotide. Linkers may be susceptible to cleavage (a "cleavable linker") thereby facilitating release of the cyclic dinucleotide. For example, such cleavable linkers may be susceptible to acid-induced cleavage, photo-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the cyclic dinucleotide and/or the antibody remains active. Alternatively, linkers may be substantially resistant to cleavage (a "noncleavable linker").
[0134] In the present disclosure, non-cleavable linkers are any chemical moiety capable of linking a cyclic dinucleotide to an antibody in a stable, covalent manner and does not fall off under the categories listed above for cleavable linkers. Thus, non-cleavable linkers are substantially resistant to acid-induced cleavage, photo-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage and disulfide bond cleavage. Furthermore, non- cleavable refers to the ability of the chemical bond in the linker or adjoining to the linker to withstand cleavage induced by an acid, photolabile-cleaving agent, a peptidase, an esterase, or a chemical or physiological compound that cleaves a disulfide bond, at conditions under which a cyclic dinucleotide and/or the antibody does not lose its activity.
[0135] Some cleavable linkers are cleaved by peptidases ("peptidase cleavable linkers").
Only certain peptides are readily cleaved inside or outside cells, see e.g. Trout et al., 79 Proc. Natl. Acad. Sci. USA, 626-629 (1982) and Umemoto et al. 43 Int. J. Cancer, 677-684 (1989). Furthermore, peptides are composed of a-amino acid units and peptidic bonds, which chemically are amide bonds between the carboxylate of one amino acid and the amino group of a second amino acid. Other amide bonds, such as the bond between a carboxylate and the a-amino acid group of lysine, are understood not to be peptidic bonds and are considered non-cleavable.
[0136] Some linkers are cleaved by esterases ("esterase cleavable linkers"). Only certain esters can be cleaved by esterases present inside or outside of cells. Esters are formed by the condensation of a carboxylic acid and an alcohol. Simple esters are esters produced with simple alcohols, such as aliphatic alcohols, and small cyclic and small aromatic alcohols.
[0137] In some embodiments, the cleavable linker component comprises a peptide comprising one to ten amino acid residues. In these embodiments, the peptide allows for cleavage of the linker by a protease, thereby facilitating release of the cyclic dinucleotide upon exposure to intracellular proteases, such as lysosomal enzymes (Doronina et al. (2003) Nat. Biotechnol. 21 :778-784). Exemplary peptides include, but are not limited to, dipeptides, tripeptides, tetrapeptides, and pentapeptides. Exemplary dipeptides include, but are not limited to, alanine-alanine (ala-ala), valine-citrulline (vc or val-cit), alanine-phenylalanine (af or ala-phe); phenylalanine-lysine (fk or phe-lys); phenylalanine-homolysine (phe-homolys); and N-methyl-valine-citrulline (Me-val-cit). Exemplary tripeptides include, but are not limited to, glycine- valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly-gly).
[0138] A peptide may comprise naturally-occurring and/or non-natural amino acid residues.
The term "naturally-occurring amino acid" refer to Ala, Asp, Cys, Glu, Phe, Gly, His, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Ser, Thr, Val, Trp, and Tyr. "Non-natural amino acids" (i.e., amino acids do not occur naturally) include, by way of non-limiting example, homoserine, homoarginine, citrulline, phenylglycine, taurine, iodotyrosine, seleno- cysteine, norleucine ("Nle"), norvaline ("Nva"), beta-alanine, L- or D-naphthalanine, ornithine ("Orn"), and the like. Peptides can be designed and optimized for enzymatic cleavage by a particular enzyme, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.
[0139] Amino acids also include the D-forms of natural and non-natural amino acids.
"D-" designates an amino acid having the "D" (dextrorotary) configuration, as opposed to the configuration in the naturally occurring ("L-") amino acids. Natural and non-natural amino acids can be purchased commercially (Sigma Chemical Co., Advanced Chemtech) or synthesized using methods known in the art.
[0140] In the present disclosure, the term "heterobifunctional group" or the term
"heterotrifunctional group" refers to a chemical moiety that connects a linker and another therapeutically active molecule, e.g., protein, e.g., an antibody. See, e.g., WO 2017/191579. Heterobi- and tri-functional groups are characterized as having different reactive groups at either end of the chemical moiety. Non-limiting exemplary heterobifunctional groups include:
Figure imgf000032_0001
wherein the "*" indicates the attachment point to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the antibody. In embodiment, the heterobifunctional group is
Figure imgf000032_0002
and is attached to a sulfur atom attached to the antibody.
[0141] A non-limiting exemplary heterotrifunctional roup is:
Figure imgf000032_0003
[0142] In the present disclosure, the term "spacer" refers to chemical moiety that connects a heterobi- and tri-functional group to the rest of the linker, e.g., a peptide, or, if a heterobi- or tri-functional group is absent, connects the rest of the linker or the cyclic dinucleotide to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the antibody. Non-limiting exemplary spacers include -NH-, -S-, -0-, -NHC(=0)CH2CH2-, -S(=0)2- CH2CH2-, - C(=0)NHNH., -C(=0)O, -C(=0)NH-, -CH2-, -CH2CH2-, -CH2CH2CH2- , -CH2=CH2-, -C≡C-, -CH=N-0-, polyethylene glycol (PEG),
Figure imgf000033_0001
[0143] The term "drug antibody ratio" or "DAR" refers to the number of CDs linked to A
(i.e., a protein, e.g., an antibody or antigen-binding fragment thereof). Thus, in the ADC having the generic formula (CD-L)n-A, the DAR is defined by the variable "n."
[0144] When referring to a compound having formula (CD-L)n-A representing an individual
ADC, the DAR refers to the number of CDs linked to the individual A, e.g., n is an integer of 1 to 10.
[0145] When referring to a compound having formula (CD-L)n-A representing a plurality of
ADCs, the DAR refers to the average number of cyclic dinucleotides linked to the As, e.g., n is an integer or fraction of 1 to 10). Thus, by way of an example, a compound having formula (CD-L)n-A comprising a first ADC with 3 cyclic dinucleotides per A and a second ADC with 4 cyclic dinucleotides per A would have a DAR, i.e., an "n," of 3.5
[0146] The terms "polypeptide," "peptide," and "protein" are used interchangeably herein to refer to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art. It is understood that, because the polypeptides of this disclosure are based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains.
[0147] A "monoclonal" antibody or antigen-binding fragment thereof refers to a homogeneous antibody or antigen-binding fragment population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants. The term "monoclonal" antibody or antigen-binding fragment thereof encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site. Furthermore, "monoclonal" antibody or antigen- binding fragment thereof refers to such antibodies and antigen-binding fragments thereof made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals.
[0148] The term "humanized" antibody or antigen-binding fragment thereof refers to forms of non-human (e.g. murine) antibodies or antigen-binding fragments that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences. Typically, humanized antibodies or antigen- binding fragments thereof are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non- human species (e.g. mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability ("CDR grafted") (Jones et al., Nature 321 :522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al, Science 239: 1534-1536 (1988)). In some instances, the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody or fragment from a non-human species that has the desired specificity, affinity, and capability. The humanized antibody or antigen- binding fragment thereof can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody or antigen-binding fragment thereof specificity, affinity, and/or capability. In general, the humanized antibody or antigen-binding fragment thereof will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody or antigen-binding fragment thereof can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. 5,225,539; Roguska et al., Proc. Natl. Acad. Sci., USA, 91(3):969-973 (1994), and Roguska et al., Protein Eng. 9(10):895-904 (1996). In some embodiments, a "humanized antibody" is a resurfaced antibody.
[0149] A "variable region" of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions. The CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al. Sequences of Proteins of Immunological Interest, (5th ed., 1991, National Institutes of Health, Bethesda Md.)); and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-lazikani et al (1997) J. Molec. Biol. 273:927-948)). In addition, combinations of these two approaches are sometimes used in the art to determine CDRs.
[0150] The Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Unless explicitly indicated otherwise, the numbering system used herein is the Kabat numbering system.
[0151] The amino acid position numbering as in Kabat, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain. For example, a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). The end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
Li ; :·····:/·.··.
·,:} Ϊ,ί ·!.¾
L:> · x ; ·? ·' iss-is"?
Hi Η31ΉΜΒ HSS-HSiR
i :·:::·.; X
Hi ·ί 5; ·ίϋ ·
C'iwiisiit u;
: ··;;;. jjsx
m m>*mm In certain aspects, the CDRs of an antibody or antigen-binding fragment thereof can be determined according to the Chothia numbering scheme, which refers to the location of immunoglobulin structural loops (see, e.g., Chothia C & Lesk AM, (1987), J Mol Biol 196: 901-917; Al-Lazikani B et al, (1997) J Mol Biol 273: 927-948; Chothia C et al, (1992) J Mol Biol 227: 799-817; Tramontano A et al, (1990) J Mol Biol 215(1): 175-82; and U.S. Patent No. 7,709,226). Typically, when using the Kabat numbering convention, the Chothia CDR-H1 loop is present at heavy chain amino acids 26 to 32, 33, or 34, the Chothia CDR-H2 loop is present at heavy chain amino acids 52 to 56, and the Chothia CDR-H3 loop is present at heavy chain amino acids 95 to 102, while the Chothia CDR-Ll loop is present at light chain amino acids 24 to 34, the Chothia CDR-L2 loop is present at light chain amino acids 50 to 56, and the Chothia CDR-L3 loop is present at light chain amino acids 89 to 97. The end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
[0153] In certain aspects, the CDRs of an antibody or antigen-binding fragment thereof can be determined according to the IMGT numbering system as described in Lefranc M-P, (1999) The Immunologist 7: 132-136 and Lefranc M-P et al, (1999) Nucleic Acids Res 27: 209-212. According to the IMGT numbering scheme, VH-CDR1 is at positions 26 to 35, VH-CDR2 is at positions 51 to 57, VH-CDR3 is at positions 93 to 102, VL-CDRl is at positions 27 to 32, VL-CDR2 is at positions 50 to 52, and VL-CDR3 is at positions 89 to 97.
[0154] In certain aspects, the CDRs of an antibody or antigen-binding fragment thereof can be determined according to MacCallum RM et al, (1996) J Mol Biol 262: 732-745. See also, e.g., Martin A. "Protein Sequence and Structure Analysis of Antibody Variable Domains," in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer- Verlag, Berlin (2001).
[0155] In certain aspects, the CDRs of an antibody or antigen-binding fragment thereof can be determined according to the AbM numbering scheme, which refers AbM hypervariable regions which represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software (Oxford Molecular Group, Inc.).
[0156] The term "human" antibody means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
[0157] The term "chimeric" antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. Typically, the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g. mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies derived from another (usually human) to avoid eliciting an immune response in that species.
[0158] The term "epitope" or "antigenic determinant" are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody. When the antigen is a polypeptide, epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
[0159] "Binding affinity" generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present disclosure. Specific illustrative embodiments are described in the following.
[0160] "Or better" when used herein to refer to binding affinity refers to a stronger binding between a molecule and its binding partner. "Or better" when used herein refers to a stronger binding, represented by a smaller numerical Kd value. For example, an antibody which has an affinity for an antigen of "0.6 nM or better", the antibody's affinity for the antigen is <0.6 nM, i.e. 0.59 nM, 0.58 nM, 0.57 nM etc. or any value less than 0.6 nM.
[0161] By "specifically binds," it is generally meant that an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind" to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope. The term "specificity" is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope. For example, antibody "A" may be deemed to have a higher specificity for a given epitope than antibody "B," or antibody "A" may be said to bind to epitope "C" with a higher specificity than it has for related epitope "D."
[0162] By "preferentially binds," it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope. Thus, an antibody which "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
[0163] An antibody is said to "competitively inhibit" binding of a reference antibody to a given epitope if the antibody preferentially binds to that epitope or an overlapping epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope. Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays. An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
[0164] The phrase "substantially similar," or "substantially the same", as used herein, denotes a sufficiently high degree of similarity between two numeric values (generally one associated with an antibody of the disclosure and the other associated with a reference/comparator antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values (e.g., Kd values). The difference between said two values can be less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% as a function of the value for the reference/comparator antibody.
[0165] A polypeptide, antibody, polynucleotide, vector, cell, or composition which is
"isolated" is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, antibodies, polynucleotides, vectors, cell or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some embodiments, an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
[0166] As used herein, "substantially pure" refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
[0167] The term "antibody" refers an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule. As used herein, the term "antibody" encompasses intact polyclonal antibodies, intact monoclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antibody, and any other modified immunoglobulin molecule so long as the antibodies exhibit the desired biological activity. An antibody can be of any the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g. IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. The different classes of immunoglobulins have different and well known subunit structures and three- dimensional configurations. Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc. As used herein, the term "antibody" encompasses bispecific and multispecific antibodies.
[0168] The term "antibody fragment" refers to a portion of an intact antibody. An "antigen- binding fragment" refers to a portion of an intact antibody that binds to an antigen. An antigen-binding fragment can contain the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, and single chain antibodies. An "antigen-binding fragment" can be a bispecific or multispecific antigen-binding fragment.
[0169] The term "drug delivery agent" as used herein refers to a chemical moiety that alters the distribution, targeting, or lifetime of the molecule into which it is incorporated. In some embodiments a drug delivery agent provides an enhanced affinity for a selected target, e.g., molecule, cell or cell type, compartment, receptor e.g., a cellular or organ compartment, tissue, organ or region of the body, as compared to a species absent such a drug delivery agent. Drug delivery agents providing enhanced affinity for a selected target are termed targeting drug delivery agents. See, e.g., WO 2013/075035 Al. All patents, patent applications, and publications cited herein are fully incorporated by reference in their entirety.
[0170] The term "drug delivery conjugate" as used herein refers to a compound comprising any one of Formula (XX)-(XXIX), a drug delivery agent and, optionally, a covalent linker.
[0171] Some drug delivery agents have endosomolytic properties. Endosomolytic drug delivery agents promote the lysis of the endosome and/or transport of any one of Formula (XX)-(XXIX), from the endosome to the cytoplasm of the cell. The endosomolytic drug delivery agent may be a polyanionic peptide or peptidomimetic which shows pH- dependent membrane activity and fusogenicity. In one embodiment, the endosomolytic drug delivery agent assumes its active conformation at endosomal pH. The "active" conformation is that conformation in which the endosomolytic drug delivery agent promotes lysis of the endosome and/or transport of Formula (XX)-(XXIX) from the endosome to the cytoplasm of the cell. Exemplary endosomolytic drug delivery agents include the GALA peptide (Subbarao et al., Biochemistry, 1987, 26: 2964-2972), the EALA peptide (Vogel et al., J. Am. Chem. Soc, 1996, 118: 1581-1586), and their derivatives (Turk et al., Biochem. Biophys. Acta, 2002, 1559: 56-68). In one embodiment, the endosomolytic component may contain a chemical group, e.g., an amino acid, which will undergo a change in charge or protonation in response to a change in pH. The endosomolytic component may be linear or branched.
[0172] Drug delivery agents can improve transport, hybridization, and specificity properties of the resultant drug delivery conjugate.
[0173] Drug delivery agents can include therapeutic modifiers, e.g., for enhancing uptake; diagnostic compounds or reporter groups e.g., for monitoring distribution; and cross-linking agents. General examples include lipids, steroids, vitamins, carbohydrates, proteins, peptides, polyamines, synthetic polymers or oligomers (such as PEG's), peptidomimetics, or any combinations thereof.
[0174] Drug delivery agents can include a naturally occurring substance, such as a protein, e.g., human serum albumin (HSA), low-density lipoprotein (LDL), high-density lipoprotein (HDL), or globulin; a carbohydrate, e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid; or a lipid. The drug delivery agent may also be a recombinant or synthetic molecule, such as a synthetic polymer or oligomer, e.g., a synthetic polyamino acid, an oligonucleotide, e.g., an aptamer. Examples of polyamino acids include a polylysine (PLL), poly L-aspartic acid, poly L-glutamic acid. Other examples of synthetic polymers or oligomers include styrene-maleic acid anhydride copolymer, poly(L-lactide-co- glycolied) copolymer, divinyl ether-maleic anhydride copolymer, N-(2- hydroxypropyl)methacrylamide copolymer (HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA), polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide polymers, or polyphosphazine. Example of polyamines include: polyethylenimine, polylysine (PLL), spermine, spermidine, polyamine, pseudopeptide-polyamine, peptidomimetic polyamine, dendrimer polyamine, arginine, amidine, protamine, cationic lipid, cationic porphyrin, quaternary salt of a polyamine, or an alpha helical peptide.
[0175] Drug delivery agents can also include targeting groups, e.g., a cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type . A targeting group can be a thyrotropin, melanotropin, lectin, glycoprotein, surfactant protein A, Mucin carbohydrate, multivalent lactose, multivalent galactose, N- acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, glycosylated polyaminoacids, multivalent galactose, transferrin, bisphosphonate, polyglutamate, polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate, vitamin B 12, biotin, an RGD peptide, an RGD peptide mimetic or an aptamer.
[0176] Other examples of drug delivery agents include dyes, intercalating agents (e.g., acridines), cross-linkers (e.g., psoralene, mitomycin C), porphyrins (TPPC4, texaphyrin, Sapphyrin), polycyclic aromatic hydrocarbons (e.g., phenazine, dihydrophenazine), artificial endonucl eases or a chelator (e.g., EDTA), lipophilic molecules, e.g., cholesterol, cholic acid, adamantane acetic acid, 1-pyrene butyric acid, dihydrotestosterone, 1,3 -Bis- 0(hexadecyl)glycerol, geranyloxyhexyl group, hexadecylglycerol, borneol, menthol, 1,3- propanediol, heptadecyl group, palmitic acid, myristic acid,03-(oleoyl)lithocholic acid, 03- (oleoyl)cholenic acid, dimethoxytrityl, or phenoxazine)and peptide conjugates (e.g., antennapedia peptide, Tat peptide), alkylating agents, phosphate, amino, mercapto, PEG (e.g., PEG-40K), MPEG, [MPEG]2, polyamino, alkyl, substituted alkyl, radiolabeled markers, enzymes, haptens (e.g., biotin), transport/absorption facilitators (e.g., aspirin, vitamin E, folic acid), synthetic ribonucleases (e.g., imidazole, bisimidazole, histamine, imidazole clusters, acridine-imidazole conjugates, Eu3+ complexes of tetraazamacrocycles), dinitrophenyl, HRP, or AP.
[0177] Drug delivery agents may also include hormones and hormone receptors. They can also include non-peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose, multivalent fucose, or aptamers. The drug delivery agent can be, for example, a lipopolysaccharide, an activator of p38 MAP kinase, or an activator of NF-KB.
[0178] The drug delivery agent can be a substance, which can increase the uptake of any one of Formula (XX)-(XXIX)into the cell, for example, by disrupting the cell's cytoskeleton, e.g., by disrupting the cell's microtubules, microfilaments, and/or intermediate filaments.
[0179] The drug delivery agent can increase the uptake of any one of
Formula (XX)-(XXIX)into the cell by, for example, activating an inflammatory response. Exemplary drug delivery agents that would have such an effect include tumor necrosis factor alpha (TNFalpha), interleukin- 1 beta, or gamma interferon.
[0180] In one embodiment, the drug delivery agent is a lipid or lipid-based molecule. Such a lipid or lipid-based molecule can bind a serum protein, e.g., human serum albumin (HSA). An HSA binding drug delivery agent allows for distribution of the drug delivery conjugate to a target tissue, e.g. , a non-kidney target tissue of the body. Other molecules that can bind HSA can also be used as drug delivery agents. For example, naproxen or aspirin can be used. A lipid or lipid-based drug delivery agent can (a) increase resistance to degradation of the drug delivery conjugate, (b) increase targeting or transport into a target cell or cell membrane, and/or (c) can be used to adjust binding to a serum protein, e.g. , HSA. A lipid or lipid-based drug delivery agent can also enable the formation of nanoparticles, such as micelles, which can impact the biodistribution of any one of Formula (XX)-(XXIX).
[0181] A lipid based drug delivery agent can be used to modulate, e.g., control the binding of the drug delivery conjugate to a target tissue. For example, a lipid or lipid-based drug delivery agent that binds to HSA more strongly will be less likely to be targeted to the kidney and therefore less likely to be cleared from the body. A lipid or lipid-based drug delivery agent that binds to HSA less strongly can be used to target the conjugate to the kidney. [0182] In one embodiment, the lipid based drug delivery agent binds HSA with a sufficient affinity such that the drug delivery conjugate is distributed to a non-kidney tissue. In one embodiment, the affinity is not so strong that the HSA-drug delivery agent binding cannot be reversed.
[0183] In another embodiment, the lipid based drug delivery agent binds HSA weakly or not at all, such that the drug delivery conjugate is distributed to the kidney. Other moieties that target to kidney cells can also be used in place of or in addition to the lipid based drug delivery agent.
[0184] In another embodiment, the drug delivery agent is a moiety, e.g., a vitamin, which is taken up by a target cell, e.g., a proliferating cell. These are particularly useful for treating disorders characterized by unwanted cell proliferation, e.g., of the malignant or non- malignant type, e.g., cancer cells. Exemplary vitamins include vitamin A, E, and K. Other exemplary vitamins include B vitamins, e.g., folic acid, B 12, riboflavin, biotin, pyridoxal or other vitamins or nutrients taken up by cancer cells. Also included are HAS, low density lipoprotein (LDL) and high-density lipoprotein (HDL).
[0185] In another embodiment, the drug delivery agent is a cell-permeation agent, e.g., a helical cell-permeation agent. In one embodiment, the agent is amphipathic. Exemplary amphipathic agents include a peptide such as tat or antennopedia, and a lipid-PEG conjugate. If the agent is a peptide, it can be modified, including a peptidylmimetic, invertomers, non- peptide or pseudo-peptide linkages, and use of D-amino acids. In one embodiment, the helical agent is an alpha-helical agent having a lipophilic and a lipophobic phase.
[0186] The drug delivery agent can be a peptide or peptidomimetic. A peptidomimetic (also referred to herein as an oligopeptidomimetic) is a molecule capable of folding into a defined three-dimensional structure similar to a natural peptide. The peptide or peptidomimetic moiety can be about 5-50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long. A peptide or peptidomimetic can be, for example, a cell permeation peptide, cationic peptide, amphipathic peptide, or hydrophobic peptide (e.g. , consisting primarily of Tyr, Trp or Phe). The peptide moiety can be a dendrimer peptide, constrained peptide or crosslinked peptide. In another embodiment, the peptide moiety can include a hydrophobic membrane translocation sequence (MTS). An exemplary hydrophobic MTS- containing peptide is RFGF. An RFGF analogue containing a hydrophobic MTS can also be a targeting moiety. The peptide moiety can be a "delivery" peptide, which can carry large polar molecules including peptides, oligonucleotides, and protein across cell membranes. For example, certain sequences from the HIV Tat protein and the Drosophila Antennapedia have been found to be capable of functioning as delivery peptides. A peptide or peptidomimetic can be encoded by a random sequence of DNA, such as a peptide identified from a phage- display library, or one-bead-one-compound (OBOC) combinatorial library (Lam et ah, Nature, 354:82-84, 1991). In one embodiment, the peptide or peptidomimetic is a cell targeting peptide such as an arginine-glycine-aspartic acid (RGD)-peptide, or RGD mimic. A peptide moiety can range in length from about 5 amino acids to about 40 amino acids. The peptide moieties can have a structural modification, such as to increase stability or direct conformational properties. Any of the structural modifications described below can be utilized. An RGD peptide moiety can be used to target a tumor cell, such as an endothelial tumor cell or a breast cancer tumor cell (Zitzmann et ah, Cancer Res., 62:5139-43, 2002). An RGD peptide can facilitate targeting of any one of Formula (XX)-(XXIX)to tumors of a variety of other tissues, including the lung, kidney, spleen, or liver (Aoki et ah, Cancer Gene Therapy 8:783-787, 2001).
[0187] In some embodiments, the RGD peptide will facilitate targeting of a drug delivery conjugate to the kidney. The RGD peptide can be linear or cyclic, and can be modified, e.g., glycosylated or methylated to facilitate targeting to specific tissues. For example, a glycosylated RGD peptide can deliver a drug delivery conjugate to a tumor cell expressing civB3 (Haubner et ah, Jour. Nucl. Med., 42:326-336, 2001). Peptides that target markers enriched in proliferating cells can be used. For example, RGD containing peptides and peptidomimetic s can target cancer cells, in particular cells that exhibit an integrin. Thus, one could use RGD peptides, cyclic peptides containing RGD, RGD peptides that include D- amino acids, as well as synthetic RGD mimics. In addition to RGD, one can use other moieties that target the integrin drug delivery agent. Generally, such drug delivery agents can be used to control proliferating cells and angiogeneis. Preferred conjugates of this type of drug delivery agent target PECAM-1, VEGF, or other cancer gene, e.g., a cancer gene described herein.
[0188] A "cell permeation peptide" is capable of permeating a cell, e.g., a mammalian cell, such as a human cell. A cell permeation peptide can include a RALA peptide. (Molecular Therapy: Nucleic Acids, 2017, 6, 249-258; J Control Release. 2014, 189: 141-9; and Nanomedicine (Lond). 2015, 10(19): 2989-3001). A cell permeation peptide can also include a nuclear localization signal (NLS). For example, a cell permeation peptide can be a bipartite amphipathic peptide, such as MPG, which is derived from the fusion peptide domain of FflV-1 gp41 and the NLS of SV40 large T antigen (Simeoni et al, Nucl. Acids Res. 31 :2717-2724, 2003). A cell permeation peptide may form a nano particle.
[0189] In one embodiment, a targeting peptide can be an amphipathic a-helical peptide.
Exemplary amphipathic a-helical peptides include, but are not limited to, cecropins, lycotoxins, paradaxins, buforin, CPF, bombinin-like peptide (BLP), cathelicidins, ceratotoxins, S. clava peptides, hagfish intestinal antimicrobial peptides (HFIAPs), magainines, brevinins-2, dermaseptins, melittins, pleurocidin, H2A peptides, Xenopus peptides, esculentinis- 1, and caerins. A number of factors will preferably be considered to maintain the integrity of helix stability. For example, a maximum number of helix stabilization residues will be utilized (e.g., leu, ala, or lys), and a minimum number helix destabilization residues will be utilized (e.g. , proline, or cyclic monomeric units. The capping residue will be considered (for example Gly is an exemplary N-capping residue and/or C-terminal amidation can be used to provide an extra H-bond to stabilize the helix. Formation of salt bridges between residues with opposite charges, separated by i + 3, or i + 4 positions can provide stability. For example, cationic residues such as lysine, arginine, homo- arginine, ornithine or histidine can form salt bridges with the anionic residues glutamate or aspartate.
[0190] Peptide and peptidomimetic drug delivery agents include those having naturally occurring or modified peptides, e.g., D or L peptides; α, β, or γ peptides; N-methyl peptides; azapeptides; peptides having one or more amide, i.e. , peptide, linkages replaced with one or more urea, thiourea, carbamate, or sulfonyl urea linkages; or cyclic peptides.
[0191] The targeting drug delivery agent can be any drug delivery agent that is capable of targeting a specific receptor. Examples are: folate, GalNAc, galactose, mannose, mannose- 6P, clusters of sugars such as GalNAc cluster, mannose cluster, galactose cluster, or an apatamer. A cluster is a combination of two or more sugar units. The targeting drug delivery agents also include integrin receptor drug delivery agents, Chemokine receptor drug delivery agents, transferrin, biotin, serotonin receptor drug delivery agents, PSMA, endothelin, GCPII, somatostatin, LDL and HDL drug delivery agents. The drug delivery agents can also be based on nucleic acid, e.g., an aptamer. The aptamer can be unmodified or have any combination of modifications disclosed herein.
[0192] Endosomal release agents include imidazoles, poly or oligoimidazoles, PEIs, peptides, fusogenic peptides, polycaboxylates, polyacations, masked oligo or poly cations or anions, acetals, polyacetals, ketals/polyketyals, orthoesters, polymers with masked or unmasked cationic or anionic charges, dendrimers with masked or unmasked cationic or anionic charges.
[0193] Drug delivery agent can be a PK modulator (pharmacokinetic modulator). PK modulators include lipophiles, bile acids, steroids, phospholipid analogues, peptides, protein binding agents, PEG, vitamins etc. Exemplary PK modulators include, but are not limited to, cholesterol, fatty acids, cholic acid, lithocholic acid, dialkylglycerides, diacylglyceride, phospholipids, sphingolipids, naproxen, ibuprofen, vitamin E, biotin etc.
[0194] Oligonucleotides that comprise a number of phosphorothioate linkages are also known to bind to serum protein, thus short oligonucleotides, e.g., oligonucleotides of about 5 bases, 10 bases, 15 bases or 20 bases, comprising multiple phosphorothioate linkages in the backbaone are also amenable to the present invention as drug delivery agents (e.g., as PK modulating drug delivery agents).
[0195] In addition, aptamers that bind serum components (e.g., serum proteins) are also amenable to the present disclosure as PK modulating drug delivery agents.
[0196] When the drug delivery agent comprises a combination of two or more moieties, e.g., a lipid and a carbohydrate, e.g., a lipid and a peptide, the two or more moieties can all have the same properties, all have different properties, or some moieties have the same properties while others have different properties. For example, a drug delivery agent can have targeting properties, endosomolytic activity, and/or PK modulating properties. For example, one moiety of a drug delivery agent can be hydrophilic, and another can be hydrophobic. In some embodiments, the moieties have different properties.
[0197] Drug delivery agents and linkers are described in US 7,745,608; US 7,626,014;
US 8,034,921; US 2005/0164235; and WO 2013/075035. All patents, patent applications, and publications cited herein are fully incorporated by reference in their entirety. [0198] The definition of each symbol in the formula (I)is explained in detail in the following embodiments.
[0199] In one embodiment, the partial structure:
Figure imgf000048_0001
is a partial structure represented b formula (IIA):
Figure imgf000048_0002
a partial structure represented by formula (IIB):
Figure imgf000048_0003
[0200] In another embodiment, the partial structure:
Figure imgf000048_0004
is a partial structure represented by the formula (IIA):
Figure imgf000049_0001
[0201] In another embodiment, the partial structure represented by the formula (IIA):
Figure imgf000049_0002
is a partial structure represented by the formula (IIAa):
Figure imgf000049_0003
[0202] In another embodiment, the partial structure represented by the formula (IIA):
Figure imgf000049_0004
is a partial structure represented by the formula (IIAb):
Figure imgf000049_0005
[0203] In another embodiment, the partial structure represented by the formula (IIB):
Figure imgf000050_0001
is a partial structure represented by the formula (IIBa):
Figure imgf000050_0002
[0204] In another embodiment, the partial structure represented by the formula (IIB):
Figure imgf000050_0003
is a partial structure represented by the formula (IIBb):
Figure imgf000050_0004
[0205] In another embodiment, the partial structure:
Figure imgf000050_0005
is
Figure imgf000051_0001
[0206] In another embodiment, the partial structure:
Figure imgf000051_0002
is
Figure imgf000051_0003
[0207] In another embodiment, R 1 and R 2 are each independently a hydroxy group or a halogen atom.
[0208] In another embodiment, R1 and R2 are each independently a hydroxy group or a fluorine atom.
[0209] In another embodiment, R1 is a hydroxy group.
[0210] In another embodiment, R2 is a hydroxy group or a fluorine atom.
[0211] In another embodiment, B1 is a group represented by
Figure imgf000051_0004
[0212] In another embodiment, R13, R14, R15, R16 and R17 are each independently a hydrog atom or a substituent.
[0213] In another embodiment, Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N
CRla. [0214] In another embodiment, Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C.
[0215] In another embodiment, Rla is a hydrogen atom or a substituent.
[0216] In another embodiment, R 13 is a hydrogen atom.
[0217] In another embodiment, R14 is a hydrogen atom or an optionally substituted amino group,
[0218] In another embodiment, R14 is a hydrogen atom or an amino group.
[0219] In another embodiment, R14 is a hydrogen atom.
[0220] In another embodiment, R15 is preferably a hydrogen atom.
[0221] In another embodiment, R13 and R15 are both hydrogen atoms, and R14 is a hydrogen atom or an optionally substituted amino group (particularly a hydrogen atom or an amino group).
[0222] In another embodiment, R13, R14 and R15 are all hydrogen atoms.
[0223] In another embodiment, R16 is a hydrogen atom.
[0224] In another embodiment, R17 is a hydrogen atom.
[0225] In another embodiment, Y11 is N.
[0226] In another embodiment, Y12 is N or CH,
[0227] In another embodiment, Y 12 is N.
[0228] In another embodiment, Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom).
[0229] In another embodiment, Y13 is N or CF.
[0230] In another embodiment, Y13 is CF.
[0231] In another embodiment, Y11 is N, Y12 is N or CH, and Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom).
[0232] In another embodiment,, Y11 is N, Y12 is N or CH, and Y13 is N or CF.
[0233] In another embodiment, Y11 is N, Y12 is N, and Y13 is CF, Y11 is N, Y12 is N, and Y13 is N, or Y11 is N, Y12 is CH, and Y13 is N.
[0234] In another embodiment, Y11 is N, Y12 is N, and Y13 is CF.
[0235] In another embodiment, Y14 is N.
[0236] In another embodiment, Y15 is N.
[0237] In another embodiment, Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom). [0238] In another embodiment, Y16 is N or CF.
[0239] In another embodiment, Y16 is N.
[0240] In another embodiment,, Y14 is N, Y15 is N, and Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom).
[0241] In another embodiment, Y14 is N, Y15 is N, and Y16 is N or CF.
[0242] In another embodiment, Y14 is N, Y15 is N, and Y16 is N, or Y14 is N, Y15 is N, and
Y16 is CF.
[0243] In another embodiment, Y14 is N, Y15 is N, and Y16 is N.
[0244] In another embodiment, Z11 is C.
[0245] In another embodiment, Z 12 is C.
[0246] In another embodiment, Z 13 is N.
[0247] In another embodiment, Z11 is C, Z12 is C, and Z13 is N.
[0248] In another embodiment, Z14 is preferably C.
[0249] In another embodiment, Z15 is preferably C.
[0250] In another embodiment, Z16 is preferably N.
[0251] In another embodiment,, Z14 is C, Z15 is C, and Z16 is N.
[0252]
Figure imgf000053_0001
[0253] In another embodiment, R , R , R , R and R are each independently a hydrogen atom or a substituent.
[0254] In another embodiment, Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a.
[0255] In another embodiment, Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C.
[0256] In another embodiment, R2a is a hydrogen atom or a substituent.
[0257] In another embodiment, R23 is a hydrogen atom. [0258] In another embodiment, R24 is a hydrogen atom or an optionally substituted amino group.
[0259] In another embodiment, R 24 is a hydrogen atom or an amino group.
[0260] In another embodiment, R 24 is a hydrogen atom.
[0261] In another embodiment, R25 is a hydrogen atom.
[0262] In another embodiment, R26 is a hydrogen atom.
[0263] In another embodiment, R27 is a hydrogen atom.
[0264] In another embodiment, Y21 is N.
[0265] In another embodiment, Y22 is N.
[0266] In another embodiment, Y23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom).
[0267] In another embodiment, Y23 is N or CF.
[0268] In another embodiment, Y23 is CF.
[0269] In another embodiment, Y21 is N, Y22 is N, and Y23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom).
[0270] In another embodiment, Y21 is N, Y22 is N, and Y23 is N or CF.
[0271] In another embodiment, Y21 is N, Y22 is N, and Y23 is CF, or Y21 is N, Y22 is N, and
Y23 is N.
[0272] In another embodiment, Y21 is N, Y22 is N, and Y23 is CF.
[0273] In another embodiment, Y24 is N.
[0274] In another embodiment, Y25 is N or CH.
[0275] In another embodiment, Y 25 is N.
[0276] In another embodiment, Y26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom).
[0277] In another embodiment, Y26 is N or CF.
[0278] In another embodiment, Y26 is N.
[0279] In another embodiment, Y24 is N, Y25 is N or CH, and Y26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom).
[0280] In another embodiment,, Y24 is N, Y25 is N or CH, and Y26 is N or CF.
[0281] In another embodiment, Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is
CF; or Y24 is N, Y25 is CH, and Y26 is N. [0282] In another embodiment, Y24 is N, Y25 is N, and Y26 is N.
[0283] In another embodiment, Z21 is N or C
[0284] In another embodiment, Z 21
is C.
[0285] In another embodiment, Z 22
is C.
[0286] In another embodiment, Z23 is N or C.
[0287] In another embodiment, Z23 is N.
[0288] In another embodiment, Z21 is N or C, Z22 is C, and Z23 is N or C.
[0289] In another embodiment, Z21 is C, Z22 is C, and Z23 is N, or Z21 is N, Z22 is C, and Z: is C.
[0290] In another embodiment, Z 21 is C, Z 22 is C, and Z 23 is N.
[0291] In another embodiment, Z 24 is N or C.
[0292] In another embodiment, Z24 is C.
[0293] In another embodiment, Z25 is C.
[0294] In another embodiment, Z26 is N or C.
[0295] In another embodiment, Z26 is N.
[0296] In another embodiment, Z 24 is N or C, Z 25 is C, and Z 26 is N or C.
[0297] In another embodiment, Z24 is C, Z25 is C, and Z26 is N, or Z24 is N, Z25 is C, and Z
In another embodiment, Z is C, Z is C, and Z is N.
In another embodiment, B1 and B2 are each independently
Figure imgf000055_0001
[0300] In another embodiment, at least one of B1 and B2 is
Figure imgf000056_0001
and in this case, he other is
Figure imgf000056_0002
[0301] In another embodiment, B1 is
Figure imgf000056_0003
[0303] In another embodiment,
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C.
[0304] In another embodiment, X1 and X2 are each independently an oxygen atom or a sulfur atom. [0305] In another embodiment, X1 and X2 are both oxygen atoms.
[0306] In another embodiment, Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
[0307] In another embodiment, Q1 is an oxygen atom.
[0308] In another embodiment, Q3 is an oxygen atom.
[0309] In another embodiment,, Q1 and Q3 are both oxygen atoms, and Q2 and Q4 are each independently an oxygen atom or a sulfur atom.
[0310] In another embodiment, Q1 is an oxygen atom, Q2 is an oxygen atom or a sulfur atom,
Q3 is an oxygen atom, and Q4 is an oxygen atom or a sulfur atom.
[0311] In another embodiment, Q 1 is an oxygen atom, Q 2 is a sulfur atom, Q 3 is an oxygen atom, and Q4 is a sulfur atom.
[0312] In another embodiment, Compound (I) is a compound represented by the formula (la):
Figure imgf000057_0001
wherein the partial structure:
Figure imgf000057_0002
is a partial structure represented by the formula (IIAa):
Figure imgf000058_0001
a partial structure represented by the formula (IIBa):
Figure imgf000058_0002
or a salt thereof (hereinafter sometimes to be referred to as compound (la)).
In another embodiment, Compound (I) is a compound represented by formula (lb):
Figure imgf000058_0003
wherein the partial structure:
Figure imgf000058_0004
is a partial structure represented by the formula (IIAb):
Figure imgf000059_0001
a partial structure represented by the formula (IIBb):
Figure imgf000059_0002
a salt thereof (hereinafter sometimes to be referred to as compound (lb)).
Examples of compound (I) include the following compounds.
Compound Al
[0315] Compound Al is a compound having formula I , wherein the partial structure:
Figure imgf000059_0003
[0316] is a partial structure represented by the formula (ΠΑ):
Figure imgf000059_0004
[0317] R1 is a hydroxy group;
[0318] R2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
[0319] B1 is a group represented by
Figure imgf000060_0001
[0320] R is a hydrogen atom;
[0321] R14 is a hydrogen atom or an optionally substituted amino group;
[0322] R15 is a hydrogen atom;
[0323] R16 is a hydrogen atom;
[0324] R17 is a hydrogen atom;
[0325] Yu is N;
[0326] Y12 is N or CH;
[0327] Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0328] Y14 is N;
[0329] Y15 is N;
[0330] Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0331] Z11 is C;
[0332] Z12 is C;
[0333] Z13 is N;
[0334] Z14 is C;
[0335] Z15 is C;
[0336] Z16 is N;
[0337]
Figure imgf000060_0002
[0338] R is a hydrogen atom;
[0339] R24 is a hydrogen atom; [0340] R25 is a hydrogen atom;
[0341] R26 is a hydrogen atom;
[0342] R27 is a hydrogen atom;
[0343] γ21 is N;
[0344] γ22 is N;
[0345] γ23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0346] γ24 is N;
[0347] γ25 is N or CH;
[0348] γ26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0349] Ζ21 is N or C;
[0350] ζ22 is C;
[0351] Ζ23 is N or C;
[0352] Ζ24 is N or C;
[0353] ζ25 is C;
[0354] Ζ26 is N or C;
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or in) at least one of Z13, Z16, Z23 and Z26 is C;
[0355] X1 and X2 are each independently an oxygen atom or a sulfur atom; and
[0356] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
Compound Bl
[0357] Compound Bl is a compound having formula (I), wherein
the partial structure:
Figure imgf000061_0001
[0358] is a partial structure represented by the formula (ΠΑ):
Figure imgf000062_0001
[0359] R1 is a hydroxy group;
[0360] R2 is a hydroxy group or a fluorine atom;
[0361] B1 is a group represented by
Figure imgf000062_0002
[0362] R is a hydrogen atom;
[0363] R14 is a hydrogen atom or an amino group;
[0364] R1* is a hydrogen atom;
[0365] R is a hydrogen atom;
[0366] R is a hydrogen atom;
[0367] Y is N;
[0368] Y is N or CH;
Figure imgf000062_0003
[0370] (e.g., Y11 is N, Y12 is N, and Y13 is CF; Y11 is N, Y12 is N, and Y13 is N; or Y11 is N,
13
Y12 is CH, and Y1J is N);
[0371] Y14 is N;
[0372] Y15 is N;
[0373] Y is N or CF;
[0374] (e.g., Y14 is N, Y15 is N, and Y16 is N; or Y14 is N, Y15 is N, and Y16 is CF);
[0375]
[0376]
[0377] Z13 is N; [0378] Z14 is C;
[0379] Z15 is C;
[0380] Z16 is N;
Figure imgf000063_0001
[0382] R is a hydrogen atom;
[0383] R24 is a hydrogen atom;
[0384] R25 is a hydrogen atom;
[0385] R26 is a hydrogen atom;
[0386] R27 is a hydrogen atom;
[0387] Y21 is N;
[0388] Y22 is N;
[0389] Y23 is N or CF;
[0390] (e.g., Y21 is N, Y22 is N, and Y23 is CF; or Y21 is N, Y22 is N, and Y23 is N);
[0391] Y24 is N;
[0392] Y25 is N or CH;
[0393] Y26 is N or CF;
[0394] (e.g., Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is CF; or Y24 is N,
Y25 is CH, and Y26 is N);
[0395] Z21 is N or C;
[0396] Z22 is C;
[0397] Z23 is N or C;
[0398] (e.g., Z21 is C, Z22 is C, and Z23 is N; or Z21 is N, Z22 is C, and Z23 is C);
[0399] Z24 is N or C;
[0400] Z25 is C;
[0401] Z26 is N or C; [0402] (e.g., Z24 is C, Z25 is C, and Z26 is N; or Z24 is N, Z25 is C, and Z: provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla, n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or in) at least one of Z13, Z16, Z23 and Z26 is C;
[0403] X1 and X2 are both oxygen atoms;
[0404] Q1 is an oxygen atom;
[0405] Q2 is an oxygen atom or a sulfur atom;
[0406] Q3 is an oxygen atom; and
[0407] Q4 is an oxygen atom or a sulfur atom.
Compound Al-a
[0408] Compound Al-a is a compound having formula (la) wherein
the partial structure:
Figure imgf000064_0001
[0409] is a partial structure represented by the formula (DAa):
Figure imgf000064_0002
[0410] R1 is a hydroxy group;
[0411] R is a hydroxy group or a halogen atom (preferably a fluorine atom);
[0412] B1 is a group represented by
Figure imgf000065_0001
[0413] R is a hydrogen atom;
[0414] R14 is a hydrogen atom or an optionally substituted amino group;
[0415] R15 is a hydrogen atom;
[0416] R16 is a hydrogen atom;
[0417] R17 is a hydrogen atom;
[0418] Yu is N;
[0419] Y12 is N or CH;
[0420] Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0421] Y14 is N;
[0422] Y15 is N;
[0423] Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0424] Z11 is C;
[0425] Z12 is C;
[0426] Z13 is N;
[0427] Z14 is C;
[0428] Z15 is C;
[0429] Z16 is N;
[0430]
Figure imgf000065_0002
[0431] R is a hydrogen atom;
[0432] R24 is a hydrogen atom; [0433] R25 is a hydrogen atom;
[0434] R26 is a hydrogen atom;
[0435] R27 is a hydrogen atom;
[0436] γ21 is N;
[0437] γ22 is N;
[0438] γ23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0439] γ24 is N;
[0440] γ25 is N or CH;
[0441] γ26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0442] Ζ21 is N or C;
[0443] Ζ22
is C;
[0444] Ζ23 is N or C;
[0445] Ζ24 is N or C;
[0446] Ζ25 is C;
[0447] Ζ26 is N or C;
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C;
[0448] X1 and X2 are each independently an oxygen atom or a sulfur atom; and
[0449] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
Compound Bl-a
[0450] Compound Bl-a is a compound having formula (la) wherein the partial structure:
Figure imgf000066_0001
[0451] is a partial structure represented by the formula (DAa):
Figure imgf000067_0001
[0452] R1 is a hydroxy group;
[0453] R2 is a hydroxy group or a fluorine atom;
[0454] 1 is a group represented by
Figure imgf000067_0002
[0455] R is a hydrogen atom;
[0456] R14 is a hydrogen atom or an amino group;
[0457] R15 is a hydrogen atom;
[0458] R16 is a hydrogen atom;
[0459] R17 is a hydrogen atom;
[0460] Y11 is N;
[0461] Y12 is N or CH;
[0462] Y13 is N or CF;
[0463] (e.g., Y11 is N, Y12 is N, and Y13 is CF; Y11 is N, Y12 is N, and Y13 is N; or Y11 is N, γ12 is CH, and Y13 is N);
[0464] Y14 is N;
[0465] Y15 is N;
[0466] Y16 is N or CF;
[0467] (e.g., Y14 is N, Y15 is N, and Y16 is N; or Y14 is N, Y15 is N, and Y16 is CF);
[0468] Z11 is C;
[0469] Z12 is C;
[0470] Z13 is N; [0471] Z14 is C;
[0472] Z15 is C;
[0473] Z16 is N;
[0474] 2 is a group represented by
Figure imgf000068_0001
[0475] R is a hydrogen atom;
[0476] R24 is a hydrogen atom;
[0477] R25 is a hydrogen atom;
[0478] R26 is a hydrogen atom;
[0479] R2' is a hydrogen atom;
[0480] Y21 is N;
[0481] Y22 is N;
[0482] Y23 is N or CF;
[0483] (e.g., Y21 is N, Y22 is N, and Y23 is CF; or Y21 is N, Y22 is N, and Y23 is N)
[0484] Y24 is N;
[0485] Y25 is N or CH;
[0486] Y26 is N or CF;
[0487] (e.g., Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is CF; or Y24 is N,
Y25 is CH, and Y26 is N);
[0488] Z21 is N or C;
[0489] Z22 is C;
[0490] Z23 is N or C;
[0491] (e.g., Z21 is C, Z22 is C, and Z23 is N; or Z21 is N, Z22 is C, and Z23 is C);
[0492] Z24 is N or C;
[0493] Z25 is C;
[0494] Z26 is N or C; [0495] (e.g., Z24 is C, Z25 is C, and Z26 is N, or Z24 is N, Z25 is C, and Z26 is C);
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C;
[0496] X1 and X2 are both oxygen atoms;
[0497] Q1 is an oxygen atom;
[0498] Q2 is an oxygen atom or a sulfur atom;
[0499] Q3 is an oxygen atom; and
[0500] Q4 is an oxygen atom or a sulfur atom.
Compound Al-b
[0501] Compound Al-b is a compound having formula lb) wherein the partial structure:
Figure imgf000069_0001
[0502] is a partial structure represented b the formula (DAb):
Figure imgf000069_0002
[0503] R1 is a hydroxy group;
[0504] R2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
[0505] B1 is a group represented by
Figure imgf000070_0001
[0506] R is a hydrogen atom;
[0507] R14 is a hydrogen atom or an optionally substituted amino group;
[0508] R15 is a hydrogen atom;
[0509] R16 is a hydrogen atom;
[0510] R17 is a hydrogen atom;
[0511] Yu is N;
[0512] Y12 is N or CH;
[0513] Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0514] Y14 is N;
[0515] Y15 is N;
[0516] Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0517] Z11 is C;
[0518] Z12 is C;
[0519] Z13 is N;
[0520] Z14 is C;
[0521] Z15 is C;
[0522] Z16 is N;
[0523]
Figure imgf000070_0002
[0524] R is a hydrogen atom;
[0525] R24 is a hydrogen atom; [0526] R25 is a hydrogen atom;
[0527] R26 is a hydrogen atom;
[0528] R27 is a hydrogen atom;
[0529] γ21 is N;
[0530] γ22 is N;
[0531] γ23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0532] γ24 is N;
[0533] γ25 is N or CH;
[0534] γ26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0535] Ζ21 is N or C;
[0536] Ζ22
is C;
[0537] Ζ23 is N or C;
[0538] Ζ24 is N or C;
[0539] Ζ25 is C;
[0540] Ζ26 is N or C;
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C;
[0541] X1 and X2 are each independently an oxygen atom or a sulfur atom; and
[0542] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
Compound Bl-b
[0543] Compound Bl-b is a compound having formula (lb) wherein the partial structure:
Figure imgf000071_0001
[0544] is a partial structure represented by the formula (DAb):
Figure imgf000072_0001
[0545] R1 is a hydroxy group;
[0546] R2 is a hydroxy group or a fluorine atom;
[0547] 1 is a group represented by
Figure imgf000072_0002
[0548] R 1 is a hydrogen atom;
[0549] R14 is a hydrogen atom or an amino group;
[0550] R15 is a hydrogen atom;
[0551] R16 is a hydrogen atom;
[0552] R17 is a hydrogen atom;
[0553] Y11 is N;
[0554] Y12 is N or CH;
[0555] Y13 is N or CF;
[0556] (e.g., Y11 is N, Y12 is N, and Y13 is CF; Y11 is N, Y12 is N, and Y13 is N; or Y11 is N, γ12 is CH, and Y13 is N);
[0557] Y14 is N;
[0558] Y15 is N;
[0559] Y16 is N or CF;
[0560] (e.g., Y14 is N, Y15 is N, and Y16 is N; or Y14 is N, Y15 is N, and Y16 is CF);
[0561] Z11 is C;
[0562] Z12 is C;
[0563] Z13 is N; [0564] Z14 is C;
[0565] Z15 is C;
[0566] Z16 is N;
[0567] 2 is a group represented by
Figure imgf000073_0001
[0568] R J is a hydrogen atom;
[0569] R24 is a hydrogen atom;
[0570] R25 is a hydrogen atom;
[0571] R26 is a hydrogen atom;
[0572] R27 is a hydrogen atom;
[0573] Y21 is N;
[0574] Y22 is N;
[0575] Y23 is N or CF;
[0576] (e.g., Y21 is N, Y22 is N, and Y23 is CF; or Y21 is N, Y22 is N, and Y23 is N);
[0577] Y24 is N;
[0578] Y25 is N or CH;
[0579] Y26 is N or CF;
[0580] (e.g., Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is CF, or Y24 is N,
Y25 is CH, and Y26 is N);
[0581] Z21 is N or C;
[0582] Z22 is C;
[0583] Z23 is N or C;
[0584] (e.g., Z21 is C, Z22 is C, and Z23 is N; or Z21 is N, Z22 is C, and Z23 is C);
[0585] Z24 is N or C;
[0586] Z25 is C;
[0587] Z26 is N or C; [0588] (e.g., Z24 is C, Z25 is C, and Z26 is N; or Z24 is N, Z25 is C, and Z26 is C);
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C;
[0589] X1 and X2 are both oxygen atoms;
[0590] Q1 is an oxygen atom;
[0591] Q is an oxygen atom or a sulfur atom;
[0592] Q is an oxygen atom; and
[0593] Q4 is an oxygen atom or a sulfur atom.
Compound A2
[0594] Compound A2 is a compound having formula (I) wherein the partial structure:
Figure imgf000074_0001
[0595] is a partial structure represented by the formula (ΠΑ):
Figure imgf000074_0002
[0596] a partial structure represented by the formula (IIB):
Figure imgf000074_0003
[0597] R1 is a hydroxy group;
[0598] R2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
[0599] 1 is a group represented by
Figure imgf000075_0001
[0600] R is a hydrogen atom;
[0601] R14 is a hydrogen atom or an optionally substituted amino group;
[0602] R15 is a hydrogen atom;
[0603] R16 is a hydrogen atom;
[0604] R17 is a hydrogen atom;
[0605] Yn is N;
[0606] Y12 is N or CH;
[0607] Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0608] Y14 is N;
[0609] Y15 is N;
[0610] Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0611] Z11 is C;
[0612] Z12 is C;
[0613] Z13 is N;
[0614] Z14 is C;
[0615] Z15 is C;
[0616] Z16 is N;
[0617] B2 is a group represented by
Figure imgf000076_0001
[0618] R is a hydrogen atom;
24
[0619] R is a hydrogen atom or an optionally substituted amino group;
[0620] R 25 is a hydrogen atom;
[0621] R26 is a hydrogen atom;
[0622] R27 is a hydrogen atom;
[0623] Y21 is N;
[0624] Y22 is N;
[0625] Y23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0626] Y24 is N;
[0627] Y25 is N or CH;
[0628] Y26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0629] Z21 is N or C;
[0630] Z22 is C;
[0631] Z23 is N or C;
[0632] Z24 is N or C;
[0633] Z25 is C;
[0634] Z26 is N or C;
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
iii) at least one of Z13, Z16, Z23 and Z26 is C;
[0635] X1 and X2 are each independently an oxygen atom or a sulfur atom; and
[0636] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
Compound B2
[0637] Compound B2 is a compound having formula (I) wherein the partial structure:
Figure imgf000077_0001
a partial structure re resented by the formula (ΠΑ):
Figure imgf000077_0002
[0639] a partial structure repres nted by the formula (IIB):
Figure imgf000077_0003
[0640] R1 is a hydroxy group;
[0641] R is a hydroxy group or a fluorine atom;
[0642] 1 is a group represented by
Figure imgf000077_0004
[0643] R is a hydrogen atom;
[0644] R14 is a hydrogen atom or an amino group;
[0645] R15 is a hydrogen atom;
[0646] R16 is a hydrogen atom; [0647] R17 is a hydrogen atom;
[0648] Yn is N;
[0649] Y12 is N or CH;
[0650] Y13 is N or CF;
[0651] (e.g., Y11 is N, Y12 is N, and Y13 is CF; Y11 is N, Y12 is N, and Y13 is N; or Y11 is N,
Y12 is CH, and Y13 is N);
[0652] Y14 is N;
[0653] Y15 is N;
[0654] Y16 is N or CF;
[0655] (e.g., Y14 is N, Y15 is N, and Y16 is N; or Y14 is N, Y15 is N, and Y16 is CF);
[0656] Z11 is C;
[0657] Z12 is C;
Z13 is N;
[0658] Z14 is C;
[0659] Z15 is C;
[0660] Z16 is N;
[0661] 2 is a group represented by
Figure imgf000078_0001
[0662] R is a hydrogen atom;
[0663] R24 is a hydrogen atom or an amino group;
R 25
[0664] is a hydrogen atom;
[0665] R26 is a hydrogen atom;
[0666] R27 is a hydrogen atom;
[0667] Y21 is N;
[0668] Y22 is N;
[0669] Y23 is N or CF;
[0670] (e.g., Y21 is N, Y22 is N, and Y23 is CF; or Y21 is N, Y22 is N, and Y23 is N); [0671] Y24 is N;
[0672] Y25 is N or CH;
[0673] Y26 is N or CF;
[0674] (e.g., Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is CF, or Y24 is
Y25 is CH, and Y26 is N);
[0675] Z21 is N or C;
[0676] Z22 is C;
[0677] Z23 is N or C;
[0678] (e.g., Z21 is C, Z22 is C, and Z23 is N; or Z21 is N, Z22 is C, and Z23 is C);
[0679] Z24 is N or C;
[0680] Z25 is C;
[0681] Z26 is N or C;
[0682] (e.g., Z24 is C, Z25 is C, and Z26 is N; or Z24 is N, Z25 is C, and Z26 is C)
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
iii) at least one of Z13, Z16, Z23 and Z26 is C;
[0683] X 1 and X 2 are both oxygen atoms;
[0684] Q1 is an oxygen atom;
[0685] Q2 is an oxygen atom or a sulfur atom;
[0686] Q3 is an oxygen atom; and
[0687] Q4 is an oxygen atom or a sulfur atom.
Compound A2-a
[0688] Compound A2-a is a compound having formula (la) wherein the partial structure:
Figure imgf000079_0001
[0689] is a partial structure represented by the formula (DAa):
Figure imgf000080_0001
[0690] a partial structure represented by the formula (IIBa):
Figure imgf000080_0002
[0691] R1 is a hydroxy group;
[0692] R2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
[0693] B1 is a group represented by
Figure imgf000080_0003
[0694] R13 is a hydrogen atom;
[0695] R is a hydrogen atom or an optionally substituted amino group;
[0696] R13 is a hydrogen atom;
[0697] R is a hydrogen atom;
[0698] R is a hydrogen atom;
[0699] Yu is N;
[0700] Y12 is N or CH;
[0701] Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0702] Y14 is N;
[0703] Y15 is N;
[0704] Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom); [0705] Z11 is C;
[0706] Z12 is C;
[0707] Z13 is N;
[0708] Z14 is C;
[0709] Z15 is C;
[0710] Z16 is N;
[0711] 2 is a group represented by
Figure imgf000081_0001
R23
[0712] is a hydrogen atom;
[0713] R24 is a hydrogen atom or an optionally substituted amino group;
[0714] R25 is a hydrogen atom;
[0715] R26 is a hydrogen atom;
[0716] R27 is a hydrogen atom;
[0717] γ21 is N;
[0718] Y2 is N;
[0719] Y23 is N or CR a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0720] Y24 is N;
[0721] Y25 is N or CH;
[0722] γ26 is N or CR a wherein R a is a halogen atom (e.g., a fluorine atom);
[0723] z21 is N or C;
[0724] z22 is C;
[0725] z23 is N or C;
[0726] z24 is N or C;
[0727] is C;
[0728] z26 is N or C;
provided that
i) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla, n) at least one of YZi, Yzz, Yz Yz Yz> and Y is CR >z2aa, or
in) at least one of Z13, Z16, Z23 and Z26 is C;
[0729] X1 and Xz are each independently an oxygen atom or a sulfur atom; and
[0730] Q , Q , Q and Q are each independently an oxygen atom or a sulfur atom.
Compound B2-a
[0731] Compound B2-a is a compound having formula I wherein the partial structure:
Figure imgf000082_0001
[0732] is a partial structure represented by the formula (DAa):
Figure imgf000082_0002
[0733] a partial structure represented by the formula (IIBa):
Figure imgf000082_0003
[0734] R1 is a hydroxy group;
[0735] R2 is a hydroxy group or a fluorine atom;
[0736] B1 is a group represented by
Figure imgf000083_0001
[0737] R is a hydrogen atom;
[0738] R14 is a hydrogen atom or an amino group;
[0739] R15 is a hydrogen atom;
[0740] R16 is a hydrogen atom;
[0741] R17 is a hydrogen atom;
[0742] Y11 is N;
[0743] Y12 is N or CH;
[0744] Y13 is N or CF;
[0745] (e.g., Y11 is N, Y12 is N, and Y13 is CF; Y11 is N, Y12 is N, and Y13 is N; o γ12 is CH, and Y13 is N);
[0746] Y14 is N;
[0747] Y15 is N;
[0748] Y16 is N or CF;
[0749] (e.g., Y14 is N, Y15 is N, and Y16 is N; or Y14 is N, Y15 is N, and Y16 is CF);
[0750] Zn is C;
[0751] Z12 is C;
[0752] Z13 is N;
[0753] Z14 is C;
[0754] Z15 is C;
[0755] Z16 is N;
[0756] B2 is a group represented by
Figure imgf000084_0001
[0757] R is a hydrogen atom;
[0758] R24 is a hydrogen atom or an amino group;
[0759] R 25 is a hydrogen atom;
[0760] R26 is a hydrogen atom;
[0761] R27 is a hydrogen atom;
[0762] Y21 is N;
[0763] Y22 is N;
[0764] Y23 is N or CF;
[0765] (e.g., Y21 is N, Y22 is N, and Y23 is CF; or Y21 is N, Y22 is N, and Y23 is N);
[0766] Y24 is N;
[0767] Y25 is N or CH;
[0768] Y26 is N or CF;
[0769] (e.g., Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is CF; or Y24 is N,
Ya is CH, and YZb is N);
[0770] Z21 is N or C;
[0771] Z22 is C;
[0772] Z23 is N or C;
[0773] (e,g., Z21 is C, Z22 is C, and Z23 is N; or Z21 is N, Z22 is C, and Z23 is C);
[0774] Z24 is N or C;
[0775] Z25 is C;
[0776] Z26 is N or C;
[0777] (e.g., Z24 is C, Z25 is C, and Z26 is N; or Z24 is N, Z25 is C, and Z26 is C);
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C; [0778] X1 and X2 are both oxygen atoms;
[0779] Q1 is an oxygen atom;
[0780] Q is an oxygen atom or a sulfur atom;
[0781] Q is an oxygen atom; and
[0782] Q4 is an oxygen atom or a sulfur atom.
Compound A2-b
[0783] Compound A2-b is a compound having formula (lb) wherein the partial structure:
Figure imgf000085_0001
[0784] is a partial structure represented by the formula (DAb):
Figure imgf000085_0002
[0785] a partial structure represented by the formula (IIBb):
Figure imgf000085_0003
[0786] R1 is a hydroxy group;
[0787] R2 is a hydroxy group or a halogen atom (e.g., a fluorine atom);
[0788] B1 is a group represented by
Figure imgf000086_0001
[0789] Rlj is a hydrogen atom;
[0790] R14 is a hydrogen atom or an optionally substituted amino group;
[0791] R15 is a hydrogen atom;
[0792] R16 is a hydrogen atom;
[0793] R17 is a hydrogen atom;
[0794] Yu is N;
[0795] Y12 is N or CH;
[0796] Y13 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0797] Y14 is N;
[0798] Y15 is N;
[0799] Y16 is N or CRla wherein Rla is a halogen atom (e.g., a fluorine atom);
[0800] Z11 is C;
[0801] Z12 is C;
[0802] Z13 is N;
[0803] Z14 is C;
[0804] Z15 is C;
[0805] Z16 is N;
[0806] 2 is a group represented by
Figure imgf000086_0002
[0807] R is a hydrogen atom;
[0808] R24 is a hydrogen atom or an optionally substituted amino group; [0809] R25 is a hydrogen atom;
[0810] R26 is a hydrogen atom;
[0811] R27 is a hydrogen atom;
[0812] γ21 is N;
[0813] γ22 is N;
[0814] γ23 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0815] γ24 is N;
[0816] γ25 is N or CH;
[0817] γ26 is N or CR2a wherein R2a is a halogen atom (e.g., a fluorine atom);
[0818] Ζ21 is N or C;
[0819] Ζ22
is C;
[0820] Ζ23 is N or C;
[0821] Ζ24 is N or C;
[0822] Ζ25 is C;
[0823] Ζ26 is N or C;
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
in) at least one of Z13, Z16, Z23 and Z26 is C;
[0824] X1 and X2 are each independently an oxygen atom or a sulfur atom; and
[0825] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
Compound B2-b
[0826] Compound B2-b is a compound having formula lb) wherein the partial structure:
Figure imgf000087_0001
[0827] is a partial structure represented by the formula (DAb):
Figure imgf000088_0001
[0828] a partial structure represented by the formula (IIBb):
Figure imgf000088_0002
[0829] R1 is a hydroxy group;
[0830] R2 is a hydroxy group or a fluorine atom;
[0831] 1 is a group represented by
Figure imgf000088_0003
[0832] R13 is a hydrogen atom;
[0833] R14 is a hydrogen atom or an amino group;
[0834] R15 is a hydrogen atom;
[0835] R16 is a hydrogen atom;
[0836] R , 17 is a hydrogen atom;
[0837] Yu is N;
[0838] Y12 is N or CH;
[0839] Y13 is N or CF;
[0840] (e.g., Y11 is N, Y12 is N, and Y13 is CF; Y11 is N, Y12 is N, and Y13 is N; or Y11 is N,
Y12 is CH, and Y13 is N);
[0841] Y14 is N; [0842] Y1- is N;
[0843] Y16 is N or CF;
[0844] (e.g., Y14 is N, Y15 is N, and Y16 is N; or Y14 is N, Y15 is N, and Y16 is CF);
[0845] Z11 is C;
[0846] Z12 is C;
[0847] Z13 is N;
[0848] Z14 is C;
[0849] Z15 is C;
[0850] Z16 is N;
[0851] 2 is a group represented by
Figure imgf000089_0001
[0852] R is a hydrogen atom;
[0853] R24 is a hydrogen atom or an amino group;
[0854] R23 is a hydrogen atom;
[0855] R26 is a hydrogen atom;
[0856] R27 is a hydrogen atom;
[0857] Y21 is N;
[0858] Y22 is N;
[0859] Y23 is N or CF;
[0860] (e.g., Y21 is N, Y22 is N, and Y23 is CF; or Y21 is N, Y22 is N, and Y23 is N);
[0861] Y24 is N;
[0862] Y25 is N or CH;
[0863] Y26 is N or CF;
[0864] (e.g., Y24 is N, Y25 is N, and Y26 is N; Y24 is N, Y25 is N, and Y26 is CF, or Y24 is N,
Y25 is CH, and Y26 is N);
[0865] Z21 is N or C;
[0866] Z22 is C; [0867] Z23 is N or C;
[0868] (e.g., Z21 is C, Z22 is C, and Z23 is N; or Z21 is N, Z22 is C, and Z23 is C)
[0869] Z24 is N or C;
[0870] Z25 is C;
[0871] Z26 is N or C;
[0872] (e.g., Z24 is C, Z25 is C, and Z26 is N; or Z24 is N, Z25 is C, and Z26 is C)
provided that
I) at least one of Y11, Y12, Y13, Y14, Y15 and Y16 is CRla,
n) at least one of Y21, Y22, Y23, Y24, Y25 and Y26 is CR2a, or
iii) at least one of Z13, Z16, Z23 and Z26 is C;
[0873] X 1 and X 2 are both oxygen atoms;
[0874] Q1 is an oxygen atom;
[0875] Q2 is an oxygen atom or a sulfur atom;
[0876] Q3 is an oxygen atom; and
[0877] Q4 is an oxygen atom or a sulfur atom.
Compound C2
[0878] Compound C2 is a compound having formula I wherein the partial structure:
Figure imgf000090_0001
[0879] is a partial structure re resented by the formula (ΠΑ):
Figure imgf000090_0002
[0880] a partial structure represented by the formula (IIB):
Figure imgf000091_0001
[0881] R1 is a hydroxy group;
[0882] R2 is a hydroxy group or a fluorine atom;
[0883] 1 and Ε ^ are each independently
Figure imgf000091_0002
[0884] at least one of B1 and B2 is
[0885] and, e.g.
Figure imgf000091_0003
[0886] X1 and X2 are both oxygen atoms;
[0887] Q1 is an oxygen atom;
[0888] Q2 is an oxygen atom or a sulfur atom;
[0889] Q3 is an oxygen atom; and
[0890] Q4 is an oxygen atom or a sulfur atom. Compound C2- a
[0891] Compound C2-a is a compound having formula (la) wherein the partial structure:
Figure imgf000092_0001
[0892] is a partial structure represented by the formula (IIAa):
Figure imgf000092_0002
[0893] a partial structure represented by the formula (IIBa):
Figure imgf000092_0003
[0894] R1 is a hydroxy group;
[0895] R2 is a hydroxy group or a fluorine atom;
[0896] B1 and B2 are each independently
Figure imgf000092_0004
1 2
[0897] at least one of B and B is
[0898] and, e.g.
Figure imgf000093_0001
[0899] X1 and X2 are both oxygen atoms;
[0900] Q1 is an oxygen atom;
[0901] Q2 is an oxygen atom or a sulfur atom;
[0902] Q3 is an oxygen atom; and
[0903] Q4 is an oxygen atom or a sulfur atom.
Compound C2- b
[0904] Compound C2-b is a compound having formula (lb) wherein the partial structure:
Figure imgf000093_0002
[0905] is a partial structure represented by the formula (DAb):
Figure imgf000093_0003
[0906] a partial structure represented by the formula (IIBb):
Figure imgf000094_0001
[0907] R1 is a hydroxy group;
[0908] R2 is a hydroxy group or a fluorine atom;
[0909] 1 and B2 are each independently
Figure imgf000094_0002
[0910] at least one of B1 and B2 is
[0911] and, e.g.
Figure imgf000094_0003
[0912] X1 and X2 are both oxygen atoms;
[0913] Q1 is an oxygen atom;
[0914] Q2 is an oxygen atom or a sulfur atom;
[0915] Q3 is an oxygen atom; and [0916] Q4 is an oxygen atom or a sulfur atom.
Compound D2
[0917] Compound D2 is a compound having formula (I) wherein the partial structure:
Figure imgf000095_0001
[0918] is a partial structure represented by the formula (ΠΑ):
Figure imgf000095_0002
[0919] a partial structure represented by the formula (IIB):
Figure imgf000095_0003
[0920] R1 is a hydroxy group;
[0921] R2 is a hydroxy group or a fluorine atom;
[0922] B1 is a group represented by
Figure imgf000095_0004
[0923] B is a group represented by
Figure imgf000096_0001
[0924] X1 and X2 are both oxygen atoms;
[0925] Q1 is an oxygen atom;
[0926] Q2 is an oxygen atom or a sulfur atom;
[0927] Q3 is an oxygen atom; and
[0928] Q4 is an oxygen atom or a sulfur atom.
Compound D2-a
[0929] Compound D2-a is a compound having formula (la) wherein the partial structure:
Figure imgf000096_0002
[0930] is a partial structure represented by the formula (DAa):
Figure imgf000096_0003
[0931] a partial structure represented by the formula (IIBa):
λ (IIBa) [0932] R1 is a hydroxy group;
[0933] R2 is a hydroxy group or a fluorine atom;
[0934] B1 is a group represented by
Figure imgf000097_0001
[0935] B2 is a group represented by
Figure imgf000097_0002
[0936] X1 and X' are both oxygen atoms;
[0937] Q1 is an oxygen atom;
[0938] Q2 is an oxygen atom or a sulfur atom;
[0939] Q3 is an oxygen atom; and
[0940] Q4 is an oxygen atom or a sulfur atom.
Compound D2-b
[0941] Compound D2-b is a compound having formula (lb) wherein the partial structure:
Figure imgf000097_0003
[0942] is a partial structure represented by the formula (DAb):
Figure imgf000098_0001
[0943] a partial structure represented by the formula (IIBb):
Figure imgf000098_0002
[0944] R1 is a hydroxy group;
[0945] R2 is a hydroxy group or a fluorine atom;
[0946] B1 is a group represented by
Figure imgf000098_0003
[0947] B2 is a group represented by
Figure imgf000098_0004
[0948] X1 and X2 are both oxygen atoms;
[0949] Q1 is an oxygen atom;
[0950] Q2 is an oxygen atom or a sulfur atom;
[0951] Q3 is an oxygen atom; and
[0952] Q4 is an oxygen atom or a sulfur atom. [0953] Specific examples of compound (I) include the compounds of Examples 1 to 20 and
3a.
[0954] When compound (I) is in a form of a salt, the salt is preferably a pharmacologically acceptable salt. Examples include salts with inorganic base, salts with organic base, salts with inorganic acid, salts with organic acid, and salts with basic or acidic amino acid.
[0955] Preferable examples of the salt with inorganic base include alkali metal salts such as sodium salt, potassium salt and the like; alkaline-earth metal salts such as calcium salt, magnesium salt and the like; aluminium salt and ammonium salt.
[0956] Preferable examples of the salt with organic base include salts with trimethylamine, triethylamine, pyridine, picoline, ethanolamine, diethanolamine, triethanolamine, tromethamine [tris(hydroxymethyl)methylamine], tert-butylamine, cyclohexylamine, benzylamine, dicyclohexylamine and Ν,Ν-dibenzyl ethylene diamine.
[0957] Preferable examples of the salt with inorganic acid include salts with hydrochloric acid, hydrobromic acid, nitric acid, sulfuric acid and phosphoric acid.
[0958] Preferable examples of the salt with organic acid include salts with formic acid, acetic acid, trifluoroacetic acid, phthalic acid, fumaric acid, oxalic acid, tartaric acid, maleic acid, citric acid, succinic acid, malic acid, methanesulfonic acid, benzenesulfonic acid and p- toluenesulfonic acid.
[0959] Preferable examples of the salt with basic amino acid include salts with arginine, lysine and ornithine.
[0960] Preferable examples of the salt with acidic amino acid include salts with aspartic acid and glutamic acid.
[0961] When compound (I) is in a form of a salt, the salt is preferably a salt with triethylamine or sodium, more preferably a salt with triethylamine.
[0962] The production method of the compound of the present invention is explained in the followings.
[0963] The raw material compound and reagent used and the compound obtained in each step in the following production method may be each in a form of a salt, and examples of such salt include those similar to the salts of the compound of the present disclosure.
[0964] When the compound obtained in each step is a free form, it can be converted to the objective salt according to a method known per se. When the compound obtained in each step is a salt, it can be converted to the objective free form or the other salt according to a method known per se.
[0965] The compound obtained in each step can be used directly as the reaction mixture or as a crude product for the next reaction. Alternatively, the compound obtained in each step can be isolated and purified from a reaction mixture according to a method known per se, for example, a separation means such as concentration, crystallization, recrystallization, distillation, solvent extraction, fractional distillation, column chromatography and the like.
[0966] When the raw material compound and reagent used in each step are commercially available, the commercially available product can also be used directly.
[0967] In the reaction in each step, while the reaction time varies depending on the kind of the reagent and solvent to be used, it is generally 1 min - 48 hr, preferably 10 min - 8 hr, unless otherwise specified.
[0968] In the reaction in each step, while the reaction temperature varies depending on the kind of the reagent and solvent to be used, it is generally -78°C - 300°C, preferably -78°C - 150°C, unless otherwise specified.
[0969] In the reaction in each step, while the pressure varies depending on the kind of the reagent and solvent to be used, it is generally 1 atm - 20 atm, preferably 1 atm - 3 atm, unless otherwise specified.
[0970] Microwave synthesizer such as Initiator manufactured by Biotage and the like may be used for the reaction in each step. While the reaction temperature varies depending on the kind of the reagent and solvent to be used, it is generally room temperature - 300°C, preferably 50°C - 250°C, unless otherwise specified. While the reaction time varies depending on the kind of the reagent and solvent to be used, it is generally 1 min - 48 hr, preferably 1 min - 8 hr, unless otherwise specified.
[0971] In the reaction in each step, the reagent is used in an amount of 0.5 equivalents - 20 equivalents, preferably 0.8 equivalents - 5 equivalents, relative to the substrate, unless otherwise specified. When the reagent is used as a catalyst, the reagent is used in an amount of 0.001 equivalent - 1 equivalent, preferably 0.01 equivalent - 0.2 equivalent, relative to the substrate. When the reagent is used as a reaction solvent, the reagent is used in a solvent amount. [0972] Unless otherwise specified, the reaction in each step is carried out without solvent, or by dissolving or suspending the raw material compound in a suitable solvent. Examples of the solvent include those described in Examples and the following solvents.
alcohols: methanol, ethanol, tert- butyl alcohol, 2-methoxyethanol and the like;
ethers: diethyl ether, diphenyl ether, tetrahydrofuran, 1 ,2-dimethoxy ethane and the like;
aromatic hydrocarbons: chlorobenzene, toluene, xylene and the like;
saturated hydrocarbons: cyclohexane, hexane and the like;
amides: Ν,Ν-dimethylformamide, N-methylpyrrolidone and the like; halogenated hydrocarbons: dichloromethane, carbon tetrachloride and the like;
nitriles: acetonitrile and the like;
sulfoxides: dimethyl sulfoxide and the like;
aromatic organic bases: pyridine and the like;
anhydrides: acetic anhydride and the like;
organic acids: formic acid, acetic acid, trifluoroacetic acid and the like; inorganic acids: hydrochloric acid, sulfuric acid and the like;
esters: ethyl acetate and the like;
ketones: acetone, methyl ethyl ketone and the like;
water.
[0973] The above-mentioned solvent can be used in a mixture of two or more kinds thereof in an appropriate ratio.
[0974] When a base is used for the reaction in each step, examples thereof include those described in Examples and the following bases.
inorganic bases: sodium hydroxide, magnesium hydroxide, sodium carbonate, calcium carbonate, sodium hydrogencarbonate and the like;
organic bases: triethylamine, diethylamine, pyridine, 4-dimethylaminopyridine, N,N- dimethylaniline, l,4-diazabicyclo[2.2.2]octane, l,8-diazabicyclo[5.4.0]-7-undecene, imidazole, piperidine and the like;
metal alkoxides: sodium ethoxide, potassium tert-butoxide and the like;
alkali metal hydrides: sodium hydride and the like; metal amides: sodium amide, lithium diisopropylamide, lithium hexamethyldisilazide and the like;
organic lithiums: n-butyllithium and the like.
[0975] When an acid or an acid catalyst is used for the reaction in each step, examples thereof include those described in Examples and the following acids and acid catalysts, inorganic acids: hydrochloric acid, sulfuric acid, nitric acid, hydrobromic acid, phosphoric acid and the like;
organic acids: acetic acid, trifluoroacetic acid, citric acid, p-toluenesulfonic acid, 10- camphorsulfonic acid and the like;
Lewis acid: boron trifluoride diethyl ether complex, zinc iodide, anhydrous aluminium chloride, anhydrous zinc chloride, anhydrous iron chloride and the like.
[0976] Unless otherwise specified, the reaction in each step is carried out according to a method known per se, for example, the method described in Jikken Kagaku Kouza, 5th Edition, vol.13-19 (the Chemical Society of Japan ed.); Shin Jikken Kagaku Kouza, vol.14- 15 (the Chemical Society of Japan ed.); Fine Organic Chemistry, Revised 2nd Edition (L. F. Tietze, Th. Eicher, Nankodo); Organic Name Reactions, the Reaction Mechanism and Essence, Revised Edition (Hideo Togo, Kodansha); ORGANIC SYNTHESES Collective Volume I- VII (John Wiley & Sons Inc); Modern Organic Synthesis in the Laboratory A Collection of Standard Experimental Procedures (Jie Jack Li, OXFORD UNIVERSITY); Comprehensive Heterocyclic Chemistry III, Vol.1 -Vol.14 (Elsevier Japan); Strategic Applications of Named Reactions in Organic Synthesis (translated by Kiyoshi Tomioka, Kagakudojin); Comprehensive Organic Transformations (VCH Publishers Inc.), 1989, or the like, or the method described in Examples.
[0977] In each step, the protection or deprotection reaction of an functional group is carried out according to a method known per se, for example, the method described in "Protective Groups in Organic Synthesis, 4th Ed", Wiley -Interscience, Inc., 2007 (Theodora W. Greene, Peter G. M. Wuts); "Protecting Groups 3rd Ed." Thieme, 2004 (P.J.Kocienski), or the like, or the method described in Examples.
[0978] Examples of the protecting group for a hydroxy group (e.g., a hydroxy group of an alcohol and the like, a phenolic hydroxy group) include ether-type protecting groups such as methoxymethyl ether, benzyl ether, tert-butyldimethylsilyl ether, tetrahydropyranyl ether and the like; carboxylate ester-type protecting groups such as acetate ester and the like; sulfonate ester-type protecting groups such as methanesulfonate ester and the like; and carbonate ester- type protecting groups such as tert-butylcarbonate and the like.
[0979] Examples of the protecting group for a carbonyl group of an aldehyde include acetal- type protecting groups such as dimethylacetal and the like; and cyclic acetal-type protecting groups such as 1,3-dioxane and the like.
[0980] Examples of the protecting group for a carbonyl group of a ketone include ketal-type protecting groups such as dimethylketal and the like; cyclic ketal-type protecting groups such as 1,3-dioxane and the like; oxime-type protecting groups such as O-methyloxime and the like; and hydrazone-type protecting groups such as Ν,Ν-dimethylhydrazone and the like.
[0981] Examples of the protecting group for a carboxyl group include ester-type protecting groups such as methyl ester and the like; and amide-type protecting groups such as N,N- dimethylamide and the like.
[0982] Examples of the protecting group for a thiol include ether-type protecting groups such as benzyl thioether and the like; and ester-type protecting groups such as thioacetate ester, thiocarbonate, thiocarbamate and the like.
[0983] Examples of the protecting group for an amino group and an aromatic heterocycle such as imidazole, pyrrole, indole and the like include carbamate-type protecting groups such as benzyl carbamate and the like; amide-type protecting groups such as acetamide, benzamide, isobutylamide and the like; alkyl amine-type protecting groups such as N- triphenylmethylamine and the like; and sulfonamide-type protecting groups such as methanesulfonamide and the like.
[0984] The protecting groups can be removed according to a method known per se (e.g., a method using acid, base, ultraviolet rays, hydrazine, phenylhydrazine, sodium N- methyldithiocarbamate, tetrabutylammonium fluoride, palladium acetate or trialkylsilyl halide (e.g., trimethylsilyl iodide, trimethylsilyl bromide), a reduction method).
[0985] When reduction reaction is carried out in each step, examples of the reducing agent to be used include metal hydrides such as lithium aluminium hydride, sodium triacetoxyborohydride, sodium cyanoborohydride, diisobutylaluminium hydride (DIBAL-H), sodium borohydride, tetramethylammonium triacetoxyborohydride and the like; boranes such as borane tetrahydrofuran complex and the like; Raney nickel; Raney cobalt; hydrogen; formic acid; triethylsilane and the like. When carbon-carbon double bond or triple bond is reduced, a method using a catalyst such as palladium-carbon, Lindlar's catalyst and the like may be employed.
[0986] When oxidation reaction is carried out in each step, examples of the oxidizing agent to be used include peroxides such as m-chloroperbenzoic acid (mCPBA), hydrogen peroxide, tert-butyl hydroperoxide and the like; perchlorates such as tetrabutylammonium perchlorate and the like; chlorates such as sodium chlorate and the like; chlorites such as sodium chlorite and the like; periodic acids such as sodium periodate and the like; hypervalent iodine reagents such as iodosylbenzene and the like; reagents containing manganese such as manganese dioxide, potassium permanganate and the like; leads such as lead tetraacetate and the like; reagents containing chromium such as pyridinium chlorochromate (PCC), pyridinium dichromate (PDC), Jones reagent and the like; halogen compounds such as N- bromosuccinimide (NBS) and the like; oxygen; ozone; sulfur trioxido-pyridine complex; osmium tetroxide; selenium dioxide; 2,3-dichloro-5,6-dicyano-l,4-benzoquinone (DDQ) and the like.
[0987] When radical cyclization reaction is carried out in each step, examples of the radical initiator to be used include azo compounds such as azobisisobutyronitrile (AIBN) and the like; water-soluble radical initiators such as 4-4'-azobis-4-cyanopentanoic acid (ACPA) and the like; triethylboron in the presence of air or oxygen; benzoyl peroxide and the like. Examples of the radical reagent to be used include tributylstannane, tristrimethylsilylsilane, 1,1,2,2-tetraphenyldisilane, diphenylsilane, samarium iodide and the like.
[0988] When Wittig reaction is carried out in each step, examples of the Wittig reagent to be used include alkylidene phosphoranes and the like. The alkylidene phosphoranes can be prepared according to a method known per se, for example, by reacting a phosphonium salt with a strong base.
[0989] When Horner-Emmons reaction is carried out in each step, examples of the reagent to be used include phosphonoacetates such as methyl dimethylphosphonoacetate, ethyl diethylphosphonoacetate and the like; and bases such as alkali metal hydrides, organic lithiums and the like.
[0990] When Friedel-Crafts reaction is carried out in each step, examples of the reagent to be used include a combination of a Lewis acid and an acid chloride or a combination of a Lewis acid and an alkylating agent (e.g., an alkyl halide, an alcohol, an olefin). Alternatively, an organic acid or an inorganic acid can also be used instead of a Lewis acid, and an anhydride such as acetic anhydride and the like can also be used instead of an acid chloride.
[0991] When aromatic nucleophilic substitution reaction is carried out in each step, a nucleophile (e.g., an amine, imidazole) and a base (e.g., an organic base) are used as a reagent.
[0992] When nucleophilic addition reaction by a carbo anion, nucleophilic 1,4-addition reaction (Michael addition reaction) by a carbo anion or nucleophilic substitution reaction by a carbo anion is carried out in each step, examples of the base to be used for generation of the carbo anion include organic lithiums, metal alkoxides, inorganic bases, organic bases and the like.
[0993] When Grignard reagent is carried out in each step, examples of the Grignard reagent to be used include arylmagnesium halides such as phenylmagnesium bromide and the like; alkylmagnesium halides such as methylmagnesium bromide and the like, and the like. The Grignard reagent can be prepared according to a method known per se, for example, by reacting an alkyl halide or an aryl halide with metal magnesium in an ether or tetrahydrofuran as a solvent.
[0994] When Knoevenagel condensation reaction is carried out in each step, a compound having an activated methylene group with two electron withdrawing groups (e.g., malonic acid, diethyl malonate, malononitrile etc.) and a base (e.g., an organic base, a metal alkoxide, an inorganic base) are used as a reagent.
[0995] When Vilsmeier-Haack reaction is carried out in each step, phosphoryl chloride and an amide derivative (e.g., Ν,Ν-dimethylformamide etc.) are used as a reagent.
[0996] When azidation reaction of an alcohol, an alkyl halide or a sulfonate is carried out in each step, examples of the azidating agent to be used include diphenylphosphorylazide (DPP A), trimethylsilylazide, sodium azide and the like. For example, for the azidation reaction of an alcohol, a method using diphenylphosphorylazide and 1,8- diazabicyclo[5.4.0]undec-7-ene (DBU), a method using trimethylsilylazide and a Lewis acid, and the like are employed.
[0997] When reductive amination reaction is carried out in each step, examples of the reducing agent to be used include sodium triacetoxyborohydride, sodium cyanoborohydride, hydrogen and formic acid. When the substrate is an amine compound, examples of the carbonyl compound to be used include paraformaldehyde, aldehydes such as acetaldehyde and the like, and ketones such as cyclohexanone and the like. When the substrate is a carbonyl compound, examples of the amine to be used include ammonia, primary amines such as methylamine and the like; secondary amines such as dimethylamine and the like, and the like.
[0998] When Mitsunobu reaction is carried out in each step, an azodicarboxylate (e.g., diethyl azodicarboxylate (DEAD), diisopropyl azodicarboxylate (DIAD) etc.) and triphenylphosphine are used as a reagent.
[0999] When esterification reaction, amidation reaction or ureation reaction is carried out in each step, examples of the reagent to be used include acyl halides such as acid chlorides, acid bromides and the like; activated carboxylic acids such as anhydrides, activated esters, sulfates and the like. Examples of the activating agent of the carboxylic acid include carbodiimide condensing agents such as l-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (WSCD) and the like; triazine condensing agents such as 4-(4,6-dimethoxy- l,3,5-triazin-2-yl)-4-methylmorpholinium chloride n-hydrate (DMT-MM) and the like; carbonate condensing agents such as 1,1-carbonyldiimidazole (CDI) and the like; diphenylphosphoryl azide (DPP A); benzotriazol-l-yloxy-trisdimethylaminophosphonium salt (BOP reagent); 2-chloro-l-methyl-pyridinium iodide (Mukaiyama reagent); thionyl chloride; lower alkyl haloformates such as ethyl chloroformate and the like; 0-(7-azabenzotriazol-l- yl)-N,N,N',N'-tetramethyluronium hexafluorophosphorate (HATU); sulfuric acid; combinations thereof and the like. When carbodiimide condensing agent is used, an additive such as 1-hydroxybenzotriazole (HOBt), N-hydroxysuccinimide (HOSu), dimethylaminopyridine (DMAP) and the like may be added to the reaction system.
[1000] When coupling reaction is carried out in each step, examples of the metal catalyst to be used include palladium compounds such as palladium(II) acetate, tetrakis(triphenylphosphine)palladium(0), dichlorobis(triphenylphosphine)palladium(II), dichlorobis(triethylphosphine)palladium(II), tris(dibenzylideneacetone)dipalladium(0), 1,1'- bis(diphenylphosphino)ferrocene palladium(II) chloride and the like; nickel compounds such as tetrakis(triphenylphosphine)nickel(0) and the like; rhodium compounds such as tris(triphenylphosphine)rhodium(III) chloride and the like; cobalt compounds; copper compounds such as copper oxide, copper(I) iodide and the like; platinum compounds and the like. In addition, a base can be added to the reaction system, and examples thereof include inorganic bases and the like.
[1001] When thiocarbonylation reaction is carried out in each step, phosphorus pentasulfide is typically used as the thiocarbonylating agent. Alternatively, a reagent having a 1,3,2,4- dithiadiphosphetane-2,4-disulfide structure (e.g., 2,4-bis(4-methoxyphenyl)-l,3,2,4- dithiadiphosphetane-2,4-disulfide (La wesson reagent) etc.) can also be used instead of phosphorus pentasulfide.
[1002] When Wohl-Ziegler reaction is carried out in each step, examples of the halogenating agent to be used include N-iodosuccinimide, N-bromosuccinimide (NBS), N- chlorosuccinimide (NCS), bromine, sulfuryl chloride and the like. In addition, the reaction can be accelerated by subjecting a radical initiator such as heat, light, benzoyl peroxide, azobisisobutyronitrile and the like to the reaction system reaction.
[1003] When halogenation reaction of a hydroxy group is carried out in each step, examples of the halogenating agent to be used include hydrohalic acids and acid halides of inorganic acids, specifically, hydrochloric acid, thionyl chloride, phosphorus oxychloride and the like for chlorination, 48% hydrobromic acid and the like for bromination. In addition, a method of producing an alkyl halide by reacting an alcohol with triphenylphosphine and carbon tetrachloride or carbon tetrabromide or the like can be employed. Alternatively, a method of producing an alkyl halide via two step comprising converting an alcohol to the corresponding sulfonate, and then reacting the sulfonate with lithium bromide, lithium chloride or sodium iodide can also be employed.
[1004] When Arbuzov reaction is carried out in each step, examples of the reagent to be used include alkyl halides such as ethyl bromoacetate and the like; phosphites such as triethyl phosphite, tri(isopropyl) phosphite and the like, and the like.
[1005] When sulfonate esterification reaction is carried out in each step, examples of the sulfonating agent to be used include methanesulfonyl chloride, p-toluenesulfonyl chloride, methanesulfonic anhydride, p-toluenesulfonic anhydride and the like.
[1006] When hydrolysis reaction is carried out in each step, an acid or a base is used as a reagent. Examples of the acid include pyridine 2,2,2-trifluoroacetate. For acid hydrolysis reaction of t-butyl ester, formic acid, triethylsilane and the like may be added to reductively- trap t-butyl cation which is by-produced.
[1007] When dehydration reaction is carried out in each step, examples of the dehydrating agent to be used include sulfuric acid, diphosphorus pentaoxide, phosphorus oxychloride,
Ν,Ν'-dicyclohexylcarbodiimide, alumina, polyphosphoric acid and the like.
[1008] Examples of the protecting group for a hydroxy group to be used in each step include ether-type protecting groups such as bis(4-methoxyphenyl)(phenyl)methyl ether and the like, in addition to those exemplified above.
[1009] Examples of the protecting group for an amino group to be used in each step include imidamide-type protecting groups such as Ν,Ν-dimethylformimidamide and the like, in addition to those exemplified above.
[1010] The deprotection reaction in each step can also be carried out using acetic acid, l,l,l,3,3,3-hexafluoropropan-2-ol, triethylamine trihydrofluoride, methylamine, 2- methylpropan-2-amine or hydrogen fluoride-pyridine, trifluoroacetic acid, instead of those exemplified above.
[1011] When rearrangement reaction is carried out in each step, examples of the reagent to be used include bases such as triethylamine and the like.
[1012] When phosphoramidite reaction is carried out in each step, a phosphoramiditing agent
(e.g., phosphordiamidites such as 3-((bis(diisopropylamino)phosphino)oxy)propanenitrile and the like; chlorophosphoramidites such as 2-cyanoethyl diisopropylchlorophosphoramidite and the like) and a base (e.g., organic bases) are used as a reagent.
[1013] When thiophosphoramidite reaction is carried out in each step, a thiophosphoramiditing agent (e.g., 2-cyanoethyl dipropan-2-ylphosphoramidochloridothioite) and a base (e.g., organic bases) are used as a reagent.
[1014] When H-phosphonation reaction is carried out in each step, examples of the H- phosphonating agent to be used include diphenyl phosphite and the like.
[1015] When H-thiophosphonation reaction is carried out in each step, examples of the H- thiophosphonating agent to be used include a combination of an activator such as diphenyl phosphite and the like and a sulfur atom source such as lithium sulfide and the like, and the like. [1016] When condensation reaction is carried out in each step, examples of the activator to be used include pyridine 2,2,2-trifluoroacetate, IH-tetrazole, 5-(ethylsulfanyl)-lH-tetrazole (hereinafter sometimes to be referred to as 5-(ethylsulfanyl)-2H-tetrazole) and the like.
[1017] When oxidation reaction is carried out in each step, examples of the oxidizing agent to be used include halogens such as iodine and the like generally used for synthesis of nucleic acid, and the like, in addition to those exemplified above.
[1018] When sulfurization reaction is carried out in each step, examples of the sulfurizing agent to be used include 3H-benzo[c][l,2]dithiol-3-one, 3H-benzo[c][l,2]dithiol-3-one 1,1- dioxide, ((dimethylamino-methylidene)amino)-3H-l,2,4-dithiazoline-3-thione and the like. In addition, for example, sulfur-2,6-lutidine suspension, sulfur-carbon disulfide solution, tetramethylthiuram disulfide (TETD) (H. Vu et al., Tetrahedron Lett, 32, 3005-3008 (1991)), Beauge's reagent (R.P. Lyer et al, J. Am. Chem. Soc, 112, 1253-1254 (1990)) and Lawesson's reagent can also be used for sulfurization reaction. Moreover, as a method of formation of phosphorodithioate structure, the document by Marshall et al (Science 259: 1564-1570, 1993) and the document by Caruthers and Nielsen et al (WO 1989/011486) can be used as a reference.
[1019] When cyclization reaction is carried out in each step, examples of the activator to be used include 2-chloro-5,5-dimethyl-l,3,2-dioxaphosphinane 2-oxide, pivaloyl chloride, 2- (benzoyltriazol- 1 -yloxy)- 1 ,3 -dimethyl-2-pyrrolidin- 1 -yl- 1 ,3,2-diazaphospholidinium hexafluorate (BOMP), N,N-bis(2-oxazolidinyl)phosphonic chloride (BopCl), pyrophosphoric acid and the like. When an activator is not used, the reaction may be carried out under heating. In addition, a base may be added to the reaction system. Examples of the base include organic bases and the like.
[1020] When bond-forming reaction between nucleobase and ribose is carried out in each step, examples of the activator to be used include trimethylsilyl N- (trimethylsilyl)acetimidate, trimethylsilyl trifluoromethanesulfonate and the like.
[1021] When the partial structure:
Figure imgf000110_0001
[1022] is a partial structure represented by the formula (ΠΑ):
Figure imgf000110_0002
compound (IA) can be produced from compound (la) or (lb) and compound (2a) or (2b) according to the below method.
Figure imgf000110_0003
wherein PGa is a hydroxy-protecting group, and the other symbols are as defined above.
[1023] Alternatively, when the partial structure:
Figure imgf000111_0001
is the partial structure represented by the formula (IIA), compound (IA) can also be produced from compound (8a) or (8b) and compound (9a) or (9b) according to the below method.
Figure imgf000111_0002
Figure imgf000111_0003
wherein PG is a hydroxy-protecting group, and the other symbols are as defined above.
[1024] When the partial structure:
Figure imgf000111_0004
[1025] is a partial structure represented by the formula (ΠΒ):
Figure imgf000112_0001
compound (IB) can be produced from compound (15a) or (15b) and compound (2a) or (2b) accordin to the below method.
Figure imgf000112_0002
wherein each symbol is as defined above.
Alternatively, when the partial structure:
Figure imgf000112_0003
is the partial structure represented by the formula (IIB), compound (IB) can also be produced from compound (8a) or (8b) and compound (21a) or (21b) according to the below method.
Figure imgf000113_0001
Figure imgf000113_0002
wherein PGC is a hydroxy-protecting group, and the other symbols are as defined above.
[1027] Preferable examples of the hydroxy-protecting group for PGa, PG or PGC include ether-type protecting groups such as bis(4-methoxyphenyl)(phenyl)methyl ether, 3-hydroxy-
1,1,3,3-tetraisopropyldisiloxanyl ether and the like.
[1028] When R1 and R2 are each a hydroxy group, the hydroxy group may be protected.
Preferable examples of the hydroxy-protecting group include ether-type protecting groups such as tert-butyldimethylsilyl ether, 3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl ether and the like.
[1029] When R1 is a hydroxyl group, the hydroxyl group and the hydroxyl group represented by PGa may be protected by a 1,1,3,3-tetraisopropyldisiloxanyl group:
Figure imgf000113_0003
[1030] In this case, a compound wherein the R1 hydroxyl group is protected by a 3 -hydroxy -
1 , 1 ,3 ,3-tetraisopropyldisiloxanyl group:
Figure imgf000114_0001
is produced in the deprotection reaction for removal of PGa.
[1031] When B1 has a functional group, the functional group may be protected. For example, when B1 is a group represented by
Figure imgf000114_0002
[1032] R14 is -NH2 group, the -NH2 group may be protected. In addition, for example, when
B1 is a group represented by
Figure imgf000114_0003
the -NH2 group may be protected.
[1033] When B2 has a functional group, the functional group may be protected. For example, when B2 is a group represented by
Figure imgf000114_0004
[1034] R is -NH2 group, the -NH2 group may be protected. In addition, for example, when
B2 is a group represented by
Figure imgf000115_0001
the -NH2 group may be protected.
[1035] Preferable examples of the protecting group for the -NH2 group include amide-type protecting groups such as benzamide, isobutylamide and the like, and imidamide-type protecting groups such as Ν,Ν-dimethylformimidamide and the like.
[1036] The above-mentioned compounds (la), (lb), (9a) and (9b) can be produced from compound (27) according to the below method.
Figure imgf000115_0002
wherein each symbol is as defined above.
[1037] The above-mentioned compounds (2a), (2b), (8a) and (8b) can be produced from compound (29) according to the below method.
Figure imgf000116_0001
(8b) (8a) (30)
wherein each symbol is as defined above.
[1038] The above-mentioned compounds (15a), (15b), (21a) and (21b) can be produced from compound (31) according to the below method.
Figure imgf000116_0002
wherein each symbol is as defined above.
[1039] The substituent of the thus-obtained compound (I) can be subjected to modification
(i.e., substituent introduction, functional group transformation) according to a means known per se to give the other compound or a salt thereof encompassed in Compound (I). Known general methods can be employed for the substituent introduction and functional group transformation, and examples thereof include conversion of a halogen atom (e.g., fluorine, chlorine, bromine, iodine) or an optionally halogenated C1-6 alkylsulfonyl-oxy group [e.g., methanesulfonyloxy, ethanesulfonyloxy, trichloromethanesulfonyloxy, trifluoromethanesulfonyloxy (inflate)] to a methyl group, a cyclopropyl group, a vinyl group, a cyano group, a formyl group, a carbonyl group, a carboxyl group, a hydroxy group, an amino group, a boryl group and the like; conversion of a formyl group to an ethynyl group by Seyferth-Gilbert homologation reaction; conversion of an ester to a carboxy group by hydrolysis; conversion of a carboxy group to a carbamoyl group by amidation; conversion of a carboxy group to a hydroxymethyl group by reduction; conversion of a carbonyl group to an alcohol by reduction or alkylation; reductive amination of a carbonyl group; oximation of a carbonyl group; acylation of an amino group; ureation of an amino group; sulfonylation of an amino group; alkylation of an amino group; replacement or amination of an activated halogen by an amine; alkylation of a hydroxy group; and replacement or amination of a hydroxy group.
[1040] In case of the substituent introduction and functional group transformation, when the compound has a reactive moiety in which undesirable reaction may occur, a protecting group may be introduced into the reactive moiety in advance according to a method known per se as necessary. By removing the protecting group according to a method known per se after the objective reaction, the compound encompassed in the present disclosure can be produced.
[1041] For Example, when the raw material compound or intermediate has an amino group, a carboxyl group or a hydroxy group, these groups may be protected by a protecting group generally used in peptide chemistry and the like. By removing the protecting group as necessary after the reaction, the objective compound can be obtained.
[1042] When compound (I) contains an isomer such as an optical isomer, a stereoisomer, a regioisomer, a rotamer and the like, any isomer and a mixture thereof are also encompassed in compound (I) wherein. For example, when compound (I) contains an optical isomer, an optical isomer resolved from racemate compound is also encompassed in compound (I) wherein. These isomers can be obtained as a single product according to a synthetic method known per se and a separation method known per se (e.g., concentration, solvent extraction, column chromatography and recrystallization).
[1043] Compound (I) may be a crystal, and a single crystal form and a mixture of crystal forms are both encompassed in compound (I) wherein. The crystal can be produced by crystallizing according to a crystallization method known per se. [1044] Compound (I) may be a pharmaceutically acceptable cocrystal or a salt thereof. The cocrystal or a salt thereof means a crystalline substance constituted with two or more special solids at room temperature, each having different physical properties (e.g., structure, melting point, melting heat, hygroscopicity and stability). The cocrystal or a salt thereof can be produced according to a cocrystallization method known per se.
[1045] Compound (I) may be a hydrate, a non-hydrate, a solvate or a non-solvate, and they are all encompassed in compound (I).
[1046] Compound (I) also encompasses a compound labeled or substituted with an isotope
(e.g., ¾ ¾ nC, 14C, 18F, 35S, 125I) and the like. The compound labeled or substituted with an isotope may be used, for example, as a tracer (PET tracer) used in positron emission tomography (PET), and is useful in the field of medical diagnosis and the like.
[1047] Compound (I) may be a prodrug.
[1048] The prodrug of compound (I) means a compound which is converted to compound (I) with a reaction due to an enzyme, gastric acid and the like under the physiological condition in the living body, that is, a compound which is converted to compound (I) by enzymatic oxidation, reduction, hydrolysis and the like; a compound which is converted to compound (I) by hydrolysis and the like due to gastric acid, and the like.
[1049] Examples of the prodrug for compound (I) include
(1) a compound obtained by subjecting the amino in compound (I) to acylation, alkylation or phosphorylation (e.g., a compound obtained by subjecting the amino in compound (I) to eicosanoylation, alanylation, pentylaminocarbonylation, (5-methyl-2-oxo- 1 ,3-dioxolen-4-yl)methoxycarbonylation, tetrahydrofuranylation, pyrrolidylmethylation, pivaloyloxymethylation, tert-butylation, ethoxycarbonylation, tert-butoxycarbonylation, acetylation or cyclopropylcarbonylation);
(2) a compound obtained by subjecting the hydroxy in compound (I) to acylation, alkylation, phosphorylation or boration (e.g., a compound obtained by subjecting the hydroxy in compound (I) to acetylation, palmitoylation, propanoylation, pivaloylation, succinylation, fumarylation, alanylation or dimethylaminomethylcarbonylation);
(3) a compound obtained by subjecting the carboxy in compound (I) to esterification or amidation (e.g., a compound obtained by subjecting the carboxy in compound (I) to ethyl esterification, phenyl esterification, carboxymethyl esterification, dimethylaminomethyl esterification, pivaloyloxymethyl esterification, ethoxycarbonyloxyethyl esterification, phthalidyl esterification, (5-methyl-2-oxo-l,3-dioxolen-4-yl)methyl esterification, cyclohexyloxycarbonylethyl esterification or methylamidation). These compounds can be produced from compound (I) according to a method known per se.
[1050] The prodrug of compound (I) may also be one which is converted to compound (I) under physiological conditions as described in "IYAKUHIN no KAIHATSU (Development of Pharmaceuticals)", Vol. 7, Design of Molecules, p. 163-198, Published by fflROKAWA SHOTEN (1990).
[1051] In the present specification, the prodrug may be in a form of a salt, and examples of such salt include those similar to the salts of the compound represented by the formula (I).
[1052] Compound (I) may also be used as a payload in an antibody (or peptidic antigen recognition sequence)-drug conjugate (the payload is the moiety corresponding to the above- mentioned drug). When compound (I) is used as a payload, compound (I) may be bonded to an antibody (or a peptidic antigen recognition sequence) via a linker.
[1053] Examples of the above-mentioned payload include
(1) compound (I) wherein B1 is a roup represented by
Figure imgf000119_0001
2
(2) compound (I) wherein B is a roup represented by
Figure imgf000119_0002
[1054] When compound (I) is used as a payload, compound (I) can be converted an antibody
(or peptidic antigen recognition sequence)-drug conjugate, as follows.
(1) B1 in the formula (I) is converted to a group represented by
Figure imgf000120_0001
[1055] B2 in the formula (I) is converted to a group represented by
Figure imgf000120_0002
wherein
Ra and R are each independently
(i) a C1-6 alkyl group,
(ii) an acyl group, or
(iii) a group represented by the formula:
Figure imgf000120_0003
wherein
[1057] R is a linker bonding to an antibody or a peptidic antigen recognition sequence (the bond is a covalent bond between the linker and the functional group in the side chain of the antibody or peptidic antigen recognition sequence), and
[1058] each R is a hydrogen atom or a substituent.
1 2
[1059] (2) R and R in the formula (I) are each independently converted to a group
3 3
represented by the formula: -OR wherein R is
[1060] (l) a Ci-6 alkyl group,
[1061] (ii) an acyl group (preferably a C1-6 alkoxy-carbonyl group), [1062] (iii) a group represented by the formula:
Figure imgf000121_0001
[1063] (iv) a group represented by the formula:
Figure imgf000121_0002
[1064] (v) a group represented by the formula:
Figure imgf000121_0003
[1065] (vi) a group represented by the formula:
Figure imgf000121_0004
[1066] (vii) a group represented by the formula:
Figure imgf000121_0005
[1067] (viii) a group represented by the formula:
Figure imgf000122_0001
d above. nverted to
Figure imgf000122_0002
745]] (c) a group represented by the formula: -SR,
(d) a group represented by the formula:
[1076]
Figure imgf000122_0003
(e) a group represented by the formula:
Figure imgf000123_0001
[1077] (f) a group represented by the formula:
Figure imgf000123_0002
[1078] (g) a group represented by the formula:
Figure imgf000123_0003
[1079] (h) a group represented by the formula:
Figure imgf000123_0004
[1081] (ii) a group represented by the formula: -OR5 wherein R5 is
[1082] (a) a Ci-6 alkyl group, [1083] (b) an acyl group,
[1084] (c) a group represented by the formula:
Figure imgf000124_0001
[1085] a group represented by the formula:
Figure imgf000124_0002
[1086] (e) a group represented by the formula:
Figure imgf000124_0003
[1087] (f) a group represented by the formula:
Figure imgf000124_0004
[1088] (iii) a group represented by the formula: -NHR6 wherein R6 is
[1089] (a) a Ci-6 alkyl group,
[1090] (b) an acyl group,
[1091] (c) a group represented by the formula:
Figure imgf000124_0005
[1092] (d) a group represented by the formula:
Figure imgf000125_0001
[1093] (e) a group represented by the formula:
Figure imgf000125_0002
wherein each R and each R in the formulas are each as defined above.
[1094] In addition, when compound (I) is used as a payload, the linker described in Chem.
Rev., 114, 9154-9218 (2014), Pharma. Res. 32, 3526-3540 (2015), Bioconjugate Chem. 21, 5-13 (2010), The AAPS journal, 17, 339-351 (2015), WO 2011/005761 and the like may be used.
[1095] The disclosure also provides the following particular embodiments.
[1096] Embodiment 1. A compound having Formula (I):
Figure imgf000125_0003
or a pharmaceutically acceptable salt thereof, wherein:
[1097] the partial structure represented by formula (A-l):
Figure imgf000125_0004
)
[1098] is a partial structure represented by formula (IIA), or formula (IIB):
Figure imgf000126_0001
[1099] R1 and R2 are each independently a hydroxy group or a halogen atom;
[1100] B1 is a group represented by formula (B*-A) or formula (B1-B):
Figure imgf000126_0002
[1101] Rlj, R14, R15, R16 and R17 are each independently a hydrogen atom or a substituent;
[1102] Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
[1103] Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
[1104] Rla is a hydrogen atom or a substituent;
[1105] B2 is a group represented by formula (B2-A) or formula (B2-B):
Figure imgf000126_0003
[1106] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1107] Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
[1108] Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
[1109] R2a is a hydrogen atom or a substituent;
[1110] X1 and X2 are each independently an oxygen atom or a sulfur atom; and
[1111] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom.
provided that:
[1112] at least one of B1 or B2 is:
Figure imgf000127_0001
wherein:
[1113] R18 is hydrogen or C1-6 alkyl; and
[1114] R19 a halogen atom.
[1115] Embodiment 2. The compound of Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein R19 is fluoro or chloro.
[1116] Embodiment s. The compound of Embodiments 1 or 2, or a pharmaceutically acceptable salt thereof, having formula X):
Figure imgf000127_0002
[1117] Embodiment 4. The compound of Embodiments 1 or 2, or a pharmaceutically acceptable salt thereof, having formula XI).
Figure imgf000127_0003
[1118] Embodiment s. The compound of any one of Embodiments 1-4, or a pharmaceutically acceptable salt thereof, wherein R1 is a hydroxy group.
[1119] Embodiment 6. The compound of any one of Embodiments 1-4, or a pharmaceutically acceptable salt thereof, wherein R1 is fluoro atom.
[1120] Embodiment 7. The compound of any one of Embodiments 1-3, 5, or 6, or a pharmaceutically acceptable salt thereof, wherein R2 is a hydroxyl group. [1121] Embodiment s. The compound of any one of Embodiments 1-3, 5, or 6, or a pharmaceutically acceptable salt thereof, wherein R2 is a fluoro atom.
[1122] Embodiment 9. The compound of any one of Embodiments 1-8, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
[1123] Embodiment 10. The compound of any one of Embodiments 1-9, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
[1124] Embodiment 11. The compound of any one of Embodiments 1-9, or a pharmaceutically acceptable salt thereof, wherein Q2 is a sulfur atom.
[1125] Embodiment 12. The compound of any one of Embodiments 1-3 or 5-11, or a pharmaceutically acceptable salt thereof having the formula (XII):
Figure imgf000128_0001
[1126] Embodiment 13. The compound of any one of Embodiments 1, 2, 4-6, or 9-11, or a pharmaceutically acceptable salt thereof having the formula (XIII):
Figure imgf000128_0002
[1127] Embodiment 14. The compound of any one of Embodiments 1-13, or a pharmaceutically acceptable salt there :
Figure imgf000128_0003
[1128] Embodiment 15. The compound of any one of Embodiments 1-13, or a pharmaceutically acceptable salt thereof, wherein B2 is:
Figure imgf000129_0001
[1129] Embodiment 16. The compound of any one of Embodiments 2-15, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom.
[1130] Embodiment s. The compound of any one of Embodiments 1-16, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
[1131] Embodiment 18. The compound of any one of Embodiments 1-16, or a
18
pharmaceutically acceptable salt thereof, wherein R is methyl.
[1132] Embodiment 19. The compound of any one of Embodiments 14 or 16-18, or a pharmaceutically acceptable salt thereof, wherein B2 is selected from the rou consisting of:
Figure imgf000129_0002
Figure imgf000130_0001
[1133] each of which is optionally and independently substituted at:
[1134] (i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
[1135] (ii) any available nitrogen atom with a C1-6 alkyl group.
[1136] Embodiment 20. The compound of Embodiment 19, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000130_0002
Figure imgf000131_0001
Embodiment 21. The compound of Embodiment 20, or a pharmaceutically acceptable salt thereof, wherein B2 is selected from the group consisting of:
Figure imgf000132_0002
Embodiment 22. The compound of Embodiment 21, or a pharmaceutically acceptable salt thereof, wherein B2 is selected from the group consisting of:
Figure imgf000132_0003
Embodiment 23. The compound of any one of Embodiments 15-18, or a pharmaceutically acceptable salt thereof, wherein B1 is selected from the group consisting of:
Figure imgf000132_0004
Figure imgf000133_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
Embodiment 24. The compound of Embodiment 23, or a pharmaceutically acceptable salt thereof, wherein B1 is selected from the group consisting of:
Figure imgf000133_0002
Figure imgf000134_0001
Figure imgf000135_0001
Embodiment 25. The compound of Embodiment 24, or a pharmaceutically acceptable salt thereof, wherein B1 is selected from the group consisting of:
Figure imgf000135_0002
[1142] Embodiment 26. The compound of Embodiment 25, or a pharmaceutically acceptable salt thereof, wherein B1 is selected from the group consisting of:
Figure imgf000136_0001
[1143] Embodiment 27. The compound of Embodiment 1, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
Figure imgf000136_0002
Figure imgf000137_0001
Figure imgf000138_0001
Figure imgf000139_0001
Figure imgf000140_0001
Embodiment 28. The compound of Embodiment 27, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
Figure imgf000140_0002
Figure imgf000141_0001
Figure imgf000142_0001
Figure imgf000143_0001
Embodiment 29. The compound of Embodiment 27, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
Figure imgf000144_0001
[1146] Embodiment 30. The compound of any one of Embodiments 1-29, wherein the pharmaceutically acceptable salt is the triethylamine salt or the sodium salt e.g., the di- triethylamine salt or di-sodium salt.
[1147] Embodiment 31. A pharmaceutical composition comprising the compound of any one of Embodiments 1-30, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
[1148] Embodiment 32. A compound having Formula (XIV):
(CD-L)n-A (XIV)
or a pharmaceutically acceptable salt thereof, wherein:
[1149] CD is a group represented by any one of Formula (XX) - (XXIX):
Figure imgf000145_0001
Figure imgf000145_0002
XXIX R 1 and R 2 are each independently a hydroxy group, hydrogen, amino group, or a halogen atom; [1151] B3 and B4 are independently an optionally substituted 5- to 14-membered aromatic heterocyclic group;
[1152] X 1 and X 2 are each independently an oxygen atom, CH2, or a sulfur atom;
[1153] Q1, Q2, Q3 and Q4 are each independently an oxygen atom or a sulfur atom;
[1154] L is a linker;
[1155] A is an antibody, antibody fragment, or antigen-binding fragment; and
[1156] n is 1-10.
[1157] Embodiment 33. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein R1 and R2 are each independently a hydroxy group or a halogen atom.
[1158] Embodiment 34. The compound of Embodiments 32 or 33, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are each independently an oxygen atom or a sulfur atom.
[1159] Embodiment 35. The compound of any one of Embodiments 31-34, or a pharmaceutically acceptable salt thereof, wherein Q1 and Q3 are an oxygen atom.
[1160] Embodiment 36. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX- A):
Figure imgf000146_0001
Embodiment 37. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXI- A):
Figure imgf000146_0002
[1162] Embodiment 38. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXII- A):
Figure imgf000147_0001
XXII-A
Embodiment 39. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIII- A):
Figure imgf000147_0002
ΙΠ-Α
[1164] Embodiment 40. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIV- A):
Figure imgf000147_0003
[1165] Embodiment 41. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXV- A):
Figure imgf000147_0004
XXV-A [1166] Embodiment 42. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVI- A):
Figure imgf000148_0001
[1167] Embodiment 43. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX VII- A):
Figure imgf000148_0002
XXVII-A
[1168] Embodiment 44. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX VIII- A):
Figure imgf000148_0003
XXVIII-A
Embodiment 45. The compound of Embodiment 32, or a pharmaceutically acceptable salt thereof, wherein CD is roup represented by Formula (XXIX- A):
Figure imgf000148_0004
XXIX-A [1170] Embodiment 46. The compound of any one of Embodiments 32-45, or a pharmaceutically acceptable salt thereof, wherein:
[1171] L is -X -T-Z-Q-;
[1172] X3 IS -(CH2)0-,
Figure imgf000149_0001
;
[1173] o is 1, 2, or 3; or
[1174] X is absent;
[1175] T is a peptide, or is absent;
[1176] Z is a spacer;
[1177] Q is a heterobifunctional group or heterotrifunctional group, or is absent.
[1178] Embodiment 47. The compound of Embodiment 46, or a pharmaceutically acceptable salt thereof, having the formula XXX :
Figure imgf000149_0002
[1179] Embodiment 48. The compound of Embodiment 46, or a pharmaceutically acceptable salt thereof, havin the formula (XXXI):
Figure imgf000149_0003
(XXXI). [1180] Embodiment 49. The compound of any one of Embodiments 46-48, or a pharmaceutically acceptable salt thereof, wherein:
[1181] X3 is
Figure imgf000150_0001
[1182]
Figure imgf000150_0002
[1184] R1100aa and R> 1100b are independently selected from the group consisting of hydrogen and optionally substituted C1-6 alkyl.
[1185] Embodiment 50. The compound of Embodiment 49, or a pharmaceutically acceptable
,
[1186] X3
Figure imgf000150_0003
[1187] Embodiment 51. The compound of any one of Embodiments 46-50, or a pharmaceutically acceptable salt thereof, wherein:
O
[1188] Z is ^ m or -(CH2CH20)s-;
[1189] m is 1, 2, 3, 4, 5, or 6; and
[1190] s is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[1191] Embodiment 52. The compound of any one of Embodiments 46-48, or a pharmaceutically acceptable salt thereof, wherein:
[1192] X3 is -CH2-;
Figure imgf000150_0004
[1195] p is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[1196] Embodiment 53. The compound of any one of Embodiments 46-48, or a pharmaceutically acceptable salt thereof, wherein: 3 i -CH2CH2-;
Figure imgf000151_0001
[1199] q is 1, 2, 3, 4, 5, or 6; and
[1200] r is 1, 2, 3, 4, 5, or 6.
[1201] Embodiment 54. The compound of any one of Embodiments 46-53, or a pharmaceutically acceptable salt thereof, wherein:
[1202] Q is a heterobifunctional group selected from the group consisting of:
Figure imgf000151_0002
[1203] R is hydrogen or C1-6 alkyl;
[1204] R30a and R30 are independently selected from the group consisting of hydrogen,
Ci-6 alkyl, halo, -C(=0)OR29, -NH2, Ci-6 alkoxy, -CN, -N02, and -OH;
[1205] R31a and R31 are independently selected from the group consisting of hydrogen,
Ci-6 alkyl, halo, -C(=0)OR29, -NH2, -N(CH3)2, Ci-6 alkoxy, -CN, -N02, and -OH; and
[1206] * indicates the attachment point to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the antibody, antibody fragment, or antigen-binding fragment. Embodiment 55. The compound of Embodiment 51, or a pharmaceutically acce table salt thereof, having formula (XXXII):
Figure imgf000152_0001
(XXXII)
[1208] wherein:
[1209] R10a and R10 are independently Cw alkyl; and
[1210] m is 2, 3, 4, or 5.
[1211] Embodiment 56. The compound of Embodiment 55, or a pharmaceutically acceptable salt thereof having formula (XXXIII):
Figure imgf000152_0002
(ΧΧΧΙΠ)
[1212] wherein p is 4, 5, or 6.
[1213] Embodiment 57. The compound of Embodiment 56, or a pharmaceutically acceptable salt thereof, having formula (XXXIV):
Figure imgf000153_0001
(XXXIV)
[1214] wherein:
[1215] q is 1, 2, or 3; and
[1216] r is 1, 2, or 3.
[1217] Embodiment 58. The compound of any one of Embodiments 32-57, or a pharmaceutically acceptable salt thereof, wherein n is 2-8.
[1218] Embodiment 59. The compound of any one of Embodiments 32-58, or a pharmaceutically acceptable salt thereof, wherein B3 and B4 are independently an optionally substituted 8- to 14-membered fused bicyclic aromatic heterocyclic.
[1219] Embodiment 60. The compound of Embodiment 59, or a pharmaceutically acceptable salt thereof, wherein:
[1220] B3 is a group represented by formula (B3-A) or formula (B3-B):
Figure imgf000153_0002
[1221] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1222] Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
[1223] Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
[1224] Rla is a hydrogen atom or a substituent;
[1225] B4 is a group represented by formula (B4-A) or formula (B4-B):
Figure imgf000154_0001
23 24 25 26 27
[1226] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1227] Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
[1228] Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
[1229] R2a is a hydrogen atom or a substituent.
[1230] Embodiment 61. The compound of any one of Embodiments 32-60, or a pharmaceutically acceptable salt there st one of B3 or B4 is:
Figure imgf000154_0002
[1231] R18 is hydrogen or C1-6 alkyl; and
[1232] R19 is a halogen atom.
[1233] Embodiment 62. The compound of Embodiment 61 , or a pharmaceutically acceptable salt thereof, wherein B is:
Figure imgf000154_0003
[1234] Embodiment 63. The compound of Embodiment 61 , or a pharmaceutically acceptable salt thereof, wherein B4 is:
Figure imgf000154_0004
[1235] Embodiment 64. The compound of any one of Embodiments 61-63, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom. [1236] Embodiment 65. The compound of any one of Embodiments 61-64, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
[1237] Embodiment 66. The compound of any one of Embodiments 61-64, or a
18
pharmaceutically acceptable salt thereof, wherein R is methyl.
[1238] Embodiment 67. The compound of any one of Embodiments 62 or 64-66, or a ph rmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000155_0001
[1239] each of which is optionally and independently substituted at:
[1240] (i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
[1241] (ii) any available nitrogen atom with a C1-6 alkyl group.
[1242] Embodiment 68. The compound of Embodiment 67, or a pharmaceutically acce table salt thereof wherein B4 is selecte from the rou consistin of:
Figure imgf000156_0001
Figure imgf000157_0001
Embodiment 69. The compound of Embodiment 68, or a pharmaceutically acceptable salt thereof, wherein B4is selected from the group consisting of:
Figure imgf000158_0001
Embodiment 70. The compound of Embodiment 69, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000158_0002
] Embodiment 71. The compound of any one of Embodiments 63-66, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000158_0003
Figure imgf000159_0001
[1246] each of which is optionally and independently substituted at:
[1247] (i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
[1248] (ii) any available nitrogen atom with a C1-6 alkyl group.
[1249] Embodiment 72. The compound of Embodiment 71, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000159_0002
Figure imgf000160_0001
Figure imgf000161_0001
Embodiment 73. The compound of Embodiment 72, or a pharmaceutically
Figure imgf000161_0002
Embodiment 74. The compound of Embodiment 73, or a pharmaceutically acceptable salt thereof, where nsisting of:
Figure imgf000161_0003
[1252] Embodiment 75. The compound of any one of Embodiments 32-39, 44, or
46-74, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
[1253] Embodiment 76. The compound of any one of Embodiments 32-39, 44, or
46-74, or a pharmaceutically acceptable salt thereof, wherein Q is a sulfur atom.
[1254] Embodiment 77. The compound of any one of Embodiments 32-35, 40-43, 45,
46, 49-54, or 58-74, or a pharmaceutically acceptable salt thereof, wherein Q4 is an oxygen atom.
[1255] Embodiment 78. The compound of any one of Embodiments 32-35, 40-43, 45,
46, 49-54, or 58-74, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
[1256] Embodiment 79. The compound of any one of Embodiments 32-78, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are an oxygen atom and R1 and
R2 are independently a hydroxy group, a fluoro atom, or a chloro atom.
[1257] Embodiment 80. The compound of any one of Embodiments 32-79, or a pharmaceutically acceptable salt thereof, wherein the antibody is an anti-GCC antibody.
Antibodies that bind to human guanylyl cyclase C (GCC) are disclosed, e.g., in
US 20130315923 and WO 2011050242.
[1258] Embodiment 81. The compound of Embodiment 80, or a pharmaceutically acceptable salt thereof, wherein the antibody is an anti-GCC antibody comprising a heavy chain region comprising amino acid sequence SEQ. ID. No. 1.
[1259] Embodiment 82. The compound of Embodiments 80 or 81, or a pharmaceutically acceptable salt thereof, wherein the antibody is an anti-GCC antibody comprising a light chain region comprising amino acid sequence SEQ. ID. No. 2.
[1260] Embodiment 83. A pharmaceutical composition comprising the compound of any one of Embodiments 32-82, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
[1261] Embodiment 84. A method of treating a patient comprising administering to the patient a therapeutically effective amount of the compound of any one of Embodiments 1-30 or 32-82, or a pharmaceutically acceptable salt thereof, wherein the patient has cancer.
[1262] Embodiment 85. The method of Embodiment 84, wherein the cancer is any one or more of the cancers of Table 7. [1263] Embodiment 86. The method of Embodiment 85, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
[1264] Embodiment 87. The method of any one of Embodiments 84-86 further comprising administering a therapeutically effective amount of a second therapeutic agent useful in the treatment of cancer.
[1265] Embodiment 88. The pharmaceutical composition of Embodiments 31 or 83 for use in treating cancer.
[1266] Embodiment 89. The pharmaceutical composition of Embodiment 88, wherein the cancer is any one or more of the cancers of Table 7.
[1267] Embodiment 90. The pharmaceutical composition of Embodiment 88, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
[1268] Embodiment 91. A compound of any one of Embodiments 1-30 or 32-82, or a pharmaceutically acceptable salt thereof, for use in treatment of cancer.
[1269] Embodiment 92. The compound of Embodiment 91, wherein the cancer is any one or more of the cancers of Table 7.
[1270] Embodiment 93. The compound of Embodiment 91, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
[1271] Embodiment 94. Use of a compound of any one of Embodiments 1-30 or 32-82, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for treatment of cancer.
[1272] Embodiment 95. The use of Embodiment 94, wherein the cancer is any one or more of the cancers of Table 7.
[1273] Embodiment 96. The use of Embodiment 94, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
[1274] Embodiment 97. A kit comprising the compound of any one of Embodiments
1-30 or 32-82, or a pharmaceutically acceptable salt, and instructions for administering the compound, or a pharmaceutically acceptable salt thereof, to a patient having cancer.
[1275] Embodiment 98. The kit of Embodiment 97, wherein the cancer is any one or more of the cancers of Table 7.
[1276] Embodiment 99. The kit of Embodiment 97, wherein the cancer is selected from the group consisting of solid tumor and lymphoma. [1277] Embodiment 100. The kit of any one of Embodiments 97-99 further comprising one or more additional therapeutic agents.
[1278] Embodiment 101. A compound having Formula (XL):
CD-L^R28 (XL)
or a pharmaceutically acceptable salt thereof, wherein:
[1279] CD is a group represented by any one of Formula (XX) - (XXIX):
Figure imgf000164_0001
XXIII XXIV
Figure imgf000164_0002
XXVI XXVII XXVIII or
Figure imgf000165_0001
XXIX
[1280] R1 and R2 are each independently a hydroxy group, hydrogen, amino group, or a halogen atom;
[1281] B3 and B4 are independently an optionally substituted 5- to 14-membered aromatic heterocyclic group;
[1282] X 1 and X 2 are each independently an oxygen atom, CH2, or a sulfur atom;
[1283] Q 1 , Q2 , Q 3 and Q 4 are each independently an oxygen atom or a sulfur atom;
[1284] L1 is a linker;
[1285] R28 is selected from the group consisting of -N3, -ONH2, -OH, -CN, -N02, -CHO, -
NR29C(=0)CH=CH2, -SH, -S(=0)2(CH=CH2), -NR29C(=0)CH2Br, -NR29C(=0)CH2I, - =0)NHNH2, -C02H, -NH2, -C≡CH,
Figure imgf000165_0002
[1286] R2y is hydrogen or Ci-6 alkyl; [1287] R30a and R30 are independently selected from the group consisting of hydrogen,
Ci-6 alkyl, halo, -C(=0)OR29, -NH2, Ci-6 alkoxy, -CN, -N02, and -OH;
[1288] R31a and R31 are independently selected from the group consisting of hydrogen,
Ci-6 alkyl, halo, -C(=0)OR29, -NH2, -N(CH3)2, Ci-6 alkoxy, -CN, -N02, and -OH; and
[1289] the linker is attached to cyclic dinucleotide through any available carbon, nitrogen, oxygen, or sulfur atom.
[1290] Embodiment 102. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein R1 and R2 are each independently a hydroxy group or a halogen atom.
[1291] Embodiment 103. The compound of Emboidments 101 or 102, or a
1 2
pharmaceutically acceptable salt thereof, wherein X and X are each independently an oxygen atom or a sulfur atom
[1292] Embodiment 104. The compound of any one of Embodiments 101-103, or a pharmaceutically acceptable salt thereof, wherein Q1 and Q3 are an oxygen atom.
[1293] Embodiment 105. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX- A):
Figure imgf000166_0001
Embodiment 106. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXI- A):
Figure imgf000166_0002
[1295] Embodiment 107. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXII- A):
Figure imgf000167_0001
XXII-A
Embodiment 108. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIII- A):
Figure imgf000167_0002
ΙΠ-Α
[1297] Embodiment 109. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIV- A):
Figure imgf000167_0003
[1298] Embodiment 110. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXV- A):
Figure imgf000167_0004
XXV-A [1299] Embodiment 111. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVI- A):
Figure imgf000168_0001
[1300] Embodiment 112. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX VII- A):
Figure imgf000168_0002
XXVII-A
[1301] Embodiment 113. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX VIII- A):
Figure imgf000168_0003
XXVIII-A
Embodiment 114. The compound of Embodiment 101, or a pharmaceutically acceptable salt thereof, wherein CD is roup represented by Formula (XXIX- A):
Figure imgf000168_0004
XXIX-A [1303] Embodiment 115. The compound of any one of Embodiments 101-114, or a pharmaceutically acceptable salt thereof, wherein:
1 is -X3-T-Z-;
Figure imgf000169_0001
[1305] o is 1, 2, or 3; or
[1306] X3 is absent;
[1307] T is a peptide, or is absent; and
[1308] Z is a spacer.
[1309] Embodiment 116. The compound of Embodiment 115, or a pharmaceutically acce
Figure imgf000169_0002
[1310] R10a and RlOb are independently selected from the group consisting of hydrogen and optionally substituted C1-6 alkyl.
[1311] Embodiment 117. The compound of Embodiment 116, or a pharmaceutically acceptable
X3
Figure imgf000169_0003
[1312] Embodiment 118. The compound of any one of Embodiments 115-117, or a pharmaceutically acceptable salt thereof, wherein:
O
[1313] Z is ^ m or -(CH2CH20)s-;
[1314] m is 1, 2, 3, 4, 5, or 6; and
[1315] s is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. [1316] Embodiment 119. The compound of Embodiment 115, or a pharmaceutically acceptable salt thereof, wherein:
3 i -CH2-;
Figure imgf000170_0001
p is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[1317] Embodiment 120. The compound of Embodiment 115, or a pharmaceutically acceptable salt thereof, wherein:
3 i -CH2CH2-;
Figure imgf000170_0002
[1320] q is 1, 2, 3, 4, 5, or 6; and
[1321] r is 1, 2, 3, 4, 5, or 6.
[1322] Embodiment 121. The compound of any one of Embodiments 101-120, or a pharmaceutically acceptable salt thereof, wherein B3 and B4 are independently an optionally substituted 8- to 14-membered fused bicyclic aromatic heterocyclic.
[1323] Embodiment 122. The compound of Embodiment 121, or a pharmaceutically acceptable salt thereof, wherein:
B3 is a group represented by formula (B3-A) or formula (B3-B):
Figure imgf000170_0003
[1324] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1325] Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
[1326] Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
[1327] Rla is a hydrogen atom or a substituent;
[1328] B4 is a group represented by formula (B4-A) or formula (B4-B):
Figure imgf000171_0001
[1329] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1330] Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
[1331] Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
[1332] R2a is a hydrogen atom or a substituent.
[1333] Embodiment 123. The compound of any one of Embodiments 101-122, or a pharmaceutically acceptable salt there st one of B3 or B4 is:
Figure imgf000171_0002
[1334] R1S is hydrogen or Ci-6 alkyl; and
[1335] R19 is a halogen atom.
[1336] Embodiment 124. The compound of Embodiment 123, or a pharmaceutically acceptable salt thereof, wherein B is:
Figure imgf000171_0003
[1337] Embodiment 125. The compound of Embodiment 123, or a pharmaceutically acceptable salt thereof, wherein B4 is:
Figure imgf000171_0004
[1338] Embodiment 126. The compound of any one of Embodiments 123-125, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom. [1339] Embodiment 127. The compound of any one of Embodiments 123-126, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
[1340] Embodiment 128. The compound of any one of Embodiments 123-126, or a
18
pharmaceutically acceptable salt thereof, wherein R is methyl.
[1341] Embodiment 129. The compound of any one of Embodiments 124 or 126-128, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000172_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
Embodiment 130. The compound of Embodiment 129, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000173_0001
Figure imgf000174_0001
Embodiment 131. The compound of Embodiment 130, or a pharmaceutically acceptable salt thereof, wherein B4is selected from the group consisting of:
Figure imgf000175_0001
[1344] Embodiment 132. The compound of Embodiment 131, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000175_0002
[1345] Embodiment 133. The compound of any one of Embodiments 125-128, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000175_0003
Figure imgf000176_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
Embodiment 134. The compound of Embodiment 133, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
"
Figure imgf000176_0002
Figure imgf000177_0001
Figure imgf000178_0001
Embodiment 135. The compound of Embodiment 134, or a pharmaceutically
Figure imgf000178_0002
] Embodiment 136. The compound of Embodiment 135, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000179_0001
[1349] Embodiment 137. The compound of any one of Embodiments 101-108, 113, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
[1350] Embodiment 138. The compound of any one of Embodiments 101-108, 113, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q is a sulfur atom.
[1351] Embodiment 139. The compound of any one of Embodiments 101 -104, 109-1 12, 114, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q4 is an oxygen atom.
[1352] Embodiment 140. The compound of any one of Embodiments 101-04, 109-1 12, 114, or 1 15-136, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
[1353] Embodiment 141. The compound of any one of Embodiments 101-142, or a
1 2 1 pharmaceutically acceptable salt thereof, wherein X and X are an oxygen atom and R and RZ are independently a hydroxy group or a halogen atom.
[1354] Embodiment 142. The compound of any one of Embodiments 101-141, wherein
R28 is
Figure imgf000179_0002
[1355] Embodiment 143. The compound of Embodiment 142, selected from the group consisting of:
Figure imgf000180_0001
[1356] Embodiment 144. A compound having Formula (XLI):
(CD-L2)U-DA (XLI)
[1357] or a pharmaceutically acceptable salt thereof, wherein:
[1358] CD is a group represented by any one of Formula (XX) - (XXIX):
Figure imgf000180_0002
XX XXI XXII
Figure imgf000181_0001
Figure imgf000181_0002
XXIX
1 2
[1359] R and R are each independently a hydroxy group, hydrogen, amino group, or a halogen atom;
[1360] B3 and B4 are independently an optionally substituted 5- to 14-membered aromatic heterocyclic group;
[1361] X1 and X2 are each independently an oxygen atom, CH2, or a sulfur atom;
[1362] Q1, Q2, Q3, and Q4 are each independently an oxygen atom or a sulfur atom;
[1363] L is a linker; or
[1364] L is absent;
[1365] DA is a drug delivery agent; and
[1366] u is 1 -1000. [1367] Embodiment 145. The compound of Embodiment 144, or a pharmaceutically
1 2
acceptable salt thereof, wherein R and R are each independently a hydroxy group or a halogen atom.
[1368] Embodiment 146. The compound of Embodiments 144 or 145, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are each independently an oxygen atom or a sulfur atom.
[1369] Embodiment 147. The compound of any one of Embodiments 144-146, or a pharmaceutically acceptable salt thereof, wherein Q1 and Q3 are an oxygen atom.
[1370] Embodiment 148. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX- A):
Figure imgf000182_0001
Embodiment 149. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXI- A):
Figure imgf000182_0002
Embodiment 150. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXII- A):
Figure imgf000183_0001
Embodiment 151. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIII- A):
Figure imgf000183_0002
ΧΧΙΠ-Α
Embodiment 152. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is roup represented by Formula (XXIV- A):
Figure imgf000183_0003
Embodiment 152. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is roup represented by Formula (XXV- A):
Figure imgf000183_0004
Embodiment 153. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX VI- A):
Figure imgf000184_0001
Embodiment 154. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is roup represented by Formula (XXVII- A):
Figure imgf000184_0002
XXVII-A
Embodiment 155. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX VIII- A):
Figure imgf000184_0003
XXVIII-A
Embodiment 156. The compound of Embodiment 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIX- A):
Figure imgf000184_0004
XXIX-A [1380] Embodiment 157. The compound of any one of Embodiments 144-156, or a pharmaceutically acceptable salt thereof, wherein B3 and B4 are independently an optionally substituted 8- to 14-membered fused bicyclic aromatic heterocyclic.
[1381] Embodiment 158. The compound of Embodiment 157, or a pharmaceutically acceptable salt thereof, wherein:
[1382] B3 is a group represented by formula (B3-A) or formula (B3-B):
Figure imgf000185_0001
[1383] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1384] Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
[1385] Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
[1386] Rla is a hydrogen atom or a substituent;
[1387] B4 is a group represented by formula (B4-A) or formula (B4-B):
Figure imgf000185_0002
[1388] R , R , R , R and R are each independently a hydrogen atom or a substituent;
[1389] Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
[1390] Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
[1391] R2a is a hydrogen atom or a substituent.
[1392] Embodiment 159. The compound of any one of Embodiments 144-158, or a pharmaceutically acceptable salt thereof, wherein at least one of B3 or B4 is:
Figure imgf000185_0003
[1393] R18 is hydrogen or Ci-6 alkyl; and
[1394] R19 is a halogen atom.
[1395] Embodiment 160. The compound of Embodiment 159, or a pharmaceutically acceptable salt thereof, wherein B is:
Figure imgf000186_0001
Embodiment 161. The compound of Embodiment 159, or a pharmaceutically acceptable salt thereof, wherein B4 is:
Figure imgf000186_0002
[1397] Embodiment 162. The compound of any one of Embodiments 159-161, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom.
[1398] Embodiment 163. The compound of any one of Embodiments 159-162, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
[1399] Embodiment 164. The compound of any one of Embodiments 159-162, or a pharmaceutically acceptable salt thereof, wherein R18 is methyl.
[1400] Embodiment 165. The compound of any one of Embodiments 159 or 162-164, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000186_0003
Figure imgf000187_0001
[1401] each of which is optionally and independently substituted at:
[1402] (i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
[1403] (ii) any available nitrogen atom with a C1-6 alkyl group.
[1404] Embodiment 166. The compound of Embodiment 165, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000187_0002
Figure imgf000188_0001
Figure imgf000189_0001
Embodiment 168. The compound of Embodiment 167, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000190_0001
Embodiment 169. The compound of any one of Embodiments 161-164, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000190_0002
TO TO TO
~-<C ^ and
Figure imgf000191_0001
[1408] each of which is optionally and independently substituted at:
[1409] (i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
[1410] (ii) any available nitrogen atom with a C1-6 alkyl group.
[1411] Embodiment 170. The compound of Embodiment 169, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000191_0002
"S, " ,
Figure imgf000192_0001
Figure imgf000193_0001
Embodiment 171. The compound of Embodiment 170, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000193_0002
Embodiment 172. The compound of Embodiment 171, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000193_0003
[1414] Embodiment 173. The compound of any one of Embodiments 144-151, 155, or
157-172, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
[1415] Embodiment 174. The compound of any one of Embodiments 144-151, 155, or
157-172, or a pharmaceutically acceptable salt thereof, wherein Q2 is a sulfur atom.
[1416] Embodiment 175. The compound of any one of Embodiments 144-147, 152-154,
156, or 157-172, or a pharmaceutically acceptable salt thereof, wherein Q4 is an oxygen atom.
[1417] Embodiment 176. The compound of any one of Embodiments 144-147, 152-154,
156, or 157-172,, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom. [1418] Embodiment 177. The compound of any one of Embodiments 144-176, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are an oxygen atom and R1 and
Rz are independently a hydroxy group, a fluoro atom, or a chloro atom.
[1419] Embodiment 178. The compound of any one of Embodiments 144-177, or a pharmaceutically acceptable salt thereof, wherein u is 1-100.
[1420] Embodiment 179. The compound of Embodiment 178, or a pharmaceutically acceptable salt thereof, wherein u is 1-10.
[1421] Embodiment 180. The compound of Embodiment 179, or a pharmaceutically acceptable salt thereof, wherein u is 1-5.
[1422] Embodiment 181. The compound of Embodiment 180, or a pharmaceutically acceptable salt thereof, wherein u is 1.
[1423] Embodiment 182. The compound of any one of Embodiments 144-181, or a pharmaceutically acceptable salt thereof, wherein:
2 is -X^T^Z^ ^;
Figure imgf000194_0001
[1426] v is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 ; or
[1427] X4 is absent;
[1428] T1 is a peptide, or is absent;
[1429] Z1 is a spacer;
[1430] QA is a heterobifunctional group or heterotrifunctional group, or is absent.
[1431] Embodiment 183. The compound of Embodiment 182, or a pharmaceutically
Figure imgf000194_0002
O H R10d
N
[1433] T ^11; is i Rl|OUcC O ~ HH ; and
[1434] R10c and R10d are independently selected from the group consisting of hydrogen and optionally substituted C1-6 alkyl. Embodiment 184. The compound of Embodiment 183, or a pharmaceutically acceptable
[1436] X4
Figure imgf000195_0001
[1437] Embodiment 185. The compound of any one of Embodiments 182-184, or a pharmaceutically acceptable salt thereof, wherein:
[1438] Z1 is ¾ m1 or -(CH2CH20)si-;
[1439] mi is 1, 2, 3, 4, 5, or 6; and
[1440] si is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[1441] Embodiment 186. The compound of Embodiment 182, or a pharmaceutically acceptable salt thereof, wherein:
4 is -CH2-;
Figure imgf000195_0002
[1444] pi is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
[1445] Embodiment 187. The compound of Embodiment 182, or a pharmaceutically acceptable salt thereof, wherein:
4 is -CH2CH2-;
Figure imgf000195_0003
qi is 1, 2, 3, 4, 5, or 6; and
ri is 1, 2, 3, 4, 5, or 6.
[1446] Embodiment 188. The compound of any one of Embodiments 182, 186, or 187, or a pharmaceutically acceptable salt thereof, wherein T1 is absent.
[1447] Embodiment 189. The compound of any one of Embodiments 182-188, or a pharmaceutically acceptable salt thereof, wherein QA is a heterobifunctional group selected from the group consisting of:
Figure imgf000196_0001
[1448] R2y is hydrogen or Ci-6 alkyl;
[1449] R30a and R30 are independently selected from the group consisting of hydrogen, Ci-6 alkyl, halo, -C(=0)OR29, -NH2, Ci-6 alkoxy, -CN, -N02, and -OH;
[1450] R31a and R31 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, -N(CH3)2, Ci-6 alkoxy, -CN, -N02, and -OH; and
[1451] * indicates the attachment point to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the drug delivery agent.
[1452] Embodiment 190. The compound of Embodiment 182, or a pharmaceutically acceptable salt thereof, wherein X4, T1, and QA are absent.
[1453] Embodiment 191. The compound of any one of Embodiments 144-190, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises lipids, steroids, vitamins, carbohydrates, proteins, peptides, polyamines, polyethylene glycols, or peptidomimetics, or any combinations thereof.
[1454] Embodiment 192. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises lipids.
[1455] Embodiment 193. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises steroids. [1456] Embodiment 194. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises vitamins.
[1457] Embodiment 195. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises carbohydrates.
[1458] Embodiment 196. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises proteins.
[1459] Embodiment 197. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises peptides.
[1460] Embodiment 198. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises polyamines.
[1461] Embodiment 199. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises polyethylene glycols.
[1462] Embodiment 200. The compound of Embodiment 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises peptidomimetics
[1463] Since compound (I) or a prodrug thereof (in the present specification, sometimes to be collectively abbreviated as "the compound of the present disclosure") has a STING agonistic activity, it may be useful as an agent for the prophylaxis or treatment of cancer, a cancer growth inhibitor or a cancer metastasis inhibitor.
[1464] Since the compound of the present disclosure shows a STING agonistic activity, and is superior in terms of efficacy expression, pharmacokinetics (e.g., absorption, distribution, metabolism, excretion), solubility (e.g., water solubility), interaction with other medicaments (e.g., drug-metabolizing enzyme inhibitory action), safety (e.g., acute toxicity, chronic toxicity, genetic toxicity, reproductive toxicity, cardiotoxicity, carcinogenicity, central toxicity) and stability (e.g., chemical stability, stability to an enzyme), it may be useful as a medicament.
[1465] Therefore, the compound of the present disclosure may be used for increased STING activity in a mammal (e.g., mouse, rat, hamster, rabbit, cat, dog, cow, sheep, monkey, human).
[1466] The compound of the present disclosure may be used as a medicament such as an agent for the prophylaxis or treatment of diseases possibly influenced by STING (in the present specification, sometimes to be abbreviated as "STING-related diseases"), for example, cancers [e.g., colorectal cancers (e.g., colorectal cancer, rectal cancer, anus cancer, familial colorectal cancer, hereditary nonpolyposis colorectal cancer, gastrointestinal stromal tumor), lung cancers (e.g., non-small-cell lung cancer, small-cell lung cancer, malignant mesothelioma), mesothelioma, pancreatic cancers (e.g., pancreatic ductal carcinoma, pancreatic endocrine tumor), pharynx cancer, larynx cancer, esophageal cancer, stomach cancers (e.g., papillary adenocarcinoma, mucinous adenocarcinoma, adenosquamous carcinoma), duodenal cancer, small intestinal cancer, breast cancers (e.g., invasive ductal carcinoma, non-invasive ductal carcinoma, inflammatory breast cancer), ovarian cancers (e.g., ovarian epithelial cancer, extragonadal germ cell tumor, ovarian germ cell tumor, ovarian low-malignant potential tumor), testis tumor, prostate cancers (e.g., hormone- dependent prostate cancer, non-hormone dependent prostate cancer, castration-resistant prostate cancer), liver cancers (e.g., hepatocellular cancer, primary liver cancer, extrahepatic bile duct cancer), thyroid cancers (e.g., medullary thyroid carcinoma), renal cancers (e.g., renal cell cancers (e.g., clear cell renal cell cancer), transitional cell cancer of renal pelvis and ureter), uterine cancers (e.g., cervical cancer, uterine body cancer, uterus sarcoma), gestational choriocarcinoma, brain tumors (e.g., medulloblastoma, glioma, pineal astrocytic tumors, pilocytic astrocytoma, diffuse astrocytoma, anaplastic astrocytoma, pituitary adenoma), retinoblastoma, skin cancers (e.g., basalioma, malignant melanoma), sarcomas (e.g., rhabdomyosarcoma, leiomyosarcoma, soft tissue sarcoma, spindle cell sarcoma), malignant bone tumor, bladder cancer, blood cancers (e.g., multiple myeloma, leukemias (e.g., acute myelogenous leukemia), malignant lymphoma, Hodgkin's disease, chronic myeloproliferative disease), cancer of unknown primary], a cancer growth inhibitor, a cancer metastasis inhibitor, an apoptosis promoter, an agent for the treatment of precancerous lesions (e.g., myelodysplastic syndromes), and the like.
In another embodiment, the cancer is selected from any one or more of the cancers of
Table 7.
Table 7
adrenal cancer lymphoepithelioma
acinic cell carcinoma lymphoma
acoustic neuroma acute lymphocytic leukemia
acral lentigious melanoma acute myelogeous leukemia acrospiroma chronic lymphocytic leukemia acute eosinophilic leukemia liver cancer
acute erythroid leukemia small cell lung cancer acute lymphoblastic leukemia non-small cell lung cancer acute megakaryoblastic leukemia MALT lymphoma
acute monocytic leukemia malignant fibrous histiocytoma acute promyelocytic leukemia malignant peripheral nerve sheath tumor adenocarcinoma malignant triton tumor adenoid cystic carcinoma mantle cell lymphoma
adenoma marginal zone B-cell lymphoma adenomatoid odontogenic tumor mast cell leukemia
adenosquamous carcinoma mediastinal germ cell tumor adipose tissue neoplasm medullary carcinoma of the breast adrenocortical carcinoma medullary thyroid cancer, adult T-cell leukemia/lymphoma medulloblastoma
aggressive NK-cell leukemia melanoma,
AIDS -related lymphoma meningioma,
alveolar rhabdomyosarcoma merkel cell cancer alveolar soft part sarcoma mesothelioma
ameloblastic fibroma metastatic urothelial carcinoma anaplastic large cell lymphoma mixed Mullerian tumor anaplastic thyroid cancer mucinous tumor angioimmunoblastic T-cell lymphoma, multiple myeloma
angiomyolipoma muscle tissue neoplasm angiosarcoma mycosis fungoides astrocytoma myxoid liposarcoma atypical teratoid rhabdoid tumor myxoma
B-cell chronic lymphocytic leukemia myxosarcoma
B-cell prolymphocytic leukemia nasopharyngeal carcinoma
B-cell lymphoma neurinoma basal cell carcinoma neuroblastoma
biliary tract cancer neurofibroma
bladder cancer neuroma
blastoma nodular melanoma bone cancer ocular cancer
Brenner tumor oligoastrocytoma
Brown tumor oligodendroglioma
Burkitt's lymphoma oncocytoma
breast cancer optic nerve sheath meningioma brain cancer optic nerve tumor carcinoma oral cancer carcinoma in situ osteosarcoma
carcinosarcoma ovarian cancer cartilage tumor Pancoast tumor cementoma papillary thyroid cancer myeloid sarcoma paraganglioma chondroma pinealoblastoma chordoma pineocytoma choriocarcinoma pituicytoma
choroid plexus papilloma pituitary adenoma clear-cell sarcoma of the kidney pituitary tumor
craniopharyngioma plasmacytoma
cutaneous T-cell lymphoma polyembryoma
cervical cancer precursor T- lymphoblastic lymphoma colorectal cancer primary central nervous system lymphoma
Degos disease primary effusion lymphoma desmoplastic small round cell tumor preimary peritoneal cancer diffuse large B-cell lymphoma prostate cancer
dysembryoplastic neuroepithelial tumor, pancreatic cancer
dysgerminoma pharyngeal cancer embryonal carcinoma pseudomyxoma periotonei endocrine gland neoplasm renal cell carcinoma endodermal sinus tumor renal medullary carcinoma enteropathy-associated T-cell lymphoma retinoblastoma
esophageal cancer rhabdomyoma fetus in fetu rhabdomyosarcoma fibroma Richter's transformation fibrosarcoma rectal cancer follicular lymphoma sarcoma
follicular thyroid cancer Schwannomatosis
ganglioneuroma seminoma gastrointestinal cancer Sertoli cell tumor
germ cell tumor sex cord-gonadal stromal tumor gestational choriocarcinoma signet ring cell carcinoma giant cell fibroblastoma skin cancer giant cell tumor of the bone small blue round cell tumors glial tumor small cell carcinoma glioblastoma multiforme soft tissue sarcoma
glioma somatostatinoma gliomatosis cerebri soot wart glucagonoma spinal tumor gonadoblastoma splenic marginal zone lymphoma granulosa cell tumor squamous cell carcinoma gynandroblastoma synovial sarcoma gallbladder cancer Sezary's disease gastric cancer small intestine cancer hairy cell leukemia squamous carcinoma hemangioblastoma stomach cancer head and neck cancer T-cell lymphoma hemangiopericytoma testicular cancer hematological malignancy thecoma
hepatoblastoma thyroid cancer hepatosplenic T-cell lymphoma transitional cell carcinoma
Hodgkin's lymphoma throat cancer
non-Hodgkin's lymphoma urachal cancer
invasive lobular carcinoma urogenital cancer
intestinal cancer urothelial carcinoma kidney cancer uveal melanoma laryngeal cancer uterine cancer
lentigo maligna verrucous carcinoma lethal midline carcinoma visual pathway glioma
leukemia vulvar cancer leydig cell tumor vaginal cancer
liposarcoma Waldenstrom's macroglobulinemia lung cancer Warthin's tumor lymphangioma Wilms' tumor lymphangiosarcoma
[1468] In another embodiment, the cancer is a solid tumor or lymphoma.
[1469] Particularly, the compound of the present disclosure may be used as a medicament for colorectal cancer, breast cancer, skin cancer, malignant lymphoma or lung cancer.
[1470] The compound of the present disclosure may be administered orally or parenterally as it is or in a mixture with a pharmacologically acceptable carrier as a medicament, to a mammal (preferably humans).
[1471] The medicament containing the compound of the present disclosure (hereinafter sometimes to be abbreviated as "the medicament of the present disclosure") is explained in detail below. Examples of the dosage form of the medicament of the present disclosure include oral preparations such as tablet (e.g., sugar-coated tablet, film-coated tablet, sublingual tablet, buccal, orally disintegrating tablet), pill, granule, powder, capsule (e.g., soft capsule, microcapsule), syrup, emulsion, suspension, films (e.g., orally disintegrable films, oral mucosa-adhesive film) and the like. In addition, examples of the dosage form of the medicament of the present disclosure include parenteral preparations such as injection, drip infusion, transdermal absorption type preparation (e.g., iontophoresis transdermal absorption type preparation), suppository, ointment, nasal preparation, pulmonary preparation, eye drop and the like. Moreover, the medicament of the present disclosure may be a release control preparation such as an immediate- release preparation, a sustained-release preparation (e.g., a sustained-release microcapsule) and the like.
[1472] As the dosage form of the medicament of the present disclosure, a nanoparticle preparation and a preparation using a bacteria-derived membrane can also be used.
[1473] The medicament of the present disclosure may be prepared according to a method known per se (e.g., the method described in the Japanese Pharmacopoeia etc.) generally used in the field of preparation. In addition, the medicament of the present disclosure may contain a suitable amount of an additive such as a excipient, a binder, a disintegrant, a lubricant, a sweetening agent, a surfactant, a suspending agent, an emulsifier, a colorant, a preservative, an aromatic, a corrigent, a stabilizer, a thickening agent and the like generally used in the field of preparation as necessary. Examples of the pharmacologically acceptable carrier include these additives.
[1474] For example, tablet may be prepared using an excipient, a binder, a disintegrant, a lubricant and the like, and pill or granule may be prepared using an excipient, a binder and a disintegrant. Powder or capsule may be prepared using an excipient and the like, syrup may be prepared using a sweetening agent and the like, and emulsion or suspension may be prepared using a suspending agent, a surfactant, an emulsifier and the like.
[1475] Examples of the excipient include lactose, sucrose, glucose, starch, sucrose, crystalline cellulose, powdered glycyrrhiza, mannitol, sodium hydrogencarbonate, calcium phosphate and calcium sulfate.
[1476] Examples of the binder include 5 to 10 wt% starch liquid paste, 10 to 20 wt% gum arabic solution or gelatin solution, 1 to 5 wt% tragacanth solution, carboxymethyl cellulose solution, sodium alginate solution and glycerin.
[1477] Examples of the disintegrant include starch and calcium carbonate.
[1478] Examples of the lubricant include magnesium stearate, stearic acid, calcium stearate and purified talc. [1479] Examples of the sweetener include glucose, fructose, invert sugar, sorbitol, xylitol, glycerin and simple syrup.
[1480] Examples of the surfactant include sodium lauryl sulfate, polysorbate 80, sorbitan monofatty acid ester and polyoxyl 40 stearate.
[1481] Examples of the suspending agent include gum arabic, sodium alginate, sodium carboxymethyl cellulose, methyl cellulose and bentonite.
[1482] Examples of the emulsifier include gum arabic, tragacanth, gelatin and polysorbate 80.
[1483] For example, when the medicament of present disclosure is a tablet, for example, an excipient (e.g., lactose, sucrose, starch), a disintegrant (e.g., starch, calcium carbonate), a binder (e.g., starch, gum arabic, carboxymethyl cellulose, polyvinyl pyrrolidone, hydroxypropyl cellulose) or a lubricant (e.g., talc, magnesium stearate, polyethylene glycol 6000) is added to the compound of the present disclosure, and the mixture is compression- molded, according to a method known per se, and then where necessary, the molded product is coated according to a method known per se for the purpose of masking of taste, enteric property or durability, to give a tablet. As the coating agent for the coating, for example, hydroxypropylmethyl cellulose, ethyl cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, polyoxyethylene glycol, Tween 80, Pluronic F68, cellulose acetate phthalate, hydroxypropylmethyl cellulose phthalate, hydroxymethyl cellulose acetate succinate, Eudragit (methacrylic acid-acrylic acid copolymer, manufactured by Rohm, DE) and pigment (e.g., iron oxide red, titanium dioxide) may be used.
[1484] Examples of the injection include intravenous injection as well as subcutaneous injection, intracutaneous injection, intramuscular injection, intraperitoneal injection, drip injection and the like.
[1485] Such injections are prepared according to a method known per se, or by dissolving, suspending or emulsifying the compound of the present disclosure in a sterilized aqueous or oily liquid. Examples of the aqueous liquid include physiological saline, isotonic solutions containing glucose or other auxiliary drugs (e.g., D-sorbitol, D-mannitol, sodium chloride) and the like. The aqueous liquid may contain a suitable solubilizing agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant (e.g., polysorbate 80, HCO-50) and the like. Examples of the oily liquid include sesame oil, soybean oil and the like. The oily liquid may contain a solubilizing agent. Examples of the solubilizing agent include benzyl benzoate, benzyl alcohol and the like. In addition, the injection may be blended with a buffer (e.g., phosphate buffer, sodium acetate buffer), a soothing agent (e.g., benzalkonium chloride, procaine hydrochloride), a stabilizer (e.g., human serum albumin, polyethylene glycol), a preservative (e.g., benzyl alcohol, phenol) and the like. A prepared injection may be generally filled in an ampoule.
[1486] While the content of the compound of the present disclosure in the medicament of the present disclosure varies depending on the form of the pharmaceutical preparation, it is generally about 0.01 to about 100 wt%, preferably about 2 to about 85 wt%, more preferably about 5 to about 70 wt%, relative to the entire preparation.
[1487] While the content of the additive in the medicament of the present disclosure varies depending on the form of the pharmaceutical preparation, it is generally about 1 to about 99.9 wt%, preferably about 10 to about 90 wt%, relative to the entire preparation.
[1488] The compound of the present disclosure is stable and low toxic, and may be used safely. While the daily dose of the compound of the present disclosure varies depending on the condition and body weight of patients, the kind of compound, administration route and the like, in the case of, for example, oral administration to patients for the treatment of cancer, the daily dose to an adult (body weight about 60 kg) is about 1 to about 1000 mg, preferably about 3 to about 300 mg, more preferably about 10 to about 200 mg, as the compound of the present disclosure, which may be given in a single administration or administered in 2 or 3 portions a day.
[1489] When the compound of the present disclosure is administered parenterally, it is generally administered in the form of a liquid (e.g., injection). While the dose of the compound of the present disclosure varies depending on the subject of administration, target organ, symptom, administration method and the like, it is, for example, about 0.01 mg to about 100 mg, preferably about 0.01 to about 50 mg, more preferably about 0.01 to about 20 mg, relative to 1 kg body weight, which is preferably given by intravenous injection.
[1490] The compound of the present disclosure may be used concurrently with other drugs.
To be specific, the compound of the present disclosure may be used together with medicaments such as hormonal therapeutic agents, chemotherapeutic agents, immunotherapeutic agents, medicaments inhibiting the action of cell growth factors or cell growth factor receptors and the like. In the following, the drugs that can be used in combination with the compound of the present disclosure are abbreviated as concomitant drugs.
[1491] Examples of the "hormonal therapeutic agents" include fosfestrol, diethylstylbestrol, chlorotrianisene, medroxyprogesterone acetate, megestrol acetate, chlormadinone acetate, cyproterone acetate, danazol, allylestrenol, gestrinone, mepartricin, raloxifene, ormeloxifene, levormeloxifene, anti-estrogens (e.g., tamoxifen citrate, toremifene citrate), pill preparations, mepitiostane, testrolactone, aminoglutethimide, LH-RH agonists (e.g., goserelin acetate, buserelin, leuprorelin, leuprorelin acetate), droloxifene, epitiostanol, ethinylestradiol sulfonate, aromatase inhibitors (e.g., fadrozole hydrochloride, anastrozole, retrozole, exemestane, vorozole, formestane), anti-androgens (e.g., flutamide, bicartamide, nilutamide, enzalutamide), 5a-reductase inhibitors (e.g., finasteride, epristeride, dutasteride), aderenal cortex hormone drugs (e.g., dexamethasone, prednisolone, betamethasone, triamcinolone), androgen synthesis inhibitors (e.g., abiraterone), retinoid and drugs that retard retinoid metabolism (e.g., liarozole), thyroid hormone, and DDS (Drug Delivery System) preparations thereof.
[1492] Examples of the "chemotherapeutic agents" include alkylating agents, antimetabolites, anticancer antibiotics and plant-derived anticancer agents.
[1493] Examples of the "alkylating agents" include nitrogen mustard, nitrogen mustard-N- oxide hydrochloride, chlorambutyl, cyclophosphamide, ifosfamide, thiotepa, carboquone, improsulfan tosylate, busulfan, nimustine hydrochloride, mitobronitol, melphalan, dacarbazine, ranimustine, sodium estramustine phosphate, triethylenemelamine, carmustine, lomustine, streptozocin, pipobroman, etoglucid, carboplatin, cisplatin, miboplatin, nedaplatin, oxaliplatin, altretamine, ambamustine, dibrospidium hydrochloride, fotemustine, prednimustine, pumitepa, ribomustin, temozolomide, treosulphan, trophosphamide, zinostatin stimalamer, adozelesin, cystemustine, bizelesin, and DDS preparations thereof.
[1494] Examples of the "antimetabolites" include mercaptopurine, 6-mercaptopurine riboside, thioinosine, methotrexate, pemetrexed, enocitabine, cytarabine, cytarabine ocfosfate, ancitabine hydrochloride, 5-FU drugs (e.g., fluorouracil, tegafur, UFT, doxifluridine, carmofur, gallocitabine, emitefur, capecitabine), aminopterine, nelzarabine, leucovorin calcium, tabloid, butocine, calcium folinate, levofolinate calcium, cladribine, emitefur, fludarabine, gemcitabine, hydroxycarbamide, pentostatin, piritrexim, idoxuridine, mitoguazone, thiazophrine, ambamustine, bendamustine, and DDS preparations thereof.
[1495] Examples of the "anticancer antibiotics" include actinomycin-D, actinomycin-C, mitomycin-C, chromomycin-A3, bleomycin hydrochloride, bleomycin sulfate, peplomycin sulfate, daunorubicin hydrochloride, doxorubicin hydrochloride, aclarubicin hydrochloride, pirarubicin hydrochloride, epirubicin hydrochloride, neocarzinostatin, mithramycin, sarcomycin, carzinophilin, mitotane, zorubicin hydrochloride, mitoxantrone hydrochloride, idarubicin hydrochloride, and DDS preparations thereof (e.g., doxorubicin-including PEG liposome).
[1496] Examples of the "plant-derived anticancer agents" include etoposide, etoposide phosphate, vinblastine sulfate, vincristine sulfate, vindesine sulfate, teniposide, paclitaxel, docetaxel, cabazitaxel, vinorelbine, and DDS preparations thereof.
[1497] Examples of the "immunotherapeutic agents (BRM)" include picibanil, krestin, sizofiran, lentinan, ubenimex, interferons, interleukins, macrophage colony-stimulating factor, granulocyte colony-stimulating factor, erythropoietin, lymphotoxin, BCG vaccine, Corynebacterium parvum, levamisole, polysaccharide K, procodazole, anti-CTLA4 antibodies (e.g., ipilimumab, tremelimumab), anti-PD-1 antibodies (e.g., nivolumab, pembrolizumab), and anti-PD-Ll antibody.
[1498] Example of the "cell growth factors" in the "medicaments inhibiting the action of cell growth factors or cell growth factor receptors" include any substances that promote cell proliferation, which are normally peptides having not more than 20,000 molecular weight that are capable of exhibiting their activity at low concentrations by binding to a receptor, including (1) EGF (epidermal growth factor) or substances possessing substantially the same activity as EGF [e.g., TGFa], (2) insulin or substances possessing substantially the same activity as insulin [e.g., insulin, IGF (insulin-like growth factor)-l, IGF-2], (3) FGF (fibroblast growth factor) or substances possessing substantially the same activity as FGF [e.g., acidic FGF, basic FGF, KGF (keratinocyte growth factor), FGF-10], and (4) other cell growth factors [e.g., CSF (colony stimulating factor), EPO (erythropoietin), IL-2 (interleukin-2), NGF (nerve growth factor), PDGF (platelet-derived growth factor), TGFP (transforming growth factor β), HGF (hepatocyte growth factor), VEGF (vascular endothelial growth factor), heregulin, angiopoietin]. [1499] Examples of the "cell growth factor receptors" include any receptors capable of binding to the aforementioned cell growth factors, including EGF receptor, heregulin receptor (e.g., HER3), insulin receptor, IGF receptor-1, IGF receptor-2, FGF receptor-1 or FGF receptor-2, VEGF receptor, angiopoietin receptor (e.g., Tie2), PDGF receptor and the like.
[1500] Examples of the "medicaments inhibiting the action of cell growth factors or cell growth factor receptors" include EGF inhibitor, TGFa inhibitor, heregulin inhibitor, insulin inhibitor, IGF inhibitor, FGF inhibitor, KGF inhibitor, CSF inhibitor, EPO inhibitor, IL-2 inhibitor, NGF inhibitor, PDGF inhibitor, TGFp inhibitor, HGF inhibitor, VEGF inhibitor, angiopoietin inhibitor, EGF receptor inhibitor, HER2 inhibitor, HER4 inhibitor, insulin receptor, IGF-1 receptor inhibitor, IGF-2 receptor inhibitor, FGF receptor-1 inhibitor, FGF receptor-2 inhibitor, FGF receptor-3 inhibitor, FGF receptor-4 inhibitor, VEGF receptor inhibitor, Tie-2 inhibitor, PDGF receptor inhibitor, Abl inhibitor, Raf inhibitor, FLT3 inhibitor, c-Kit inhibitor, Src inhibitor, PKC inhibitor, Smo inhibitor, ALK inhibitor, ROR1 inhibitor, Trk inhibitor, Ret inhibitor, mTOR inhibitor, Aurora inhibitor, PLK inhibitor, MEK (MEK1/2) inhibitor, MET inhibitor, CDK inhibitor, Akt inhibitor, ERK inhibitor, PI3K inhibitor and the like. More specifically, anti-VEGF antibody (e.g., Bevacizumab, Ramucurumab), anti-HER2 antibody (e.g., Trastuzumab, Pertuzumab), anti-EGFR antibody (e.g., Cetuximab, Panitumumab, Matuzumab, Nimotuzumab), anti-HGF antibody, Imatinib, Erlotinib, Gefitinib, Sorafenib, Sunitinib, Dasatinib, Lapatinib, Vatalanib, Ibrutinib, Bosutinib, Cabozantinib, Crizotinib, Alectinib, Vismodegib, Axitinib, Motesanib, Nilotinib, 6-[4-(4-ethylpiperazin-l-ylmethyl)phenyl]-N-[l(R)-phenylethyl]-7H-pyrrolo[2,3- d]pyrimidin-4-amine (AEE-788), Vandetanib, Temsirolimus, Everolimus, Enzastaurin, Tozasertib, 2- [N- [3 - [4- [5- [N-(3 -fluorophenyl)carbamoylmethy 1] - 1 H-pyrazol-3 - ylamino]quinazolin-7-yloxy]propyl]-N-ethylamino]ethyl phosphate (AZD-1152), 4-[9- chloro-7-(2,6-difluorophenyl)-5H-pyrimido[5,4-d][2]benzazepin-2-ylamino]benzoic acid, N- [2-methoxy-5-[(E)-2-(2,4,6-trimethoxyphenyl)vinylsulfonylmethyl]phenyl]glycine sodium salt (ON-1910Na), Volasertib, Selumetinib, Trametinib, N-[2(R),3-dihydroxypropoxy]-3,4- difluoro-2-(2-fluoro-4-iodophenylamino)benzamide (PD-0325901), Bosutinib, Regorafenib, Afatinib, Idelalisib, Ceritinib, Dabrafenib and the like may be used. [1501] In addition to the aforementioned drugs, L-asparaginase, L-arginase, arginine deiminase, aceglatone, procarbazine hydrochloride, protoporphyrin-cobalt complex salt, mercuric hematoporphyrin-sodium, topoisomerase I inhibitors (e.g., irinotecan, topotecan, indotecan, Indimitecan), topoisomerase II inhibitors (e.g., sobuzoxane), differentiation inducers (e.g., retinoid, vitamin D), other angiogenesis inhibitors (e.g., humagillin, shark extract, COX-2 inhibitor), a-blockers (e.g., tamsulosin hydrochloride), bisphosphonic acids (e.g., pamidronate, zoledronate), thalidomide, lenalidomide, pomalidomide, azacytidine, decitabine, proteasome inhibitors (e.g.,bortezomib, carfilzomib, ixazomib), NEDD8 inhibitors (e.g., Pevonedistat), UAE inhibitors, PARP inhibitors (e.g., Olaparib, Niraparib, Veliparib), antitumor antibodies such as anti-CD20 antibodies (e.g., Rituximab, Obinutuzumab), anti-CCR4 antibodies (e.g., Mogamulizumab) and the like, antibody-drug conjugates (e.g., trastuzumab emtansine, Brentuximab vedotin) and the like may also be used as a concomitant drug.
[1502] By combining the compound of the present disclosure and a concomitant drug, a superior effect such as (1) the dose may be reduced as compared to single administration of the compound of the present disclosure or a concomitant drug, (2) the drug to be combined with the compound of the present disclosure may be selected according to the condition of patients (mild case, severe case and the like), (3) the period of treatment may be set longer, (4) a sustained treatment effect may be designed, (5) a synergistic effect may be afforded by a combined use of the compound of the present disclosure and a concomitant drug, and the like, may be achieved.
[1503] In the present specification, the compound of the present disclosure and a concomitant drug used in combination are referred to as the "combination agent of the present disclosure".
[1504] For use of the combination agent of the present disclosure, the administration time of the compound of the present disclosure and the concomitant drug is not restricted, and the compound of the present disclosure and the concomitant drug can be administered to an administration subject simultaneously, or may be administered at different times. When administered at a time interval, the interval differs depending on the effective ingredient to be administered, dosage form and administration method, and for example, when the concomitant drug is administered first, the compound of the present disclosure may be administered within time range of from 1 min to 3 days, preferably from 10 min to 1 day, more preferably from 15 min to 1 hr after administration of the concomitant drug. When the compound of the present disclosure is administered first, the concomitant drug is administered within time range of from 1 min to 1 day, preferably from 10 min to 6 hrs, more preferably from 15 min to 1 hr after administration of the compound of the present disclosure. The dosage of the concomitant drug may be determined according to the dose clinically set, and may be appropriately selected depending on the administration subject, administration route, disease, combination and the like.
[1505] Examples of the administration mode of the combined use of the compound of the present disclosure and the concomitant drug include the following methods: (1) The compound of the present disclosure and the concomitant drug are simultaneously produced to give a single preparation, which is then administered. (2) The compound of the present disclosure and the concomitant drug are separately produced to give two kinds of preparations which are administered simultaneously by the same administration route. (3) The compound of the present disclosure and the concomitant drug are separately produced to give two kinds of preparations which are administered by the same administration route at different times. (4) The compound of the present disclosure and the concomitant drug are separately produced to give two kinds of preparations which are administered simultaneously by different administration routes. (5) The compound of the present disclosure and the concomitant drug are separately produced to give two kinds of preparations which are administered by different administration routes at different times (e.g., the compound of the present disclosure and the concomitant drug are administered in this order, or in the reverse order).
[1506] The dose of the concomitant drug may be appropriately determined in accordance with its clinical dose, and the ratio of the compound of the present disclosure and the concomitant drug may be appropriately determined depending on the administration subject, administration route, target disease, symptom, combination, and the like. For example, when the administration subject is human, the concomitant drug is used in 0.01 to 100 (parts by weight), relative to 1 part by weight of the compound of the present disclosure.
[1507] Furthermore, the compound of the present disclosure or the combination agent of the present disclosure may be used concurrently with a non-drug therapy. To be precise, the compound of the present disclosure or the combination agent of the present disclosure may be combined with a non-drug therapy such as (1) surgery, (2) hypertensive chemotherapy using angiotensin II etc., (3) gene therapy, (4) thermotherapy, (5) cryotherapy, (6) laser cauterization and (7) radiotherapy.
[1508] For example, by using the compound of the present disclosure or the combination agent of the present disclosure before or after the above-mentioned surgery and the like, or before or after a combined treatment of two or three kinds thereof, effects such as prevention of emergence of resistance, prolongation of Disease-Free Survival, suppression of cancer metastasis or recurrence, prolongation of life and the like may be afforded.
[1509] In addition, it is possible to combine a treatment with the compound of the present disclosure or the combination agent of the present disclosure with a supportive therapy [(i) administration of antibiotic (e.g., β-lactam type such as pansporin and the like, macrolide type such as clarithromycin and the like) for the complication with various infectious diseases, (ii) administration of high-calorie transfusion, amino acid preparation or general vitamin preparation for the improvement of malnutrition, (iii) administration of morphine for pain mitigation, (iv) administration of a pharmaceutical agent for ameliorating side effects such as nausea, vomiting, anorexia, diarrhea, leucopenia, thrombocytopenia, decreased hemoglobin concentration, hair loss, hepatopathy, Tenopathy, DIC, fever and the like and (v) administration of a pharmaceutical agent for suppressing multiple drug resistance of cancer and the like].
EXAMPLES
[1510] The present disclosure is explained in detail by referring to the following Examples,
Experimental Examples and Formulation Examples, which are not to be construed as limitative, and the disclosure may be changed within the scope of the present disclosure.
[1511] In the following Examples, the "room temperature" generally means about 10°C to about 35°C. The ratios indicated for mixed solvents are volume mixing ratios, unless otherwise specified. % means wt%, unless otherwise specified.
[1512] In silica gel column chromatography, "Diol" means use of 3-(2,3- dihydroxypropoxy)propylsilane-bound silica gel. In silica gel column chromatography and HPLC (high-performance liquid chromatography), "CI 8" means use of octadecyl-bound silica gel. The ratios of elution solvents are volume mixing ratios, unless otherwise specified.
[1513] The measurement by LC/MS was performed under the following conditions [column:
L-Column2 ODS, 3.0 mmI.D. x50 mm, mobile phase: acetonitrile/5 mM ammonium acetate buffer solution = 900/100)].
[1514] In Examples, the following abbreviations are used.
mp: melting point
MS: mass spectrum
[M+H]+, [M-H]": molecular ion peak
M: mol concentration
N: normal
CDCI3: deuterated chloroform
DMSO-de: deuterated dimethyl sulfoxide
D20: deuterated water
1H NMR: proton nuclear magnetic resonance
31P NMR: phosphorus nuclear magnetic resonance
LC/MS: liquid chromatograph mass spectrometer
ESI: ElectroSpray Ionization
APCI: Atomospheric Pressure Chemical Ionization
THF: tetrahydrofuran
DMF: N,N-dimethylformamide
DCM: dichloromethane
[1515] 1H NMR and 31P NMR was measured by Fourier-transform type NMR. For the analysis, ACD/SpecManager (trade name) and the like were used. Peaks with very mild protons such as a hydroxy group, an amino group and the like are not described.
[1516] MS was measured by LC/MS. As ionization method, ESI method or APCI method was used. The data indicates actual measured value (found). Generally, a molecular ion peak is observed. In the case of a compound having a tert-butoxycarbonyl group, a peak after elimination of a tert-butoxycarbonyl group or a tert-butyl group may be observed as a fragment ion. In the case of a compound having a hydroxy group, a peak after elimination of ]¾0 may be observed as a fragment ion. In the case of a salt, a molecular ion peak or fragment ion peak of free form is generally observed.
EXAMPLE 1
Synthesis of 7-((5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15 -fluoro- 2, 10, 16-trihydroxy-2, 10-dioxidooctahydro-12H-5,8-methanofuro[3,2-] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3 ,7-dihydro-4H-pyrrolo[2,3- d]pyrimidin-4-one di-triethylamine salt
Figure imgf000213_0001
A) 7-((2R,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3,4- dihydroxytetrahydrofuran-2-yl)-5-fluoro-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one
17] To a solution of 7-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-
2-yl)-5-fluoro-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one (6.26 g) in pyridine (100 rriL) was added 4,4'-dimethoxytrityl chloride (8.92 g) at room temperature, and the mixture was stirred overnight under argon atmosphere at room temperature. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution, and the mixture was extracted with ethyl acetate. The organic layer was washed successively with saturated aqueous sodium hydrogencarbonate solution and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (8.65 g). MS: [M-H]" 586.0.
B) 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3-0-(tert-butyl(dimethyl)silyl)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
[1518] To a solution of 7-((2R,3R,4S,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-3,4-dihydroxytetrahydrofuran-2-yl)-5-fluoro-3H- pyrrolo[2,3-d]pyrimidin-4(7H)-one (2.65 g) in DMF (20 rriL) were added imidazole (0.614 g) and tert-butyldimethylchlorosilane (0.816 g), and the mixture was stirred overnight at room temperature. The reaction mixture was diluted with water, and extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (1.1 g). MS: [M-H]" 700.2.
C) 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3-0-(tert-butyl(dimethyl)silyl)-2-0-((2- cyanoethoxy)(diisopropylamino)phosphino)-beta-D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one
[1519] 7-(5-0-(Bis(4-methoxyphenyl)(phenyl)methyl)-3-0-(tert-butyl(dimethyl)silyl)-beta- D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (5.43 g) was subjected to azeotropic dehydration three times with anhydrous toluene, and dissolved in anhydrous DMF (15 mL). To the solution were added 3-
((bis(diisopropylamino)phosphino)oxy)propanenitrile (3.19 mL), lH-tetrazole (0.542 g) and 1 -methyl- lH-imidazole (0.306 mL), and the mixture was stirred overnight under argon atmosphere at room temperature, poured into saturated aqueous sodium hydrogencarbonate solution, and extracted with ethyl acetate. The organic layer was washed successively with saturated aqueous sodium hydrogencarbonate solution and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (DIOL, ethyl acetate/hexane). The obtained crude product was purified again by silica gel column chromatography (ethyl acetate/hexane, containing 0.5% triethylamine) to give the title compound (4.22 g) as a mixture of two diastereomers. MS: [M-H]" 901.2. D) (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2-((((((2R,3R,4R,5R)-4-((tert- butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-5- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate
[1520] N-Benzoyl-2'-deoxy-2'-fluoro-3'-0-(hydroxy(oxido)phosphoranyl)adenosine (1.2 g) and 7-(5-0-([bis(4-methoxyphenyl)(phenyl)methyl)]-3-0-([tert-butyl(dimethyl)silyl)]-2-0- ({(2-cyanoethoxy)([diisopropylamino)]phosphino)}-beta-D-ribofuranosyl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (3.4 g) were subjected to azeotropic dehydration with anhydrous acetonitrile, and anhydrous acetonitrile (15 mL) and anhydrous THF (5 mL) were added thereto. To the mixture was added a mixture of 5-(ethylsulfanyl)-2H-tetrazole (1.07 g) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) and anhydrous acetonitrile (10 mL), and the mixture was stirred under argon atmosphere at 55°C for 2 hr. 70% tert-Butyl hydroperoxide aqueous solution (1.12 mL) was added thereto, and the mixture was stirred at room temperature for 20 min. To the reaction mixture was added a mixture of sodium thiosulfate (5920 mg) and water (3 mL), and the mixture was concentrated under reduced pressure. To the residue was added 80% acetic acid (30 mL), and the mixture was stirred at room temperature for 20 min. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (1.1 g). MS: [M+H]+ 952.2
E) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 16-((tert-butyl(dimethyl)silyl)oxy)- 15-fluoro- 7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,10-dihydroxy-2,10- dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6-yl)benzamide
[1521] (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-2-((((((2R,3R,4R,5R)-4-((tert- butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-5- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate (350 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and anhydrous pyridine (15 mL) was added thereto. To the mixture was added 2-chloro-5,5-dimethyl- 1,3,2- dioxaphosphinane 2-oxide (238 mg), and the mixture was stirred under argon atmosphere at room temperature for 1 hr. Water (232 μΕ) and iodine (121 mg) were added thereto, and the mixture was stirred at room temperature for additional 20 min. To the reaction mixture was added a mixture of sodium thiosulfate pentahydrate (91 mg) and water (1 mL), and the mixture was stirred at room temperature for 5 min. Toluene was added thereto, and the mixture was concentrated under reduced pressure. To the residue were added anhydrous acetonitrile (15 mL) and 2-methylpropan-2-amine (5.26 mL), and the mixture was stirred at room temperature for 2 hr, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (332 mg). MS: [M+H]+ 897.1
F) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 16-((tert- butyl(dimethyl)silyl)oxy)-15-fluoro-2,10-dihydroxy-2,10-dioxidooctahydro-12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2, 3-d] pyrimidin-4-one
[1522] To N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 16-((tert-butyl(dimethyl)silyl)oxy)-
15-fluoro-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,10-dihydroxy- 2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2-
1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H-purin-6-yl)benzamide (332 mg) was added 40% methylamine ethanol solution (7.6 mL), and the mixture was stirred under argon atmosphere at room temperature for 1 hr, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate), and the obtained residue was purified by HPLC (L-column2 ODS, 50x150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (106.4 mg). MS: [M+H]+ 793.1
G) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-2, 10,16- trihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt
[1523] To 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 16-((tert- butyl(dimethyl)silyl)oxy)-15-fluoro-2,10-dihydroxy-2,10-dioxidooctahydro-12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (106.4 mg) was added triethylamine trihydrofluoride (1094 uL). The reaction mixture was stirred at 50°C for 1 hr, and cooled to room temperature, ethoxy(trimethyl)silane (6266 μL) was added thereto, and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and to the residue were added ethoxy(trimethyl)silane (6266 μΐ.) and methanol (1 rriL), and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution) to give the title compound (82 mg). 1H NMR (400 MHz, D20) δ 1.18 (18H, t, J = 7.3 Hz), 3.11 (12H, q, J = 7.4 Hz), 4.01-4.14 (2H, m), 4.17-4.26 (1H, m), 4.34 (2H, d, J = 3.4 Hz), 4.42-4.50 (1H, m), 4.54 (1H, d, J = 4.2 Hz), 4.86-4.99 (2H, m), 5.38-5.60 (1H, m), 6.30-6.45 (2H, m), 7.24 (1H, d, J = 2.0 Hz), 7.91 (1H, s), 8.05 (1H, s), 8.17 (1H, s). 31P NMR (162 MHz, D20) δ - 2.16, -1.66.
EXAMPLE la
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15- fluoro-2, 10, 16-trihydroxy-2, 10-dioxidooctahydro- 12H-5,8-methanofuro[3 ,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one disodium salt
Figure imgf000217_0001
Deionized water (480 mL) was passed through a column prepared by packing AG
(trade name) 50W-X8 cation-exchange resin (100-200 mesh, 30 g) in an empty column. Then, 1 M aqueous sodium hydroxide solution (288 mL) and deionized water (540 mL) were passed through the resin. Deionized water (54 mL) containing 7-
((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15-fluoro-2, 10,16- trihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2-
1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (1.53 g) was passed through the resin after the above-mentioned pre-treatment, and deionized water (72 mL) was passed through the resin, and the obtained aqueous solution was freeze-dried to give the title compound (1.28 g). 1H NMR (300 MHz, D20) δ 4.05-4.17 (2H, m), 4.20-4.28 (1H, m), 4.33-4.40 (2H, m), 4.44-4.51 (1H, m), 4.55 (1H, d, J = 4.2 Hz), 4.84-5.01 (2H, m), 5.39-5.61 (1H, m), 6.31- 6.40 (2H, m), 7.25 (1H, d, J = 2.0 Hz), 7.91 (1H, s), 8.07 (1H, s), 8.18 (1H, s). 31P NMR (121 MHz, D20) δ -2.2, -1.6.
EXAMPLE 2
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15- fluoro-10,16-dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000218_0001
A) 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 16-((tert- butyl(dimethyl)silyl)oxy)-15-fluoro-10-hydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer) (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-2-((((((2R,3R,4R,5R)-4-((tert- butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-5- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate (700 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and anhydrous pyridine (50 mL) was added thereto. To the mixture was added 2-chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (475 mg) at room temperature, and the mixture was stirred under argon atmosphere at room temperature for 1 hr. Water (464 μΕ) and 3H- benzo[c][l,2]dithiol-3-one (186 mg) were added thereto, and the mixture was stirred at room temperature for additional 30 min. To the reaction mixture was added a mixture of sodium thiosulfate (913 mg) and water (3 mL), and the mixture was concentrated under reduced pressure. To the residue were added anhydrous acetonitrile (30 mL) and 2-methylpropan-2- amine (10 mL), and the mixture was stirred at room temperature for 1 hr, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate), and to the obtained residue was added 40% methylamine ethanol solution (7.3 niL). The mixture was stirred under argon atmosphere at room temperature for 30 min, and the reaction mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was resolved into two diastereomers (tRl and tR2, retention times of which by LC/MS are from shorter to longer in this order) by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (70 mg, tRl) and the title compound (150 mg, tR2). MS (tRl): [M+H]+ 809.1. MS (tR2): [M+H]+ 809.1
B) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15-fluoro- 10,16- dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer) To 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 16-((tert- butyl(dimethyl)silyl)oxy)-15-fluoro-10-hydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer) (70 mg, derived from tRl) were added methanol (3.0 mL) and triethylamine trihydrofluoride (1.41 mL). The reaction mixture was concentrated to remove the methanol, and the residue was stirred at 55°C for 1 hr. The residue was cooled to room temperature, ethoxy(trimethyl)silane (7.8 mL) was added thereto, and the mixture was stirred at room temperature for 2 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution) to give the title compound (56 mg). 1H NMR (400 MHz, D20) δ 1.23 (18H, t, J = 7.3 Hz), 3.15 (12H, q, J = 7.3 Hz), 4.15-4.23 (3H, m), 4.37-4.50 (2H, m), 4.54 (1H, d, J = 10.3 Hz), 4.61 (1H, d, J = 3.9 Hz), 4.96 (2H, dt, J = 7.9, 3.9 Hz), 5.77-5.95 (1H, m), 6.36 (1H, d, J = 8.1 Hz), 6.40 (1H, d, J = 15.4 Hz), 7.51 (1H, d, J = 1.7 Hz), 7.99 (2H, d, J = 13.7 Hz), 8.23 (1H, s). 31P NMR (162 MHz, D20) δ-2.43, 54.03.
EXAMPLE 3
Synthesis of 7-((2R, 5RJR, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- fluoro-10,16-dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one 1.7 triethylamine salt
Figure imgf000220_0001
7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 16-((tert- butyl(dimethyl)silyl)oxy)-15-fluoro-10-hydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer) (150 mg, derived from tR2) were added methanol (3.0 mL) and triethylamine trihydrofluoride (3.02 mL). The reaction mixture was concentrated to remove the methanol, and the residue was stirred at 55°C for 1 hr. The residue was cooled to room temperature, ethoxy(trimethyl)silane (16.4 mL) was added thereto, and the mixture was stirred at room temperature for 2 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution) to give the title compound (155 mg). 1H NMR (400 MHz, D20) δ 1.23 (15H, t, J = 7.3 Hz), 3.15 (10H, q, J = 7.3 Hz), 4.06 (1H, dd, J = 11.7, 4.9 Hz), 4.18 (1H, dd, J = 11.6, 2.8 Hz), 4.29-4.47 (3H, m), 4.51 (1H, d, J = 8.8 Hz), 4.58 (1H, d, J = 3.9 Hz), 4.93-5.14 (2H, m), 5.44-5.64 (1H, m), 6.33-6.45 (2H, m), 7.32 (1H, d, J = 1.5 Hz), 7.95 (1H, s), 8.06 (1H, s), 8.24 (1H, s). 31P NMR (162 MHz, D20) δ-2.41,55.33.
EXAMPLE 3a
Synthesis of 7-((2R, 5RJR, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- fluoro-10,16-dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one disodium salt
Figure imgf000220_0002
[1528] Deionized water (400 mL) was passed through a column prepared by packing AG
(trade name) 50W-X8 cation-exchange resin (100-200 mesh, 25.3 g) in an empty column. Then, 1 M aqueous sodium hydroxide solution (240 mL) and deionized water (450 mL) were passed through the resin. Deionized water (45 mL) containing 7-
((2R, 5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -fluoro- 10,16- dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (1.30 g) was passed through the resin after the above-mentioned pre-treatment, and deionized water (60 mL) was passed through the resin to give an aqueous solution containing the title compound.
[1529] Deionized water (400 mL) was passed through a column prepared by packing AG
(trade name) 50W-X8 cation-exchange resin (100-200 mesh, 26.3 g) in an empty column. Then, 1 M aqueous sodium hydroxide solution (270 mL) and deionized water (540 mL) were passed through the resin. Deionized water (54 mL) containing 7-
((2R, 5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -fluoro- 10,16- dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (1.18 g) was passed through the resin after the above-mentioned pre-treatment, and deionized water (63 mL) was passed through the resin to give an aqueous solution containing the title compound. The two aqueous solutions containing the title compound were combined, and freeze-dried to give the title compound (2.0 g). 1H NMR (300 MHz, D20) δ 3.97-4.07 (1H, m), 4.11-4.20 (1H, m), 4.27- 4.42 (3H, m), 4.43-4.51 (1H, m), 4.55 (1H, d, J = 3.8 Hz), 4.88-5.12 (2H, m), 5.34-5.59 (1H, m), 6.30-6.40 (2H, m), 7.28 (1H, d, J = 1.9 Hz), 7.91 (1H, s), 8.01 (1H, s), 8.18 (1H, s). 31P NMR (121 MHz, D20) δ -2.38, 55.3.
EXAMPLE 4
Synthesis of 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-purin-9-y 1)-
2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt
Figure imgf000222_0001
A) (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-((tert-butyldimethylsilyl)oxy)-2- ((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3- d]pyrimidin-7(4H)-yl)-5-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3 -yl hydrogen phosphonate
0] N-Benzoyl-2'-0-(tert-butyl(dimethyl)silyl)-3'-0-
(hydroxy(oxido)phosphoranyl)adenosine (369 mg) and 7-(5-0-(bis(4- methoxyphenyl)(phenyl)methyl)-3-0-(tert-butyl(dimethyl)silyl)-2-0-((2- cyanoethoxy)(diisopropylamino)phosphino)-beta-D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (817 mg) were subjected to azeotropic dehydration with anhydrous acetonitrile (three times), and suspended in anhydrous acetonitrile (3.6 mL) and anhydrous THF (1.2 mL). To the suspension was added a mixture of 5-(ethylsulfanyl)-2H- tetrazole (262 mg) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) and anhydrous acetonitrile (2.4 mL), and the mixture was stirred under argon atmosphere at room temperature for 1.5 hr. To the reaction solution was added 70% tert- butyl hydroperoxide aqueous solution (0.276 mL), and the mixture was stirred at room temperature for additional 40 min. The reaction mixture was quenched with sodium thiosulfate (636 mg) and water (2 mL), and the solvent was evaporated under reduced pressure. The residue was dissolved in 80% acetic acid (5 mL), and the solution was stirred at room temperature for 2.5 hr. The reaction mixture was concentrated under reduced pressure, and the residue was subjected to azeotropic dehydration with anhydrous acetonitrile and toluene. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (538 mg). MS: [M+H]+ 1064.3.
B) N-(9-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 15 , 16-bis((tert-butyl(dimethyl)silyl)oxy)- 10- (2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2- hydroxy-2, 10-dioxidooctahydro-l 2H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6-yl)benzamide
[1531] (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-4-((tert-butyldimethylsilyl)oxy)-2- ((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3- d]pyrimidin-7(4H)-yl)-5-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate (538 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (12 mL). 2-Chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (327 mg) was added thereto, and the mixture was stirred at room temperature for 1 hr. Water (0.319 mL) and iodine (167 mg) were added thereto, and the mixture was stirred at room temperature for additional 30 min. The reaction mixture was quenched with sodium thiosulfate (208 mg) and water (2 mL), and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (509 mg). MS: [M+H]+ 1062.3.
C) 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15,16-bis((tert- butyl(dimethyl)silyl)oxy)-2,10-dihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one
[1532] N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-Bis((tert- butyl(dimethyl)silyl)oxy)-10-(2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-2, 10-dioxidooctahydro-l 2H-5, 8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H-purin-6-yl)benzamide (509 mg) was dissolved in 33% methylamine ethanol solution (10 mL), the solution was stirred under argon atmosphere at room temperature for 1 hr, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (227 mg). MS: [M+H]+ 905.2.
D) 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-punn-9-yl)-2, 10,15,16- tetrahydroxy-2, 10-dioxidooctahydro- 12H-5, 8-methanofuro[3 ,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt To 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15,16- bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dihydroxy-2, 10-dioxidooctahydro- 12H-5, 8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (227 mg) was added triethylamine trihydrofluoride (0.818 mL), and the mixture was stirred at 50°C for 5 hr. The solvent was evaporated under reduced pressure, the residue was neutralized with 1 M aqueous triethylammonium bicarbonate solution, and the solvent was again evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained solid was freeze- dned to give the title compound (103 mg). 1H NMR (300 MHz, D20) 51.26 (18H, t, J = 7.4 Hz), 3.18 (12H, q, J = 7.4 Hz), 4.06-4.29 (3H, m), 4.34-4.52 (3H, m), 4.62 (1H, d, J = 3.8 Hz), 4.69-4.83 (1H, m), 4.84-4.95 (1H, m), 4.98-5.09 (1H, m), 6.14 (1H, d, J = 1.5 Hz), 6.41 (1H, dd, J = 8.3, 1.5 Hz), 7.33 (1H, d, J = 1.9 Hz), 7.99 (1H, s), 8.16 (1H, s), 8.25 (1H, s). 31P NMR (121 MHz, D20) δ-1.96,-1.21.
EXAMPLE 5
7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-purin-9-yl)- 15,16-dihydroxy-2, 10- dioxido-2, 10-disulfanyloctahydro- 12H-5 , 8-methanofuro [3 ,2- lJ [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt optical isomer)
Figure imgf000225_0001
>rVF
Figure imgf000225_0002
A) 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3-0-(tert-butyl(dimethyl)silyl)-2-0- (hydroxy(oxido)phosphoranyl)-beta-D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3- d]pyrimidin-4-one
] 7-(5-0-(Bis(4-methoxyphenyl)(phenyl)methyl)-3-0-(tert-butyl(dimethyl)silyl)-beta- D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (835 mg) was dissolved in pyridine (4 mL), and diphenyl phosphite (0.456 mL) was added thereto. The mixture was stirred at room temperature for 2 hr. Water (1 mL) and hydroxide ammonium (2 mL) were added thereto. The mixture was stirred at room temperature for 30 min, and the reaction mixture was diluted with water, and extracted with ethyl acetate. The extract was dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (611 mg). MS: [M-H]" 764.1.
B) 7-(3-0-(tert-butyl(dimethyl)silyl)-2-0-(hydroxy(oxido)phosphoranyl)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
[1535] A mixture of 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3-0-(tert- butyl(dimethyl)silyl)-2-0-(hydroxy(oxido)phosphoranyl)-beta-D-ribofuranosyl)-5-fluoro- 3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (611 mg) and 80% acetic acid (4 mL) was stirred at room temperature for 2 hr. The reaction mixture was diluted with methanol, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (358 mg). MS: [M+H]+ 464.1.
C) (2R,3R,4R,5R)-5-((((((2R,3R,4R,5R)-5-(6-benzamido-9H-punn-9-yl)-4-((tert- butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-2-(5-fluoro-4- oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1536] A mixture of 7-(3-0-(tert-butyl(dimethyl)silyl)-2-0-(hydroxy(oxido)phosphoranyl)- beta-D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (358 mg) and N-benzoyl-5'-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2'-0-(tert-butyl(dimethyl)silyl)-3'-0- ((2-cyanoethoxy)(diisopropylamino)phosphino)adenosine (1.02 g) was subjected to azeotropic dehydration with anhydrous acetonitrile, and suspended in anhydrous acetonitrile (10 mL). Pyridine 2,2,2-trifluoroacetate (386 mg) was added thereto, and the mixture was stirred under argon atmosphere at room temperature for 1 hr. ((Dimethylamino- methylidene)amino)-3H-l,2,4-dithiazoline-3-thione (199 mg) was added thereto, and the mixture was stirred at room temperature for additional 30 min. The reaction mixture was quenched with a aqueous solution (2.5 mL) of sodium thiosulfate (250 mg), and the solvent was evaporated under reduced pressure. The residue was dissolved in 1,1,1,3,3,3- hexafluoropropan-2-ol (10 mL), the solution was stirred at room temperature for 30 min, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (328 mg). MS: [M+H]+ 1080.3. D) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2- (2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-10-oxido- 10-sulfanyl-2-sulfidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6-yl)benzamide
(optical isomer)
[1537] To a mixture of (2R,3R,4R,5R)-5-((((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9- yl)-4-((tert-butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-2-(5-fluoro-4- oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate (328 mg) and anhydrous pyridine (10 rriL) was added 2-chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (196 mg). The mixture was stirred under argon atmosphere at room temperature for 30 min, water (0.5 mL) and 3H-benzo[c][l,2]dithiol-3-one (61 mg) were added thereto, and the mixture was stirred at room temperature for 1 hr. The reaction mixture was diluted with saturated aqueous sodium bicarbonate solution, and extracted with ethyl acetate. The extract was dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate), and then purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile) to give the title compound (optical isomer) (92 mg, tR4). MS: [M+H]+ 1094.3.
E) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15, 16-bis((tert- butyl(dimethyl)silyl)oxy)-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1538] N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-Bis((tert- butyl(dimethyl)silyl)oxy)-2-(2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)- 10-oxido- 10-sulfanyl-2-sulfidooctahydro- 12H-5, 8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H-purin-6-yl)benzamide (optical isomer) (90 mg) was dissolved in 40% methylamine-methanol solution (3.0 mL), the solution was stirred under argon atmosphere at room temperature for 1 hr, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (32 mg). MS: [M+H]+ 937.1. F) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-punn-9-yl)- 15, 16-dihydroxy- 2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer) A mixture of 7-((5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(6-amino-9H-purin-9-yl)-
15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer) (32 mg) and triethylamine trihydrofluoride (0.12 mL) was stirred at 50°C for 3 hr. The mixture was cooled to room temperature, and neutralized with 1 M aqueous triethylammonium bicarbonate solution, and the solvent was evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile). The obtained solid was freeze-dried to give the title compound (21 mg). 1H NMR (300 MHz, D20) 51.23 (18H, t, J = 7.3 Hz), 3.15 (12H, q, J = 7.4 Hz), 3.99-4.09 (1H, m), 4.23-4.30 (2H, m), 4.30-4.41 (2H, m), 4.41-4.45 (1H, m), 4.47-4.54 (1H, m), 4.83-4.88 (2H, m), 4.96-5.13 (3H, m), 6.11 (1H, d, J = 1.1 Hz), 6.36 (1H, d, J = 7.4 Hz), 7.31 (1H, d, J = 1.9 Hz), 7.95 (1H, s), 8.11 (1H, s), 8.22 (1H, s). 31P NMR (121 MHz, D20) 552.25, 54.88.
EXAMPLE 6
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)-7-(6-amino-9H-purin-9-yl)- 15,16- dihydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000229_0001
A) 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert-butyl(dimethyl)silyl)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
To a solution of 7-((2R,3R,4S,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-3,4-dihydroxytetrahydrofuran-2-yl)-5-fluoro-3H- pyrrolo[2,3-d]pyrimidin-4(7H)-one (2.65 g) in DMF (20 rriL) were added imidazole (0.614 g) and tert-butyldimethylchlorosilane (0.816 g), and the mixture was stirred overnight at room temperature. The reaction mixture was diluted with water, and extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (1.2 g). MS: [M-H]" 700.3. B) 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert-butyl(dimethyl)silyl)-3-0-((2- cyanoethoxy)(diisopropylamino)phosphino)-beta-D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one
[1541] 7-(5-0-(Bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert-butyl(dimethyl)silyl)-beta- D-ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (2.37 g) was dissolved in DMF (6.75 niL), and to the solution were added 3- ((bis(diisopropylamino)phosphino)oxy)propanenitrile (2.15 mL), lH-tetrazole (0.237 g) and 1 -methyl- lH-imidazole (0.134 mL), and the mixture was stirred under argon atmosphere at room temperature for 20.5 hr. To the reaction solution was added saturated aqueous sodium bicarbonate solution, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane, containing 0.5% triethylamine) to give the title compound (2.67 g). MS: [M-H]" 900.2.
C) 7-(2-0-(tert-butyl(dimethyl)silyl)-3-0-(hydroxy(oxido)phosphoranyl)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
[1542] 7-(5-0-(Bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert-butyl(dimethyl)silyl)-3-0- ((2-cyanoethoxy)(diisopropylamino)phosphino)-beta-D-ribofuranosyl)-5-fluoro-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one (1.54 g) was dissolved in acetonitrile (15 mL), pyridine 2,2,2-trifluoroacetate (0.396 g) and water (0.062 mL) were added thereto at room temperature, and the mixture was stirred at room temperature for 50 min. To the reaction solution was added 2-methylpropan-2-amine (8.07 mL) at room temperature, and the mixture was stirred at room temperature for 30 min. The reaction mixture was concentrated under reduced pressure, to the residue was added 80% acetic acid (8.54 mL), and the mixture was stirred at room temperature for 1 hr.
[1543] Similarly, 7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert- butyl(dimethyl)silyl)-3-0-((2-cyanoethoxy)(diisopropylamino)phosphino)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (1.13 g) was dissolved in acetonitrile (10 mL), and pyridine 2,2,2-trifluoroacetate (0.290 g) and water (0.045 mL) were added thereto at room temperature, and the mixture was stirred at room temperature for 50 min. To the reaction solution was added 2-methylpropan-2-amine (5.92 mL) at room temperature, and the mixture was stirred at room temperature for 30 min. The reaction mixture was concentrated under reduced pressure, to the residue was added 80% acetic acid (6.27 mL), and the mixture was stirred at room temperature for 1 hr.
[1544] The reaction mixtures were combined, and concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (961 mg). MS: [M+H]+ 464.0.
D) (2R,3R,4R,5R)-2-((((((2R,3R,4R,5R)-2-(6-benzamido-9H-punn-9-yl)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-5-(5-fluoro-4- oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1545] 7-(2-0-(tert-Butyl(dimethyl)silyl)-3-0-(hydroxy(oxido)phosphoranyl)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (400 mg) and N- benzoyl-5'-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3'-0-(tert-butyl(dimethyl)silyl)-2'-0- ((2-cyanoethoxy)(diisopropylamino)phosphino)adenosine (1.02 g) were subjected to azeotropic dehydration with anhydrous acetonitrile (three times), and was suspended in anhydrous acetonitrile (6 mL). Pyridine 2,2,2-trifluoroacetate (333 mg) was added thereto, and the mixture was stirred under argon atmosphere at room temperature for 1 hr. (Dimethylamino-methylidene)amino)-3H-l,2,4-dithiazoline-3-thione (195 mg) was added thereto, and the mixture was stirred at room temperature for additional 30 min. The reaction mixture was quenched with sodium thiosulfate (316 mg) and water (0.5 mL), and the solvent was evaporated under reduced pressure. The residue was dissolved in 1,1,1,3,3,3- hexafluoropropan-2-ol (5 mL), and the solution was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was subjected to azeotropic dehydration with anhydrous acetonitrile and toluene. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (556 mg). MS: [M+H]+ 1080.3. E) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15,16-bis((tert-butyl(dimethyl)silyl)oxy)- 10- (2-cyanoethoxy)-14-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2- hydroxy-2,10-disulfidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-9H-purin-6-yl)benzamide (optical isomer)
[1546] ((2R,3R,4R,5R)-2-((((((2R,3R,4R,5R)-2-(6-Benzamido-9H-purin-9-yl)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-5-(5-fluoro-4- oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate (556 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and dissolved in anhydrous pyridine (15 rriL). To the solution was added 2-chloro- 5,5-dimethyl-l,3,2-dioxaphosphinane 2-oxide (332 mg) at room temperature, and the mixture was stirred under argon atmosphere at room temperature for 30 min. Water (1 mL) and 3H- l,2-benzodithiol-3-one (108 mg) were added thereto, and the mixture was stirred at room temperature for additional 1 hr. To the reaction mixture was added saturated aqueous sodium bicarbonate solution, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/methanol). The obtained residue was resolved into four diastereomers (tRl , tR2, tR3 and tR4, retention times of which by LC/MS are from shorter to longer in this order) by HPLC (L-column2 ODS, 50x150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (120 mg, tR2) and the title compound (183 mg, tR4). tR2 MS: [M+H]+ 1094.3. tR4 MS: [M+H]+ 1094.3.
F) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16-bis((tert- butyl(dimethyl)silyl)oxy)-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacy clotetradecin-14-yl)-5-fluoro-3, 7-dihy dro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1547] N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-Bis((tert- butyl(dimethyl)silyl)oxy)-10-(2-cyanoethoxy)-14-(5-fluoro-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-2-oxido-2-sulfanyl-10-sulfidooctahydro-12H-5,8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin-7-yl)-9H-purin-6- yl)benzamide (optical isomer, derived from tR2) (120 mg) was dissolved in 33% methylamine ethanol solution (5.0 mL), the solution was stirred under argon atmosphere at room temperature for 1.5 hr, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (84.4 mg). MS: [M+H]+ 937.2.
G) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16-dihydroxy- 2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
To 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16- bis((tert-butyl(dimethyl)silyl)oxy)-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin- 14-y l)-5 -fluoro-3 ,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer, derived from tR2) (84.4 mg) was added triethylamine trihydrofluoride (0.294 mL), and the mixture was stirred at 50°C for 2 hr. The reaction solution was cooled to room temperature, and neutralized with 1 M aqueous triethylammonium bicarbonate solution, and the solvent was evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained solid was freeze- dned to give the title compound (58.4 mg). 1H NMR (300 MHz, D20) δ 1.26 (18H, t, J = 7.4
Hz), 3.18 (12H, q, J = 7.3 Hz), 3.94-4.05 (1H, m), 4.10-4.20 (1H, m), 4.28-4.45 (2H, m), 4.50 (2H, brs), 4.59 (1H, d, J = 4.2 Hz), 4.71-4.81 (1H, m), 5.32 (2H, d, J = 10.6 Hz), 6.23- 6.32 (2H, m), 7.17 (1H, d, J = 2.3 Hz), 8.05 (1H, s), 8.20 (1H, s), 8.66 (1H, s). 31P NMR (121 MHz, D20) 555.8,59.2.
EXAMPLE 7
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)-7-(6-amino-9H-purin-9-yl)- 15,16- dihydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000233_0001
A) 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16-bis((tert- butyl(dimethyl)silyl)oxy)-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1549] N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-Bis((tert- butyl(dimethyl)silyl)oxy)-10-(2-cyanoethoxy)-14-(5-fluoro-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-2-oxido-2-sulfanyl-10-sulfidooctahydro-12H-5,8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin-7-yl)-9H-purin-6- yl)benzamide (optical isomer, derived from tR4) (183 mg) was dissolved in 33% methylamine ethanol solution (5.0 mL), the solution was stirred under argon atmosphere at room temperature for 1 hr, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (107 mg). MS: [M+H]+ 937.1.
B) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16-dihydroxy- 2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
[1550] To 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16- bis((tert-butyl(dimethyl)silyl)oxy)-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin- 14-y l)-5 -fluoro-3 ,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer, derived from tR4) (107 mg) was added triethylamine trihydrofluoride (0.372 mL), and the mixture was stirred at 50°C for 2.5 hr. The reaction solution was cooled to room temperature, and neutralized with 1 M aqueous triethylammonium bicarbonate solution, and the solvent was evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained solid was freeze- dned to give the title compound (78 mg). 1H NMR (300 MHz, D20) δ 1.26 (18H, t, J = 7.4 Hz), 3.18 (12H, q, J = 7.2 Hz), 4.09-4.18 (1H, m), 4.21-4.29 (2H, m), 4.33-4.43 (1H, m), 4.51 (2H, brs), 4.65-4.71 (1H, m), 4.89 (1H, d, J = 4.2 Hz), 4.99-5.11 (1H, m), 5.29-5.42 (1H, m), 6.23-6.31 (2H, m), 7.00 (1H, d, J = 1.9 Hz), 8.03 (1H, s), 8.17 (1H, s), 8.56 (1H, s). 31P NMR (121 MHz, D20) 552.8,55.1. EXAMPLE 8
Synthesis of 2-amino-9-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(4-amino-5-fluoro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro- 12H-5,8- methanofuro[3,2-l] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H- purin-6-one di-triethylamine salt
Figure imgf000235_0001
Figure imgf000235_0002
A) N-(7-((2R,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3,4- dihydroxytetrahydrofuran-2-yl)-5-fluoro-7H-pyrrolo[2,3-d]pyrimidin-4-yl)benzamide (2R,3R,4R,5R)-2-((Benzoyloxy)methyl)-5-(4-chloro-5-fluoro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)tetrahydrofuran-3,4-diyl dibenzoate (14.09 g) was charged into 17 seal tube containers in 17 parts, and 2 M ammonia isopropanol solution (20 mL) was added thereto, respectively. Each mixture was stirred with microwave irradiation at 130°C for 5 hr. The obtained mixtures were combined, and concentrated under reduced pressure. The obtained residue was subjected to azeotropic evaporation twice with toluene to remove the solvent, pyridine (100 mL) was added thereto, and the mixture was cooled to 0°C. Benzoyl chloride (26.6 mL) was added thereto at 0°C, and the mixture was stirred overnight at room temperature. To the reaction mixture was added water, and the mixture was extracted with ethyl acetate. The extract was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (ethyl acetate/hexane). To the obtained compound were added pyridine (350 rriL) and ethanol (100 rriL), and the mixture was cooled to 0°C. 1 M Aqueous sodium hydroxide solution (103 mL) was added thereto, and the mixture was stirred at 0°C for 1 hr. 1 M Aqueous sodium hydroxide solution (45.7 mL) was added again thereto, and the mixture was stirred at 0°C for 1 hr. To the reaction mixture was added strong acidic cation-exchange resin DOWEX vi 50Wx4 100-200 (95 g) at room temperature, the solid was removed by filtration, and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate). To the obtained product (5.71 g) were added pyridine (60 mL) and 4,4'-dimethoxytrityl chloride (5.98 g), and the mixture was stirred at room temperature for 4 hr. 4,4'-Dimethoxytrityl chloride (5.98 g) was added again thereto, and the mixture was stirred at room temperature for 1 hr. The mixture was concentrated under reduced pressure, water was added thereto, and the mixture was extracted with ethyl acetate. The extract was washed with water and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (8.50 g). MS: [M+H]+ 691.2.
B) N-(7-((2R,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3-((tert- butyldimethylsilyl)oxy)-4-hydroxytetrahydrofuran-2-yl)-5-fluoro-7H-pyrrolo[2,3- d] pyrimidin-4-yl)benzamide
To a mixture of N-(7-((2R,3R,4S,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-3,4-dihydroxytetrahydrofuran-2-yl)-5-fluoro-7H- pyrrolo[2,3-d]pyrimidin-4-yl)benzamide (7.51 g) and DMF (30 mL) were added imidazole (1.924 g) and tert-butyldimethylchlorosilane (2.13 g), and the mixture was stirred overnight at room temperature. To the reaction mixture was added water, and the mixture was extracted with ethyl acetate. The extract was washed with water and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (2.94 g). MS, found: 501.2. C) N-benzoyl-7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert-butyl(dimethyl)silyl)- 3-0-((2-cyanoethoxy)(diisopropylamino)phosphino)-beta-D-ribofuranosyl)-5-fluoro-7H- pyrrolo[2,3-d]pyrimidin-4-amine
[1553] N-(7-((2R,3R,4R,5R)-5-((Bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3-((tert- butyldimethylsilyl)oxy)-4-hydroxytetrahydrofuran-2-yl)-5-fluoro-7H-pyrrolo[2,3- d]pyrimidin-4-yl)benzamide (1.03 g) was subjected to azeotropic dehydration with anhydrous toluene, and anhydrous DMF (5 mL) was added thereto under argon atmosphere. 3-((Bis(diisopropylamino)phosphino)oxy)propanenitrile (0.771 g), lH-tetrazole (0.090 g) and 1-methyl-lH-imidazole (0.051 mL) were added thereto, and the mixture was stirred for 6 hr. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution, and the mixture was extracted with ethyl acetate. The extract was washed with saturated aqueous sodium hydrogencarbonate solution and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate containing 0.5% triethylamine/hexane) to give the title compound (1.12 g). 1H NMR (300 MHz, CDC13) δ - 0.17 (3H, d, J = 2.6 Hz), -0.04-0.00 (3H, m), 0.78 (9H, s), 1.04 (3H, d, J = 6.8 Hz), 1.13-1.23 (9H, m), 2.32 (1H, t, J = 6.6 Hz), 2.68 (1H, td, J = 6.4, 1.9 Hz), 3.21-3.36 (1H, m), 3.42-3.71 (4H, m), 3.79 (6H, d, J = 1.1 Hz), 3.85-4.05 (1H, m), 4.25-4.45 (2H, m), 4.64-4.82 (1H, m), 6.39 (1H, dd, J = 14.2, 5.9 Hz), 6.74-6.89 (4H, m), 7.19-7.41 (8H, m), 7.43-7.67 (5H, m), 7.98 (2H, d, J = 7.6 Hz), 8.50 (1H, s), 8.64 (1H, d, J = 5.3 Hz).
D) (2R,3R,4R,5R)-5-(4-benzamido-5-fluoro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-4-((tert- butyldimethy lsily l)oxy)-2-(hydroxymethy l)tetrahy drofuran-3 -yl hydrogen phosphonate
[1554] To N-benzoyl-7-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert- butyl(dimethyl)silyl)-3-0-((2-cyanoethoxy)(diisopropylamino)phosphino)-beta-D- ribofuranosyl)-5-fluoro-7H-pyrrolo[2,3-d]pyrimidin-4-amine (1.12 g) were added acetonitrile (5 mL), water (40 μL) and pyridine 2,2,2-trifluoroacetate (258 mg). The mixture was stirred at room temperature for 10 min, tert-butylamine (5.43 mL) was added thereto, and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, 80% acetic acid (5.5 mL) was added thereto, and the mixture was stirred at room temperature for additional 1 hr. The solvent was evaporated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (527 mg). MS: [M+H]+ 567.2.
E) (2R,3R,4R,5R)-5-(4-benzamido-5-fluoro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-4-((tert- butyldimethylsilyl)oxy)-2-((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-5- (hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3 -yl hydrogen phosphonate
[1555] (2R,3R,4R,5R)-5-(4-Benzamido-5-fluoro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-4-((tert- butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (527 mg) and 3'-0-(tert-butyl(dimethyl)silyl)-2'-0-((2- cyanoethoxy)(diisopropylamino)phosphino)-N-isobutyrylguanosine (1.083 g) were subjected to azeotropic dehydration three times with anhydrous acetonitrile, and anhydrous acetonitrile (10 mL) was added thereto. Pyridine 2,2,2-trifluoroacetate (359 mg) was added thereto, and the mixture was stirred at room temperature for 30 min. 70% tert-Butyl hydroperoxide aqueous solution (382 μΐ.) was added thereto, and the mixture was stirred at room temperature for additional 20 min. To the reaction mixture were added sodium thiosulfate (693 mg) and water (1 mL), and the mixture was concentrated under reduced pressure. To the residue was added 80% acetic acid (5 mL), and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was subjected to azeotropic dehydration three times with toluene. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (175 mg). MS: [M+H]+ 1149.4.
F) N-(7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-bis((tert-buty l(dimethyl)silyl)oxy)- 10- (2-cyanoethoxy)-2-hydroxy-7-(2-((2-methylpropanoyl)amino)-6-oxo-l,6-dihydro-9H-purin- 9-yl)-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-5-fluoro-7H-pyrrolo[2,3- d] pyrimidin-4-yl)benzamide
[1556] (2R,3R,4R,5R)-5-(4-Benzamido-5-fluoro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-4-((tert- butyldimethylsilyl)oxy)-2-((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-5- (hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate (175 mg) was subjected to azeotropic dehydration three times with anhydrous acetonitrile, and anhydrous pyridine (3 mL) and 2-chloro-5,5-dimethyl-l,3,2-dioxaphosphinane 2-oxide (98 mg) were added thereto. The mixture was stirred under argon atmosphere at room temperature for 10 min, water (96 μΐ.) and iodine (50 mg) were added thereto, and the mixture was stirred at room temperature for additional 20 min. The reaction mixture was added to a mixture of sodium thiosulfate (98 mg) and water (0.4 mL), and the mixture was stirred for 5 min, and concentrated under reduced pressure. The residue was purified twice by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (48 mg). MS: [M+H]+ 1147.6.
G) 2-amino-9-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(4-amino-5-fluoro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-l 5, 16-bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dihydroxy-2, 10- dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-l ,9-dihydro-6H-purin-6-one
[1557] N-(7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-Bis((tert- butyl(dimethyl)silyl)oxy)-10-(2-cyanoethoxy)-2-hydroxy-7-(2-((2-methylpropanoyl)amino)- 6-oxo-l,6-dihydro-9H-purin-9-yl)-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-5-fluoro-7H-pyrrolo[2,3- d]pyrimidin-4-yl)benzamide (48 mg) was subjected to azeotropic dehydration twice with anhydrous acetonitrile, 33% methylamine ethanol solution (2 mL) was added thereto, and the mixture was stirred overnight under argon atmosphere at room temperature. The obtained mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile), the obtained fraction was concentrated under reduced pressure, and the obtained product was freeze-dried to give the title compound (5 mg). MS: [M+H]+ 920.3.
H) 2-amino-9-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(4-amino-5-fluoro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro- 12H-5,8- methanofuro[3,2-l] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H- purin-6-one di-triethylamine salt
[1558] A mixture of 2-amino-9-((5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(4-amino-5- fluoro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)- 15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2, 10- dihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2-
I) [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H-purin-6-one (5 mg) and triethylamine trihydrofluoride (200 μΐ.) was stirred at 50°C for 1 hr. The reaction mixture was cooled to room temperature, and neutralized with 1 M aqueous triethylammonium hydrogen carbonate solution. The reaction mixture was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution), the objective fraction was concentrated under reduced pressure, and the obtained product was freeze-dned to give the title compound (3.2 mg). 1H NMR (600 MHz, D20) δ 1.23 (18H, t, J = 7.3 Hz), 3.15 (12H, q, J = 7.3 Hz), 4.06-4.11 (1H, m), 4.14-4.19 (1H, m), 4.21-4.26 (1H, m), 4.31-4.37 (2H, m),4.40 (1H, d, J = 1.5 Hz), 4.56 (1H, dd, J = 15.2, 4.3 Hz), 4.61-4.68 (1H, m), 5.00 (1H, ddd, J = 8.5, 6.6, 4.5 Hz), 5.60 (1H, td, J = 7.9, 4.1 Hz), 5.93 (1H, d, J = 8.5 Hz), 6.26 (1H, s), 7.14 (1H, d, J = 1.6 Hz), 7.87 (1H, s), 8.10 (1H, s).
EXAMPLE 10
Synthesis of 1 -((5RJR, 8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-punn-9-y 1)- 2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro-l 2H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-l,5-dihydro-4H-imidazo[4,5- c]pyridin-4-one
Figure imgf000240_0001
Figure imgf000241_0001
A) (2R,3R,4R,5R)-2-((benzoyloxy)methyl)-5-(4-oxo-4,5-dihydro-lH-imidazo[4,5-c]pyridin-
1 -yl)tetrahydrofuran-3,4-diyl dibenzoate
To 4-chloro-lH-imidazo[4,5-c]pyridine (20 g) were added formic acid (123 mL) and water (30 mL) at room temperature, and the mixture was stirred at 100°C for 2 hr. The mixture was cooled to room temperature, and concentrated under reduced pressure. To the residue was added cone, hydrochloric acid (100 mL), and the mixture was stirred at 100°C for 1 hr. The mixture was concentrated under reduced pressure, the residue was suspended in MeOH (100 mL) and diisopropyl ether (100 mL), and triethylamine (50 mL) was added thereto. The resulting solid was collected by filtration, and dissolved in acetonitrile (600 mL). Trimethylsilyl N-(trimethylsilyl)acetimidate (38.2 mL) was added thereto at room temperature, and the mixture was stirred for 10 min. To the reaction mixture was added (2S,3R,4R,5R)-2-acetoxy-5-((benzoyloxy)methyl)tetrahydrofuran-3,4-diyl dibenzoate (79.0 g) at room temperature, and the mixture was heated to 80°C. To the reaction solution was added trimethylsilyl trifluoromethanesulfonate (28.2 mL), and the mixture was stirred under argon atmosphere overnight at 80°C. The mixture was cooled to room temperature, water (500 mL) was added thereto, and the resulting solid was collected by filtration. The solid was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (25.9 g). 1H NMR (400 MHz, CDC13) δ 4.65-4.96 (3H, m), 5.91 (2H, brs), 6.23- 6.42 (1H, m), 6.64 (1H, brs), 7.15 (1H, brs), 7.32-7.56 (9H, m), 7.92-8.15 (7H, m), 12.11- 12.50 (lH, m). MS: [M+H]+ 580.1
B) l-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-lH- imidazo[4,5-c]pyridin-4(5H)-one
[1560] To (2R,3R,4R,5R)-2-((benzoyloxy)methyl)-5-(4-oxo-4,5-dihydro-lH-imidazo[4,5- c]pyridin-l-yl)tetrahydrofuran-3,4-diyl dibenzoate (30.0 g) was added 40% methylamine methanol solution (200 mL), and the mixture was stirred under argon atmosphere at room temperature for 1 hr, and concentrated under reduced pressure. The residue was recrystallized from hexane-ethyl acetate to give the title compound (11.2 g). MS: [M+H]+ 268.1
C) l-((2R,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3,4- dihydroxytetrahydrofuran-2-yl)-lH-imidazo[4,5-c]pyridin-4(5H)-one
[1561] To a solution of l-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-
2-yl)-lH-imidazo[4,5-c]pyridin-4(5H)-one (18.0 g) in pyridine (140 mL) was added 4,4'- dimethoxytrityl chloride (18.46 g) at room temperature, and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, to the residue was added water, and the mixture was extracted with ethyl acetate. The obtained extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (18.2 g). MS: [M+H]+ 570.2
D) l-((2R,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-((tert- butyldimethylsilyl)oxy)-3-hydroxytetrahydrofuran-2-yl)-lH-imidazo[4,5-c]pyridin-4(5H)- one
[1562] To a solution of l-((2R,3R,4S,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-3,4-dihydroxytetrahydrofuran-2-yl)-lH- imidazo[4,5-c]pyridin-4(5H)-one (18.02 g) in DMF (158 mL) were added imidazole (4.30 g) and tert-butyldimethylchlorosilane (5.72 g), and the mixture was stirred at room temperature for 3 hr. tert-Butyldimethylchlorosilane (2.38 g) was added again thereto, and the mixture was stirred for 3 hr. The reaction mixture was diluted with water, and extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane). The isolated regioisomer of the title compound was dissolved in MeOH and triethylamine, and the solution was stirred overnight at room temperature. The reaction solution was concentrated, and the residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (11.5 g). MS: [M+H]+ 684.2
E) (2R,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-((tert- butyldimethylsilyl)oxy)-2-(4-oxo-4,5-dihydro-lH-imidazo[4,5-c]pyridin-l- yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1563] To a mixture of l-((2R,3R,4S,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-3- hydroxytetrahydrofuran-2-yl)-lH-imidazo[4,5-c]pyridin-4(5H)-one (8.0 g) and pyridine (117 mL) was added diphenyl phosphite (4.5 mL). The mixture was stirred at room temperature for 1 hr. Water (20 mL) was added to the reaction mixture. The mixture was stirred at room temperature for 30 min, and the reaction mixture was diluted with water, and extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (8.5 g). MS: [M+H]+ 748.3
F) (2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-5-(hydroxymethyl)-2-(4-oxo-4,5-dihydro- lH-imidazo[4,5-c]pyridin-l-yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1564] A mixture of (2R,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-
((tert-butyldimethylsilyl)oxy)-2-(4-oxo-4,5-dihydro-lH-imidazo[4,5-c]pyridin-l- yl)tetrahydrofuran-3-yl hydrogen phosphonate (8.2 g) and l,l,l,3,3,3-hexafluoropropan-2-ol (30 mL) was stirred at room temperature for 2 hr. Methanol (10 mL) was added thereto, the mixture was stirred at 60°C for 1 hr, and the solvent was evaporated under reduced pressure. The residue was recrystallized from ethyl acetate and diisopropyl ether to give the title compound (4.3 g). MS: [M+H]+ 446.1 G) (2R,3R,4R,5R)-5-((((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-((tert- butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-2-(4-oxo-4,5-dihydro- lH-imidazo[4,5-c]pyridin-l-yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1565] (2R,3R,4R,5R)-4-((tert-Butyldimethylsilyl)oxy)-5-(hydroxymethyl)-2-(4-oxo-4,5- dihydro-lH-imidazo[4,5-c]pyridin-l-yl)tetrahydrofuran-3-yl hydrogen phosphonate (250 mg) and N-benzoyl-5'-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2'-0-(tert- butyl(dimethyl)silyl)-3'-0-((2-cyanoethoxy)(diisopropylamino)phosphino)adenosine (776 mg) were subjected to azeotropic dehydration with anhydrous acetonitrile, and anhydrous acetonitrile (5.61 mL) was added thereto. To the mixture was added pyridine 2,2,2- trifluoroacetate (271 mg), and the mixture was stirred at room temperature for 40 min. 70% tert-Butyl hydroperoxide aqueous solution (231 μΐ.) was added thereto, and the mixture was stirred at room temperature for 20 min. To the reaction mixture was added a mixture of sodium thiosulfate (1.3 g) and water (3 mL), and the mixture was concentrated under reduced pressure. To the residue was added l,l,l,3,3,3-hexafluoropropan-2-ol (15 mL), and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (ethyl acetate/hexane and methanol/ethyl acetate) to give the title compound (170 mg). MS: [M+H]+ 1046.3
H) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2- (2-cyanoethoxy)-10-hydroxy-2,10-dioxido-7-(4-oxo-4,5-dihydro-lH-imidazo[4,5-c]pyridin- l-yl)octahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6-yl)benzamide
[1566] (2R,3R,4R,5R)-5-((((((2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-4-((tert- butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-2-(4-oxo-4,5-dihydro- lH-imidazo[4,5-c]pyridin-l-yl)tetrahydrofuran-3-yl hydrogen phosphonate (160 mg) was subjected to azeotropic dehydration with anhydrous pyridine, and anhydrous pyridine (3.0 mL) was added thereto. To the mixture was added 2-chloro-5,5-dimethyl- 1,3,2- dioxaphosphinane 2-oxide (99 mg) at room temperature, and the mixture was stirred at room temperature for 1 hr. Water (96 μL) and iodine (50.5 mg) were added thereto, and the mixture was stirred at room temperature for additional 20 min. To the reaction mixture was added a mixture of sodium thiosulfate (190 mg) and water (0.4 mL), and the mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (10.6 mg). MS: [M+H]+ 1044.3
I) 1 -((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15,16-bis((tert- butyl(dimethyl)silyl)oxy)-2,10-dihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-l,5-dihydro-4H-imidazo[4,5- c]pyridin-4-one
[1567] To N-(9-((5R,7R,8R,12aR,14R,15R,15aR,16R)-15,16-bis((tert- butyl(dimethyl)silyl)oxy)-2-(2-cyanoethoxy)-10-hydroxy-2,10-dioxido-7-(4-oxo-4,5- dihydro- 1 H-imidazo[4, 5-c]pyridin- 1 -yl)octahy dro- 12H-5 , 8-methanofuro [3 ,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H-purin-6-yl)benzamide (10.6 mg) was added 40% methylamine ethanol solution (5.0 mL), and the mixture was stirred under argon atmosphere at room temperature for 1 hr, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (9.0 mg). MS: [M+H]+ 887.2
J) 1 -((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-punn-9-yl)-2, 10,15,16- tetrahydroxy-2, 10-dioxidooctahydro- 12H-5, 8-methanofuro[3 ,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-l,5-dihydro-4H-imidazo[4,5- c]pyridin-4-one
[1568] To 1 -((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15,16- bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dihydroxy-2, 10-dioxidooctahydro- 12H-5, 8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin-7-yl)- 1 , 5 -dihydro-4H- imidazo[4,5-c]pyridin-4-one (9.0 mg) were added methanol (1.0 mL) and triethylamine trihydrofluoride (165 μL). The reaction mixture was concentrated to remove the methanol, and the residue was stirred at 55°C for 1 hr. The mixture was cooled to room temperature, ethoxy(trimethyl)silane (0.90 mL) was added thereto, and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution) to give the title compound (0.3 mg). 1H NMR (400 MHz, D20) a 4.15 (2H, d, J = 11.5 Hz), 4.46 (4H, brs), 4.56-4.62 (1H, m), 4.98-4.99 (2H, m), 6.05-6.20 (2H, m), 6.79-6.87 (1H, m), 7.06-7.12 (1H, m), 8.00 (1H, s), 7.96-8.10 (1H, m), 8.23 (2H, s). 31P NMR (162 MHz, D20) δ -2.36,-1.94.
EXAMPLE 11
Synthesis of 2-amino-9-((5R,7R, 8R, 12aR, 14R, 15R, 15aS , 16R)- 14-(4-amino- 1 H-imidazo[4, 5- c]pyridin-l -yl)-2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro-12H-5, 8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H-purin-6-one di- triethylamine salt
Figure imgf000246_0001
A) N-benzoyl-l-(2-0-(tert-butyl(dimethyl)silyl)-3,5-0-(di-tert-butylsilylene)-beta-D- ribofuranosyl)- 1 H-imidazo [4, 5 -c] pyridin-4-amine
9] N-Benzoyl-l-(beta-D-ribofuranosyl)-lH-imidazo[4,5-c]pyridin-4-amine (2.41 g) was dissolved in DMF (25 mL), di-tert-butylsilanediyl bis(trifluoromethanesulfonate) (2.32 mL) was added thereto at 0°C, and the mixture was stirred at 0°C for 75 min. Di-tert- butylsilanediyl bis(trifluoromethanesulfonate) (0.63 mL) was added thereto at 0°C, and the mixture was stirred at 0°C for additional 30 min. Di-tert-butylsilanediyl bis(trifluoromethanesulfonate) (0.63 mL) was added thereto at 0°C, and the mixture was stirred at 0°C for additional 35 min. To the reaction mixture was added lH-imidazole (2.22 g), and the mixture was stirred at room temperature for 10 min. tert- Butyldimethylchlorosilane (1.18 g) was added thereto, and the mixture was stirred at 60°C for 1.5 hr. tert-Butyldimethylchlorosilane (0.294 g) was added thereto, and the mixture was stirred at 60°C for 14.5 hr. The reaction mixture was diluted with water, and extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (3.28 g). MS: [M+H]+ 625.2.
B) N-benzoyl-l-(2-0-(tert-butyl(dimethyl)silyl)-beta-D-ribofuranosyl)-lH-imidazo[4,5- c]pyridin-4-amine
[1570] Pyridinium poly(hydrogen fluoride) (1.86 mL) was dissolved in pyridine (10 mL) at
0°C, the solution was added to a solution of N-benzoyl-l-(2-0-(tert-butyl(dimethyl)silyl)- 3,5-0-(di-tert-butylsilylene)-beta-D-ribofuranosyl)-lH-imidazo[4,5-c]pyridin-4-amine (1.64 g) in THF (13 mL) at 0°C, and the mixture was stirred at 0°C for 8 min. This reaction was repeated twice. The reaction solutions were combined, diluted with water, and extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane and methanol/ethyl acetate) to give the title compound (2.24 g). MS: [M+H]+ 485.1.
C) N-benzoyl-l-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert-butyl(dimethyl)silyl)- beta-D-ribofuranosyl)-lH-imidazo[4,5-c]pyridin-4-amine
[1571] N-Benzoyl-l-(2-0-(tert-butyl(dimethyl)silyl)-beta-D-ribofuranosyl)-lH-imidazo[4,5- c]pyridin-4-amine (2.24 g) was dissolved in pyridine (25 mL), 4,4'-dimethoxytrityl chloride (2.04 g) was added thereto at room temperature, and the mixture was stirred at room temperature for 4.5 hr. The reaction mixture was concentrated under reduced pressure, to the residue was added water, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (3.29 g). MS: [M+H]+ 787.3.
D) N-benzoyl- 1 -(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert- butyl(dimethyl)silyl)-3-0-((2-cyanoethoxy)(diisopropylamino)phosphino)-beta-D- ribofuranosyl)- 1 H-imidazo [4, 5 -c] pyridin-4-amine
[1572] N-Benzoyl-l-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert- butyl(dimethyl)silyl)-beta-D-ribofuranosyl)-lH-imidazo[4,5-c]pyridin-4-amine (3.29 g) was dissolved in anhydrous DMF (9.5 mL), to the solution were added 3- ((bis(diisopropylamino)phosphino)oxy)propanenitrile (2.98 mL), lH-tetrazole (0.328 g) and 1 -methyl- lH-imidazole (0.185 mL), and the mixture was stirred under argon atmosphere at room temperature for 2.5 hr. To the reaction solution was added saturated aqueous sodium bicarbonate solution, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane, containing 0.5% triethylamine) to give the title compound (3.85 g). MS: [M+H]+ 987.4.
E) N-benzoyl-l-(2-0-(tert-butyl(dimethyl)silyl)-3-0-(hydroxy(oxido)phosphoranyl)-beta-D- ribofuranosyl)- 1 H-imidazo [4, 5 -c] pyridin-4-amine
[1573] N-Benzoyl-l-(5-0-(bis(4-methoxyphenyl)(phenyl)methyl)-2-0-(tert- butyl(dimethyl)silyl)-3-0-((2-cyanoethoxy)(diisopropylamino)phosphino)-beta-D- ribofuranosyl)-lH-imidazo[4,5-c]pyridin-4-amine (3.85 g) was dissolved in acetonitrile (30 mL), pyridine 2,2,2-trifluoroacetate (0.904 g) and water (0.141 mL) were added thereto at room temperature, and the mixture was stirred at room temperature for 30 min. To the reaction solution was added 2-methylpropan-2-amine (9 mL) at room temperature, and the mixture was stirred at room temperature for 40 min. The reaction mixture was concentrated under reduced pressure, and to the residue was added l,l,l,3,3,3-hexafluoropropan-2-ol (25 mL), and the mixture was stirred at room temperature for 3.5 hr. The reaction mixture was concentrated under reduced pressure, acetic acid (20 mL) and water (5 mL) were added thereto, and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (1.85 g). MS: [M+H]+ 549.1.
F) (2R,3R,4R, 5R)-5 -(4-benzamido- 1 H-imidazo [4, 5 -c]pyndin- 1 -yl)-4-((tert- butyldimethylsilyl)oxy)-2-((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-5- (hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3 -yl hydrogen phosphonate
[1574] N-Benzoyl-l-(2-0-(tert-butyl(dimethyl)silyl)-3-0-(hydroxy(oxido)phosphoranyl)- beta-D-ribofuranosyl)-lH-imidazo[4,5-c]pyridin-4-amine (300 mg) and 5'-0-(bis(4- methoxyphenyl)(phenyl)methyl)-3'-0-(tert-butyl(dimethyl)silyl)-2'-0-((2- cyanoethoxy)(diisopropylamino)phosphino)-N-isobutyrylguanosine (637 mg) were subjected to azeotropic dehydration with anhydrous acetonitrile (three times), and suspended in anhydrous acetonitrile (6 mL). Pyridine 2,2,2-trifluoroacetate (264 mg) was added thereto, and the mixture was stirred under argon atmosphere at room temperature for 1 hr. 70% tert- Butyl hydroperoxide aqueous solution (0.225 mL) was added thereto, and the mixture was stirred at room temperature for additional 1 hr. The reaction mixture was quenched with sodium thiosulfate (400 mg) and water (1.5 mL), and the solvent was evaporated under reduced pressure. The residue was dissolved in 80% acetic acid (5 mL), and the solution was stirred at room temperature for 45 min. The reaction mixture was concentrated under reduced pressure, and the residue was subjected to azeotropic dehydration with anhydrous acetonitrile and toluene. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (469 mg). MS: [M+H]+ 1131.4.
G) N-( 1 -((5RJR, 8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-bis((tert-butyl(dimethyl)silyl)oxy)- 10- (2-cyanoethoxy)-2-hydroxy-7-(2-(isobutyrylamino)-6-oxo- 1 ,6-dihydro-9H-purin-9-yl)-2, 10- dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)- lH-imidazo[4,5-c]pyridin-4- yl)benzamide
[1575] (2R,3R,4R,5R)-5-(4-Benzamido-lH-imidazo[4,5-c]pyridin-l-yl)-4-((tert- butyldimethylsilyl)oxy)-2-((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-5- (hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate (469 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (10 mL). 2-Chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (268 mg) was added thereto, and the mixture was stirred under argon atmosphere at room temperature for 15 min. Water (1 mL) and iodine (158 mg) were added thereto, and the mixture was stirred at room temperature for additional 13 min. The reaction mixture was quenched with sodium thiosulfate (170 mg) and water (0.5 mL), the solvent was evaporated under reduced pressure, and the residue was subjected to azeotropic dehydration with toluene. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (419 mg). MS: [M+H]+ 1129.3.
H) 2-amino-9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(4-amino- lH-imidazo[4,5- c]pyridin- 1 -yl)- 15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dihydroxy-2, 10- dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-l ,9-dihydro-6H-purin-6-one
[1576] N-(l -((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15, 16-Bis((tert- butyl(dimethyl)silyl)oxy)-10-(2-cyanoethoxy)-2-hydroxy-7-(2-(isobutyrylamino)-6-oxo-l,6- dihydro-9H-purin-9-yl)-2, 10-dioxidooctahydro- 12H-5 , 8-methanofuro [3 ,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-lH-imidazo[4,5-c]pyridin-4- yl)benzamide (419 mg) was dissolved in 33% methylamine ethanol solution (10.0 mL), and the solution was stirred under argon atmosphere at room temperature for 18.5 hr. 33% Methylamine ethanol solution (5 mL) was added thereto, the mixture was stirred for additional 3 hr, and the solvent was evaporated under reduced pressure. The residue was dissolved in 33% methylamine ethanol solution (10.0 mL), the solution was stirred at room temperature for 1 hr, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (173 mg). MS: [M+H]+ 902.3.
I) 2-amino-9-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(4-amino- lH-imidazo[4,5-c]pyridin-
1 -yl)-2, 10,15,16-tetrahydroxy-2, 10-dioxidooctahydro- 12H-5, 8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H-purin-6-one di- triethylamine salt
[1577] To 2-amino-9-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(4-amino- lH-imidazo[4, 5- c]pyridin- 1 -yl)- 15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dihydroxy-2, 10- dioxidooctahy dro- 12H- 5, 8-methanofuro [3 ,2- lJ [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H-purin-6-one ( 173 mg) was added triethylamine trihydrofluoride (0.625 mL), and the mixture was stirred at 50°C for 3 hr. The mixture was cooled to room temperature, and neutralized with 1 M aqueous triethylammonium bicarbonate solution, and the solvent was evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained solid was freeze-dned to give the title compound (123 mg). 1H NMR (300 MHz, D20) δ 1.25 (18H, t, J = 7.4 Hz), 3.17 (12H, q, J = 7.2 Hz), 3.87-4.10 (1H, m), 4.11-4.30 (3H, m), 4.32-4.45 (2H, m), 4.52 (1H, d, J = 3.8 Hz), 4.65 (1H, d, J = 4.2 Hz), 4.97-5.10 (1H, m), 5.79 (1H, brs), 5.94 (2H, d, J = 8.3 Hz), 7.10 (1H, d, J = 6.8 Hz), 7.68-7.78 (1H, m), 7.83 (1H, s), 7.94-8.26 (1H, m). 31P NMR (121 MHz, D20) δ-1.36.
EX AMPLE 12
Synthesis of 8-((5R,7R,8R, 12aR, 14S, 15S, 15aS, 16R)-7-(6-amino-9H-punn-9-yl)- 15,16- dihydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)pyrazolo[l,5-a] [1,3, 5]triazin- 4(3H)-one di-triethylamine salt (optical isomer)
Figure imgf000252_0001
Figure imgf000252_0002
A) 8-((2S,3S,4R,5R)-3,4-bis(benzyloxy)-5-((benzyloxy)methyl)tetrahydrofuran-2- yl)pyrazolo[l,5-a][l,3,5]triazin-4(3H)-one
To a solution of 4-((2S,3S,4R,5R)-3,4-bis(benzyloxy)-5-
((benzyloxy)methyl)tetrahydrofuran-2-yl)-lH-pyrazol-5-amine (17.3 g) and potassium carbonate (24.6 g) in DMF (200 mL) was added ethyl formimidate hydrochloride (19.5 g) at room temperature. The reaction mixture was stirred overnight at room temperature. To the reaction mixture was added diethyl carbonate (126 g) at room temperature, and the reaction mixture was stirred at 100°C for 1 hr. To the reaction mixture was added 20% sodium ethoxide ethanol solution (60.6 g) at room temperature. The reaction mixture was stirred at 100°C for 30 min. The reaction mixture was neutralized with acetic acid at room temperature, and extracted with ethyl acetate. The extract was washed with water and saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (5.79 g). MS: [M+H]+ 539.1.
B) 8-((2S,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)pyrazolo[l,5- a][l,3,5]triazin-4(3H)-one
[1579] A solution of 8-((2S,3S,4R,5R)-3,4-bis(benzyloxy)-5-
((benzyloxy)methyl)tetrahy drofuran-2-yl)pyrazolo [ 1 , 5 -a] [ 1 ,3 , 5]triazin-4(3H)-one (3.49 g) and palladium hydroxide (1.37 g, 10% Pd) in methanol (30 rriL) was stirred under hydrogen atmosphere overnight at room temperature. The catalyst was removed by filtration, and the filtrate was concentrated under reduced pressure to give the title compound (1.72 g). MS: [M+H]+ 269.0.
C) 8-((2S,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3,4- dihydroxytetrahydrofuran-2-yl)pyrazolo[l ,5-a] [ 1 ,3,5]triazin-4(3H)-one
[1580] To a solution of 8-((2S,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-
2-yl)pyrazolo[l,5-a][l,3,5]triazin-4(3H)-one (1.72 g) in dehydrated pyridine (30 mL) was added 4,4'-dimethoxytrityl chloride (2.39 g) under ice-cooling. The reaction mixture was stirred under argon atmosphere at room temperature for 2 hr. To the reaction mixture was added 4,4'-dimethoxytrityl chloride (0.217 g) under ice-cooling. The reaction mixture was stirred under argon atmosphere at room temperature for 3 hr. To the reaction mixture was added 4,4'-dimethoxytrityl chloride (0.217 g) at room temperature. The reaction mixture was stirred under argon atmosphere at room temperature for 30 min. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution at room temperature, and the mixture was extracted with ethyl acetate. The extract was washed with water and saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (1.62 g). MS: [M-H]" 569.1. D) 8-((2S,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3-((tert- butyldimethylsilyl)oxy)-4-hydroxytetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4(3H)- one
[1581] tert-Butyldimethylchlorosilane (536 mg) and silver(I) nitrate (604 mg) were added to a solution of 8-((2S,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3,4- dihydroxytetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4(3H)-one (1.69 g) and dehydrated pyridine (1.20 mL) in dehydrated THF (20 mL) at room temperature under argon atmosphere. The reaction mixture was stirred at room temperature for 8 hr, and to the reaction mixture were added tert-butyldimethylchlorosilane (89 mg) and silver(I) nitrate (101 mg) at room temperature. The reaction mixture was stirred overnight at room temperature. The insoluble substance was removed by filtration, and washed with ethyl acetate. To the filtrate was added saturated aqueous sodium hydrogencarbonate solution, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (740 mg). MS: [M-H]" 683.1.
E) (2R,3R,4S,5S)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-((tert- butyldimethylsilyl)oxy)-5-(4-oxo-3 ,4-dihydropyrazolo[ 1 ,5-a] [ 1 ,3, 5]triazin-8- yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1582] Diphenyl phosphite (0.41 mL) was added to a solution of 8-((2S,3R,4R,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-3-((tert-butyldimethylsilyl)oxy)-4- hydroxytetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4(3H)-one (740 mg) in pyridine (10 mL) at room temperature. The reaction mixture was stirred under argon atmosphere at room temperature for 1 hr. To the reaction mixture was added water (20 mL), and the mixture was stirred for 1 hr. The reaction mixture was poured into water at room temperature, and extracted with ethyl acetate. The extract was washed with water and saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (300 mg). MS: [M-H]" 747.1. F) (2R,3R,4S,5S)-4-((tert-butyldimethylsilyl)oxy)-2-(hydroxymethyl)-5-(4-oxo-3,4- dihy dropyrazolo [ 1 , 5 -a] [ 1 ,3 , 5]triazin- 8-yl)tetrahydrofuran-3 -yl hydrogen phosphonate
[1583] To (2R,3R,4S,5S)-2-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-4-((tert- butyldimethylsilyl)oxy)-5-(4-oxo-3,4-dihydropyrazolo[l,5-a][l,3,5]triazin-8- yl)tetrahydrofuran-3-yl hydrogen phosphonate (300 mg) was added 80% aqueous acetic acid solution (10 mL), and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (170 mg). MS: [M+H]+ 447.0.
G) (2R,3R,4S,5S)-2-((((((2R,3R,4R,5R)-2-(6-benzamido-9H-punn-9-yl)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-5-(4-oxo-3,4- dihy dropyrazolo [ 1 , 5 -a] [ 1 ,3 , 5]triazin- 8-yl)tetrahydrofuran-3 -yl hydrogen phosphonate
[1584] (2R,3R,4S,5S)-4-((tert-Butyldimethylsilyl)oxy)-2-(hydroxymethyl)-5-(4-oxo-3,4- dihydropyrazolo[l,5-a][l,3,5]triazin-8-yl)tetrahydrofuran-3-yl hydrogen phosphonate (190 mg) and N-benzoyl-5'-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3'-0-(tert- butyl(dimethyl)silyl)-2'-0-((2-cyanoethyl)(diisopropylamino)phosphino)adenosine (505 mg) were subjected to azeotropic process three times with dehydrated acetonitrile. To the residue were added dehydrated acetonitrile (5 mL) and pyridine 2,2,2-trifluoroacetate (164 mg). The reaction mixture was stirred under argon atmosphere at room temperature for 10 min, ((dimethylamino-methylidene)amino)-3H-l,2,4-dithiazoline-3-thione (96 mg) was added to the reaction mixture, and the mixture was stirred at room temperature for 20 min. To the reaction mixture was added an aqueous solution (0.2 mL) of sodium thiosulfate (0.2 g), and the mixture was concentrated under reduced pressure. To the residue was added 80% aqueous acetic acid solution (5 mL), the mixture was stirred at room temperature for 1 hr, and the reaction mixture was subjected to azeotropic process twice with acetonitrile. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (260 mg). MS: [M+H]+ 1063.2. H) 8-((5R,7R,8R, 12aR, 14S, 15S, 15aR, 16R)-7-(6-amino-9H-punn-9-yl)- 15, 16-bis((tert- butyl(dimethyl)silyl)oxy)-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)pyrazolo[l,5-a] [1,3, 5]triazin-
4(3H)-one (optical isomer)
[1585] (2R,3R,4S,5S)-2-((((((2R,3R,4R,5R)-2-(6-Benzamido-9H-purin-9-yl)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphorothioyl)oxy)methyl)-4-((tert-butyldimethylsilyl)oxy)-5-(4-oxo-3,4- dihydropyrazolo[l,5-a][l,3,5]triazin-8-yl)tetrahydrofuran-3-yl hydrogen phosphonate (260 mg) was subjected to azeotropic process twice with dehydrated acetonitrile. The residue was subjected to azeotropic process once with dehydrated pyridine. To a solution of the residue in dehydrated pyridine (5 mL) was added 2-chloro-5,5-dimethyl-l,3,2-dioxaphosphinane 2- oxide (158 mg), and the mixture was stirred under argon atmosphere at room temperature for 20 min. To the reaction mixture were added water (0.15 mL) and 3H-benzo[c][l,2]dithiol-3- one (49.4 mg) at room temperature. The reaction mixture was stirred at room temperature for 1 hr. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution at room temperature, and the mixture was extracted with ethyl acetate. The extract was washed with saturated aqueous sodium thiosulfate solution and saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate), and then purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give fractions, and the fraction having the longest retention time was concentrated under reduced pressure. To the residue was added 33% methylamine ethanol solution (5 mL), and the mixture was stirred at room temperature for 1 hr. The reaction mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (25 mg). MS: [M+H]+ 920.2.
I) 8-((5R,7R,8R, 12aR, 14S, 15S, 15aS, 16R)-7-(6-amino-9H-purin-9-yl)- 15,16-dihydroxy-2, 10- dioxido-2, 10-disulfanyloctahydro- 12H-5 , 8-methanofuro [3 ,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)pyrazolo[l,5-a] [1,3, 5]triazin- 4(3H)-one di-triethylamine salt (optical isomer)
[1586] To a solution of 8-((5R,7R,8R,12aR,14S,15S,15aR,16R)-7-(6-amino-9H-purin-9-yl)-
15,16-bis((tert-butyl(dimethyl)silyl)oxy)-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5,8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin- 14-y l)pyrazolo[ 1 , 5- a][l,3,5]triazin-4(3H)-one (optical isomer) (25 mg) in methanol (2 mL) was added triethylamine trihydrofluoride (0.177 mL) at room temperature, and the mixture was stirred at 50°C for 2 hr. To the reaction mixture was added ethoxytrimethylsilane (5 mL) at room temperature, and the mixture was stirred for 10 min. The reaction mixture was concentrated under reduced pressure, the residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained product was freeze-dried to give the title compound (13 mg). 1H NMR (300 MHz, D20) δ 4.02-4.19 (3H, m), 4.32-4.42 (2H, m), 4.44-4.49 (1H, m), 4.59-4.64 (1H, m), 4.76-4.80 (1H, m), 4.95-5.04 (1H, m), 5.16 (1H, d, J = 4.9 Hz), 5.31 (1H, ddd, J = 9.8, 8.7, 4.2 Hz), 6.22 (1H, d, J = 8.3 Hz), 7.99 (1H, s), 8.00 (1H, s), 8.14 (1H, s), 8.49 (1H, s).
EXAMPLE 13
Synthesis of 2-amino-9-((5R, 7R, 8R, 12aR, 14S, 15 S, 15aS, 16R)- 14-(4-aminopyrazolo [1,5- ,3 ,5]triazin-8-yl)-2, 10, 15, 16-tetrahydroxy-2, 10-dioxidooctahydro- 12H-5,8-methanofuro[3,2- ] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H-purin-6-one di- triethylamine salt
Figure imgf000257_0001
A) (2S,3S,4R,5R)-2-(4-(N-benzoylbenzamido)pyrazolo[l,5-a][l,3,5]triazin-8-yl)-5- ((benzoyloxy)methyl)tetrahydrofuran-3,4-diyl dibenzoate
[1587] To a solution of (2S,3R,4S,5R)-2-(4-aminopyrazolo[l,5-a][l,3,5]tnazin-8-yl)-5-
(hydroxymethyl)tetrahydrofuran-3,4-diol (2.98 g) and N,N-dimethyl-4-aminopyridine (1.36 g) in dehydrated pyridine (50 mL) was added benzoyl chloride (12.5 g) under ice-cooling. The reaction mixture was stirred under argon atmosphere for 1 hr. To the reaction mixture was added benzoyl chloride (3.13 g) under ice-cooling. The reaction mixture was stirred under argon atmosphere at room temperature for 2 hr. To the reaction mixture was added water, and the mixture was extracted with ethyl acetate. The extract was washed with water and saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (6.51 g). MS: [M+H]+ 788.2.
B) N-(8-((2S,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2- yl)pyrazolo[l,5-a][l,3,5]triazin-4-yl)benzamide
[1588] To a solution of (2S,3S,4R,5R)-2-(4-(N-benzoylbenzamido)pyrazolo[l,5- a][l,3,5]triazin-8-yl)-5-((benzoyloxy)methyl)tetrahydrofuran-3,4-diyl dibenzoate (6.51 g) in a mixed solvent of pyridine (50 mL) and ethanol (25 mL) was added 1M aqueous sodium hydroxide solution (49.6 mL) under ice-cooling, and the mixture was stirred at room temperature for 2 hr. To the reaction mixture was added strong acidic cation-exchange resin DOWEX TM 50Wx4 100-200 (40 g) at room temperature, and the mixture was stirred at room temperature for 15 min. The solid was removed by filtration, and the filtrate was concentrated under reduced pressure. To the residue was added methanol, and the obtained solid was collected by filtration to give the title compound (1.82 g). MS: [M+H]+ 372.1.
C) N-(8-((2S,3R,4S,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3,4- dihydroxytetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4-yl)benzamide
[1589] To a solution of N-(8-((2S,3R,4S,5R)-3,4-dihydroxy-5-
(hydroxymethyl)tetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4-yl)benzamide (1.89 g) in dehydrated pyridine (30 mL) was added 4,4'-dimethoxytrityl chloride (517 mg) under ice- cooling. The reaction mixture was stirred under argon atmosphere at room temperature for 3 hr. To the reaction mixture was added 4,4'-dimethoxytrityl chloride (517 mg) at room temperature, and the mixture was stirred overnight under argon atmosphere at room temperature. To the reaction mixture was added 4,4'-dimethoxytrityl chloride (1035 mg) at room temperature, and the mixture was stirred under argon atmosphere at room temperature for 1 hr. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution at room temperature, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (2160 mg). MS: [M-H]" 672.1.
D) N-(8-((2S,3R,4R,5R)-5-((bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3-((tert- butyldimethylsilyl)oxy)-4-hydroxytetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4- yl)benzamide
To a solution of N-(8-((2S,3R,4S,5R)-5-((bis(4- methoxyphenyl)(phenyl)methoxy)methyl)-3,4-dihydroxytetrahydrofuran-2-yl)pyrazolo[l,5- a][l,3,5]triazin-4-yl)benzamide (2.16 g) in dehydrated THF (30 mL) were added silver(I) nitrate (708 mg) and dehydrated pyridine (1.22 g). The reaction mixture was stirred under argon atmosphere for 15 min, and tert-butyldimethylchlorosilane (628 mg) was added thereto. The reaction mixture was stirred under argon atmosphere at room temperature for 2 hr. To the reaction mixture were added silver(I) nitrate (163 mg), tert- butyldimethylchlorosilane (145 mg) and dehydrated pyridine (507 mg) at room temperature. The reaction mixture was stirred overnight under argon atmosphere at room temperature. To the reaction mixture were added silver(I) nitrate (436 mg), tert-butyldimethylchlorosilane (387 mg) and dehydrated pyridine (761 mg) at room temperature. The reaction mixture was stirred under argon atmosphere at room temperature for 2 hr. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution at room temperature, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane) to give the title compound (980 mg). MS: [M-H]" 786.2. E) (2R,3R,4S,5S)-5-(4-benzamidopyrazolo[l,5-a][l,3,5]triazin-8-yl)-4-((tert- butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3 -yl hydrogen phosphonate
[1591] N-(8-((2S,3R,4R,5R)-5-((Bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-3-((tert- butyldimethylsilyl)oxy)-4-hydroxytetrahydrofuran-2-yl)pyrazolo[l,5-a][l,3,5]triazin-4- yl)benzamide (980 mg) was subjected to azeotropic process twice with dehydrated toluene, and dissolved in dehydrated DMF (10 mL). To the reaction mixture were added 3- ((bis(diisopropylamino)phosphino)oxy)propanenitrile (487 mg), lH-tetrazole (87 mg) and 1- methyl-lH-imidazole (51 mg). The reaction mixture was stirred under argon atmosphere at room temperature for 5 hr. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution at room temperature, and the mixture was extracted with ethyl acetate. The extract was washed with saturated brine, dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate containing 0.5% triethylamine/hexane). To a solution of the obtained mixture in acetonitrile (10 mL) were added water (0.04 mL) and pyridine 2,2,2- trifluoroacetate (256 mg) at room temperature. The reaction mixture was stirred at room temperature for 30 min, tert-butylamine (5.38 mL) was added thereto, and the mixture was stirred at room temperature for 45 min. The solvent was evaporated under reduced pressure. To the residue was added 80% aqueous acetic acid solution (5.4 mL), the mixture was stirred at room temperature for 1 hr, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (530 mg). MS: [M+H]+ 550.2.
F) (2R,3R,4S,5S)-5-(4-benzamidopyrazolo[l,5-a][l,3,5]tnazin-8-yl)-4-((tert- butyldimethylsilyl)oxy)-2-((((((2R,3R,4R,5R)-4-((tert-butyldimethylsilyl)oxy)-5-
(hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl)oxy)(2- cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3 -yl hydrogen phosphonate
[1592] A mixture of (2R,3R,4S,5S)-5-(4-benzamidopyrazolo[l,5-a][l,3,5]triazin-8-yl)-4-
((tert-butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (240 mg) and 5'-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3'-0-(tert-butyl(dimethyl)silyl)- 2'-0-((2-cyanoethyl)(diisopropylamino)phosphino)-N-isobutyrylguanosine (635 mg) was subjected to azeotropic process three times with dehydrated acetonitrile. To the residue was added a solution of dehydrated acetonitrile (5 mL), dehydrated THF (2.5 mL) and 5- (ethylthio)-2H-tetrazole (171 mg) (which was in advance subjected to azeotropic process with dehydrated acetonitrile) in dehydrated acetonitrile (2.5 mL). The reaction mixture was stirred under argon atmosphere at room temperature for 2 hr. 70% Aqueous tert-butyl hydroperoxide solution (0.179 mL) was added thereto, and the mixture was stirred at room temperature for 20 min. To the reaction mixture was added an aqueous solution (0.12 mL) of sodium thiosulfate pentahydrate (0.12 g), and the reaction mixture was concentrated under reduced pressure. To the residue was added 80% aqueous acetic acid solution (3 mL), and the mixture was stirred at room temperature for 1 hr. The residue was subjected to azeotropic process twice with acetonitrile. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give a crude product (420 mg) containing the title compound. MS: [M+H]+ 1132.3.
G) N-(8-((5R,7R,8R, 12aR, 14S, 15S, 15aR, 16R)- 15, 16-bis((tert-butyl(dimethyl)silyl)oxy)- 10- (2-cyanoethoxy)-2-hydroxy-7-(2-((2-methylpropanoyl)amino)-6-oxo-l,6-dihydro-9H-purin-
9-yl)-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)pyrazolo[l,5-a] [1,3, 5]triazin-4- yl)benzamide
The crude product (430 mg) containing (2R,3R,4S,5S)-5-(4-benzamidopyrazolo[l,5- a][l,3,5]triazin-8-yl)-4-((tert-butyldimethylsilyl)oxy)-2-((((((2R,3R,4R,5R)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)- yl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate was subjected to azeotropic process twice with dehydrated acetonitrile. The obtained residue was subjected to azeotropic process once with dehydrated pyridine. To a solution of the obtained residue in dehydrated pyridine (3 mL) was added 2- chloro-5,5-dimethyl-l,3,2-dioxaphosphinane 2-oxide (245 mg), and the mixture was stirred at room temperature under argon atmosphere for 10 min. To the reaction mixture were added water (0.239 mL) and iodine (125 mg), and the mixture was stirred at room temperature for 20 min. To the reaction mixture was added an aqueous solution (0.4 mL) of sodium thiosulfate pentahydrate (245 mg), and the mixture was stirred at room temperature for 5 min. Toluene was added thereto, and the mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give a crude product (553 mg) containing the title compound. MS: [M+H]+ 1130.4. H) 2-amino-9-((5R,7R,8R,12aR,14S,15S,15aS,16R)-14-(4-aminopyrazolo[l,5- a] [ 1 ,3 , 5 ]triazin-8-yl)-2, 10, 15 , 16-tetrahy droxy-2, 10-dioxidooctahy dro- 12H-5 , 8- methanofuro[3,2-l] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)- 1 ,9-dihydro-6H- purin-6-one di-triethylamine salt
A mixture of N-(8-((5R,7R,8R,12aR,14S,15S,15aR,16R)-15,16-bis((tert- butyl(dimethyl)silyl)oxy)-10-(2-cyanoethoxy)-2-hydroxy-7-(2-((2-methylpropanoyl)amino)- 6-oxo-l,6-dihydro-9H-purin-9-yl)-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)pyrazolo[l,5-a] [1,3, 5]triazin-4- yl)benzamide (553 mg) and 33% methylamine ethanol solution (20 mL) was stirred overnight at room temperature. The reaction mixture was concentrated under reduced pressure, the residue was purified by silica gel column chromatography (methanol/ethyl acetate), and then purified by HPLC (ODS, mobile phase: water/acetonitrile (containing 5mM ammonium acetate)) to give a fraction, and the obtained fraction was concentrated under reduced pressure. To a solution of the obtained residue in methanol (3 mL) was added triethylamine trihydrofluoride (0.072 mL) at room temperature, and the mixture was stirred at 50°C for 4 hr. To the reaction mixture was added triethylamine trihydrofluoride (0.181 mL) at room temperature, and the mixture was stirred overnight at 50°C. To the reaction mixture was added triethylamine trihydrofluoride (0.181 mL) at room temperature, and the mixture was stirred at 50°C for 5 hr. To the reaction mixture was added ethoxytrimethylsilane (1.034 mL) at room temperature, and the mixture was stirred for 5 min. The reaction mixture was concentrated under reduced pressure, the residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained product was freeze-dried to give the title compound (10 mg). 1H NMR (300 MHz, D20) δ 3.99-4.08 (1H, m), 4.11-4.31 (4H, m), 4.34-4.42 (1H, m), 4.52-4.60 (2H, m), 4.94- 5.05 (1H, m), 5.27-5.35 (1H, m), 5.51-5.62 (1H, m), 5.94 (1H, d, J = 8.3 Hz), 7.89 (1H, s), 8.07 (1H, s), 8.08 (1H, s). EXAMPLE 14
7-((2R, 5R, 7R, 8R, 1 OR, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-y 1)- 15-fluoro- 16- hydroxy-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5,8-methanofuro[3,2- ] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3 ,7-dihydro-4H-pyrrolo[2,3- d]pyrimidin-4-one disodium salt
Figure imgf000263_0001
A) (2R,3R,4R,5R)-5-((((((2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-fluoro-2- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphorothioyl)oxy)methyl)-4- ((tert-butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)- yl)tetrahydrofuran-3-yl hydrogen phosphonate
95] 7-(3-0-(tert-Butyl(dimethyl)silyl)-2-0-(hydroxy(oxido)phosphoranyl)-beta-D- ribofuranosyl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (8.89 g) and N- benzoyl-5'-0-(bis(4-methoxyphenyl)(phenyl)methyl)-3'-0-((2- cyanoethoxy)(diisopropylamino]phosphino)-2'-deoxy-2'-fluoroadenosine (18.5 g) were subjected to azeotropic process three times with dehydrated acetonitrile. To the residue were added anhydrous acetonitrile (40 mL), anhydrous THF (20 mL) and an anhydrous acetonitrile solution (40 mL) of 5-(ethylsulfanyl)-2H-tetrazole (7.49 g). The reaction mixture was stirred at room temperature for 30 min under argon atmosphere, ((dimethylaminomethylidene)amino)-3H-l,2,4-dithiazoline-3-thione (4.33 g) was added to the reaction mixture, and the mixture was stirred at room temperature for 30 min. To the reaction mixture was added an aqueous solution (5 mL) containing sodium thiosulfate (5.24 g), and the mixture was concentrated under reduced pressure. To the residue was added 80% aqueous acetic acid solution (100 mL), the mixture was stirred at room temperature for 1 hr, and the reaction mixture was subjected to azeotropic process with toluene. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (14.3 g). MS: [M+H]+ 968.3.
B) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 16-((tert-butyl(dimethyl)silyl)oxy)-2-(2- cyanoethoxy)-15-fluoro-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-10- oxido-10-sulfanyl-2-sulfidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6-yl)benzamide
(optical isomer)
(2R,3R,4R,5R)-5-((((((2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-4-fluoro-2- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphorothioyl)oxy)methyl)-4- ((tert-butyldimethylsilyl)oxy)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)- yl)tetrahydrofuran-3-yl hydrogen phosphonate (1.07 g) was subjected to azeotropic process three times with dehydration pyridine. To a solution of the residue in anhydrous pyridine (150 mL) was added 2-chloro-5,5-dimethyl-l,3,2-dioxaphosphinane 2-oxide (4.66 g), and the mixture was stirred at room temperature for 30 min under argon atmosphere. To the reaction mixture were added 3H-benzo[c][l,2]dithiol-3-one (1.46 g) and water (4.55 mL) at room temperature, and the reaction mixture was stirred for 30 min. LCMS analysis of the reaction mixture showed four peaks with the same mass ([M+H]+ 971.1), indicating four diastereomers being formed. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate), and then purified by HPLC (L-column2 ODS, 50x150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile). The fraction having the longest retention time was concentrated under reduced pressure to give the title compound (379 mg). MS: [M+H]+ 982.1. C) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 16-((tert- butyl(dimethyl)silyl)oxy)- 15-fluoro-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5,8- methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7- dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1597] 40% Methylamine methanol solution (10 mL) of N-(9-
((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 16-((tert-buty l(dimethyl)silyl)oxy)-2-(2- cyanoethoxy)-15-fluoro-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-10- oxido- 10-sulfanyl-2-sulf idooctahydro- 12H-5 , 8-methanofuro [3 ,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H-purin-6-yl)benzamide (optical isomer) (379 mg) was stirred at room temperature for 3 hr under argon atmosphere. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (319 mg). MS: [M+H]+ 825.1.
D) 7-((2R, 5RJR, 8R, 1 OR, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -fluoro- 16-hydroxy-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5, 8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt
[1598] To a solution of 7-((5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(6-amino-9H-purin-9- yl)-16-((tert-butyl(dimethyl)silyl)oxy)-15-fluoro-2,10-dioxido-2,10-disulfanyloctahydro- 12H-5, 8-methanofuro [3, 2-1] [ 1,3, 6,9,11,2,10]pentaoxadiphosphacy clotetradecin-7-yl)-5- fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (optical isomer) (319 mg) in methanol (1 mL) was added triethylamine trihydrofluoride (2.52 mL) at room temperature, and the mixture was stirred at 50°C for 3 hr, and diluted with methanol (10 mL). To the reaction mixture was added ethoxytrimethylsilane (12 mL) at room temperature, and the mixture was stirred for 10 min. The reaction mixture was concentrated under reduced pressure, the residue was diluted with methanol, and the mixture was concentrated again under reduced pressure. To the residue was added triethylammonium acetate buffer solution, and the solid was collected by filtration, and washed with acetonitrile to give a white solid. The obtained white solid was purified by silica gel column chromatography (ODS, 10 mM triethylammonium acetate buffer solution/acetonitrile). On the other hand, the filtrate was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) and silica gel column chromatography (ODS, 10 niM triethylammonium acetate buffer solution/acetonitrile). The fraction containing the title compound obtained by silica gel column chromatography (ODS, 10 mM triethylammonium acetate buffer solution/acetonitrile) was concentrated under reduced pressure, and the residue was freeze-dried to give the title compound (195 mg). MS: [M+H]+ 711.0.
E) 7-((2R, 5R,7R, 8R, 1 OR, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15-fluoro- 16-hydroxy-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one disodium salt
Deionized water (60 mL) was passed through a column prepared by packing AG
(trade name) 50W-X8 cation-exchange resin (100-200 mesh, 3.9 g) in an empty column. Then, 1 M aqueous sodium hydroxide solution (36 mL) and deionized water (68 mL) were passed through the resin. Deionized water (15 mL) containing
7-((2R, 5RJR, 8R, 1 OR, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15 -fluoro- 16- hydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (195 mg) was passed through the resin after the above-mentioned pre-treatment, and deionized water (19 mL) was passed through the resin, and the obtained aqueous solution was freeze-dried to give the title compound (165 mg). 1H NMR (300 MHz, D20) δ 4.00-4.08 (1H, m), 4.22-4.45 (4H, m), 4.50-4.57 (1H, m), 4.81-4.84 (1H, m), 4.98-5.14 (2H, m), 5.40-5.61 (1H, m), 6.33-6.43 (2H, m), 7.28 (1H, d, J = 1.9 Hz), 7.94 (1H, s), 8.05 (1H, s), 8.21 (1H, s). 31P NMR (121 MHz, D20) δ 52.1, 55.3.
EXAMPLE 15
Sythesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15-fluoro-2, 16- dihydroxy-2,10-dioxido-10-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3 ,7-dihydro-4H-pyrrolo[2,3- d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000267_0001
A) 5-fluoro-7-((6aR,8R,9R,9aS)-9-hydroxy-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-8-yl)-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
600] To a solution of 7-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-
2-yl)-5-fluoro-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one (37.9 g) in pyridine (760 rriL) was added l,3-dichloro-l,l,3,3-tetraisopropyldisiloxane (44.4 rriL), and the mixture was stirred at room temperature for 3 hr under argon atmosphere. The solvent was evaporated under reduced pressure, and to the residue were added ethyl acetate and water. The organic layer was washed with water and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was diluted with isopropyl ether (IPE), and the mixture was stirred overnight at room temperature. The solid was collected by filtration to give the title compound (32.3 g). The mother liquor was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (hexane/ethyl acetate) to give the title compound (13.3 g). MS: [M+H]+ 528.2. B) 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-
2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl
diisopropylphosphoramidite
[1601] 5-Fluoro-7-((6aR,8R,9R,9aS)-9-hydroxy-2,2,4,4-tetraisopropyltetrahydro-6H- furo[3,2-f [l,3,5,2,4]trioxadisilocin-8-yl)-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (20 g) was subjected to azeotropic dehydration three times with anhydrous acetonitrile, and dissolved in anhydrous DMF (100 mL). To this solution were added lH-tetrazole (2.79 g), 1 -methyl- lH-imidazole (1.65 mL), and 3-
((bis(diisopropylamino)phosphino)oxy)propanenitrile (24.1 mL), and the mixture was stirred overnight at room temperature under argon atmosphere, poured into saturated aqueous sodium hydrogencarbonate solution, and extracted with ethyl acetate. The organic layer was washed successively with saturated aqueous sodium hydrogencarbonate solution and saturated brine, and dried over anhydrous sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (ethyl acetate/hexane, containing 0.5% triethylamine) to give the title compound (20.8 g) as a mixture of two diastereomers. 1H NMR (300 MHz, DMSO-d6) δ 0.91-1.19 (40H, m), 2.69- 2.82 (2H, m), 3.46-3.73 (2H, m), 3.78-4.12 (5H, m), 4.47-4.61 (2H, m), 6.02-6.12 (1H, m), 7.14-7.23 (1H, m), 7.84-7.91 (1H, m), 12.00-12.40 (1H, br).
C) (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-2-((((2-cyanoethoxy)(((6aR,8R,9R,9aR)- 8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro-
6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl)oxy)phosphorothioyl)oxy)methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate
[1602] A mixture of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-fluoro-2-
(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (3.48 g) and 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4- tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl
diisopropylphosphoramidite (7.82 g) was subjected to azeotropic dehydration with anhydrous acetonitrile, and suspended in anhydrous acetonitrile (25 mL) and anhydrous THF (15 mL). 5-(Ethylsulfanyl)-2H-tetrazole (3.11 g), which was subjected in advance to azeotropic dehydration with anhydrous acetonitrile, was dissolved in anhydrous acetonitrile (6 mL), the solution was added to the above-mentioned suspension, and the mixture was stirred at room temperature for 1 hr under argon atmosphere. ((Dimethylaminomethylidene)amino)-3H- l,2,4-dithiazoline-3-thione (3.27 g) was added thereto, and the mixture was stirred at room temperature for additional 30 min. The solvent was evaporated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (6.73 g). MS: [M+H]+ 1096.2.
D) (2R,3R,4R,5R)-5-(6-benzamido-9H-punn-9-yl)-2-((((2-cyanoethoxy)(((2R,3R,4R,5R)-2-
(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4-((3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphorothioyl)oxy)methyl)-4-fluorotetrahydrofuran-3 -yl hydrogen phosphonate
[1603] (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-2-((((2- cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pynmidin-7(4H)-yl)- 2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9- yl)oxy)phosphorothioyl)oxy)methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate (6.73 g) was dissolved in a mixed solvent of THF (74.8 mL) and water (16.6 mL), and the solution was ice-cooled. Trifluoroacetic acid (16.6 mL) was added thereto, and the mixture was stirred 0°C for 2 hr. The reaction mixture was quenched with an aqueous solution of sodium bicarbonate (25.8 g), and extracted with ethyl acetate. The organic layer was washed with saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (6.43 g). MS: [M+H]+ 1114.2.
E) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5-fluoro-4- oxo-3 ,4-dihydro-7H-pyrrolo[2,3 -d]pyrimidin-7-yl)-2-hydroxy- 16-((3 -hydroxy- 1,1,3,3- tetra(propan-2-yl)disiloxanyl)oxy)-2-oxido-10-sulfidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6-yl)benzamide
[1604] (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-2-((((2- cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4- ((3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphorothioyl)oxy)methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate (6.43 g) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (130 mL). 2-Chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (3.73 g) was added thereto, and the mixture was stirred at room temperature for 1 hr under argon atmosphere. Water (5.17 mL) and iodine (1.90 g) were added thereto, and the mixture was stirred at room temperature for additional 1 hr. The reaction mixture was quenched with sodium thiosulfate (7.16 g) and water (3.6 mL), and extracted with ethyl acetate. The organic layer was washed with water and saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (4.60 g). MS: [M+H]+ 1112.2.
F) 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -fluoro-2- hydroxy- 16-((3 -hydroxy- 1 , 1 ,3 ,3 -tetraisopropyldisiloxanyl)oxy)-2, 10-dioxido- 10- sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1605] To N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5- fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-16-((3-hydroxy- l,l,3,3-tetra(propan-2-yl)disiloxanyl)oxy)-2-oxido-10-sulfidooctahydro-12H-5,8- methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin- 14-yl)-9H-purin-6- yl)benzamide (6.42 g) was added 40% methylamine methanol solution (30 mL), and the mixture was stirred at room temperature for 1 hr under argon atmosphere. The obtained mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile), the obtained fraction was concentrated under reduced pressure, and the residue was freeze-dried to give the title compound (420 mg). MS: [M+H]+ 955.2.
G) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-2, 16- dihydroxy-2,10-dioxido-10-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-trimethylamine salt (optical isomer)
[1606] To 7-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-
2-hydroxy-16-((3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy)-2,10-dioxido-10- sulfanyloctahydro-12H-5,8-methanofuro[3,2-
1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer, derived from tR2) (420 mg) was added triethylamine trihydrofluoride (9.68 mL), and the mixture was stirred at 50°C for 7.5 hr. To the reaction mixture was added ethoxytrimethylsilane (36.3 mL) at room temperature, and the mixture was stirred for 30 min. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and freeze-dried to give the title compound (298 mg). 1H NMR (300 MHz, D20) 51.13-1.29 (16H, m), 3.12 (11H, q, J = 7.2 Hz), 3.99-4.29 (4H, m), 4.31-4.43 (2H, m), 4.50 (1H, d, J = 9.1 Hz), 4.81-5.08 (3H, m), 5.39- 5.61 (1H, m), 6.30-6.42 (2H, m), 7.24 (1H, d, J = 1.9 Hz), 7.92 (1H, s), 8.09 (1H, s), 8.19 (1H, s). 31P NMR (121 MHz, D20) 552.2,1.63.
EXAMPLE 16
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-purin-9-yl)-2, 10,18- trihydroxy-2, 10-dioxidohexahydro- 14H- 15,12a-(epoxymethano)-5,8-methanofuro[3 ,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(12H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000271_0001
A) (lR,3R,4R,7S)-3-(6-benzamido-9H-purin-9-yl)-l-((((2-cyanoethoxy)(((6aR,8R,9R,9aR)- 8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro- 6H-furo[3,2-f] [1,3,5, 2,4]trioxadisilocin-9-yl)oxy)phosphoryl)oxy)methyl)-2,5- dioxabicyclo[2.2.1]heptan-7-yl hydrogen phosphonate
] (lS,3R,4R,7S)-3-(6-Benzamido-9H-punn-9-yl)-l-(hydroxymethyl)-2,5- dioxabicyclo[2.2. l]heptan-7-yl hydrogen phosphonate (2.00 g) and 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4- tetraisopropyltetrahydro-6H-furo[3,2-f [l,3,5,2,4]trioxadisilocin-9-yl diisopropylphosphoramidite (4.23 g) were subjected to azeotropic dehydration with anhydrous acetonitrile (about 50 mL, three times), and suspended in anhydrous THF (16 mL). 5-(Ethylsulfanyl)-2H-tetrazole (1.75 g), which was subjected in advance to azeotropic dehydration with anhydrous acetonitrile (about 30 mL, three times), was dissolved in anhydrous acetonitrile (16 mL), the solution was added to the above-mentioned suspension, and the mixture was stirred at room temperature for 15 hr under argon stream. 70% tert- Butyl hydroperoxide aqueous solution (1.86 mL) was added thereto, and the mixture was stirred at room temperature for additional 30 min. The reaction mixture was quenched with 10% aqueous sodium thiosulfate solution (13 mL), and concentrated under reduced pressure. The residue was subjected successively to azeotropic dehydration with acetonitrile (about 80 mL) and toluene (about 80 mL), the residue was subjected to silica gel column chromatography (methanol/ethyl acetate), and the objective fraction was concentrated under reduced pressure to give the title compound (5.36 g) as a white amorphous solid (a mixture of two diastereomers). MS: [M+H]+ 1090.2.
B) (lR,3R,4R,7S)-3-(6-benzamido-9H-punn-9-yl)-l-((((2-cyanoethoxy)(((2R,3R,4R,5R)-2- (5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4-((3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphoryl)oxy)methyl)-2,5-dioxabicyclo[2.2. l]heptan-7-yl hydrogen phosphonate (lR,3R,4R,7S)-3-(6-Benzamido-9H-purin-9-yl)-l-((((2- cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)- 2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9- yl)oxy)phosphoryl)oxy)methyl)-2,5-dioxabicyclo[2.2. l]heptan-7-yl hydrogen phosphonate (5.36 g) was dissolved in a mixed solvent of THF (60 mL) and water (13 mL), and the solution was ice-cooled. Trifluoroacetic acid (13.18 mL) was added thereto, and the mixture was stirred at 0°C for 4 hr. The reaction mixture was quenched with a solution of sodium bicarbonate (20.65 g) in water (250 mL) little by little, saturated with NaCl, and extracted with ethyl acetate-THF (3: 1). The organic layer was washed with saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was subjected to silica gel column chromatography (methanol/ethyl acetate), and the objective fraction was concentrated under reduced pressure to give the title compound (3.06 g) as a white amorphous solid (a mixture of two diastereomers). MS: [M+H]+ 1108.3.
C) N-(9-((5R,7R,8R,12aR,14R,15R,15aS,18R)-10-(2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4- dihydro-7H-pyrrolo [2,3 -d] pyrimidin-7-yl)-2-hydroxy- 18-((3 -hydroxy- 1,1, 3 ,3 -tetra(propan-2- yl)disiloxanyl)oxy)-2, 10-dioxidohexahydro- 14H- 15,12a-(epoxymethano)-5,8- methanofuro[3,2-l] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14(12H)-yl)-9H- purin-6-yl)benzamide
[1609] (lR,3R,4R,7S)-3-(6-Benzamido-9H-purin-9-yl)-l-((((2- cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4- ((3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphoryl)oxy)methyl)-2,5-dioxabicyclo[2.2. l]heptan-7-yl hydrogen phosphonate (3.06 g) was subjected successively to azeotropic dehydration with anhydrous acetonitrile (about 100 mL) and anhydrous pyridine (about 100 rriL), and dissolved in anhydrous pyridine (75 mL). 2-Chloro-5,5-dimethyl-l,3,2-dioxaphosphinane 2-oxide (1.78 g) was added thereto, and the mixture was stirred at room temperature for 1 hr under argon stream. Water (1.74 mL) and iodine (911 mg) were added thereto, and the mixture was stirred at room temperature for additional 15 min. The reaction mixture was quenched with 10% aqueous sodium thiosulfate solution (7.5 mL), and concentrated under reduced pressure. The residue was diluted with water (100 mL), and the mixture was extracted with ethyl acetate-THF (3: 1). The organic layer was washed with saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. Toluene (about 100 mL) was added thereto, and the mixture was concentrated again under reduced pressure. The residue was subjected to silica gel column chromatography (methanol/ethyl acetate), and the objective fraction was concentrated under reduced pressure to give the title compound (2.38 g) as a white amorphous solid (a mixture of two diastereomers). MS: [M+H]+ 1106.3.
D) 7-((5R, 7R, 8R, 12aR, 14R, 15R, 15aS , 18R)- 14-(6-amino-9H-punn-9-y l)-2, 10-dihydroxy- 18- ((3 -hydroxy- 1 , 1 ,3 ,3 -tetra(propan-2-yl)disiloxany l)oxy)-2, 10-dioxidohexahydro- 14H- 15,12a- (epoxymethano)-5,8-methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin- 7(12H)-yl)-5-fluoro-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
[1610] N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 10-(2-Cyanoethoxy)-7-(5-fluoro-4-oxo-
3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-18-((3-hydroxy-l, 1,3,3- tetra(propan-2-yl)disiloxanyl)oxy)-2, 10-dioxidohexahydro- 14H- 15,12a-(epoxymethano)-5,8- methanofuro[3,2-l] [ 1 ,3 ,6,9, 11 ,2, 1 O]pentaoxadiphosphacyclotetradecin- 14(12H)-yl)-9H- purin-6-yl)benzamide (2.38 g) was dissolved in 40% methylamine methanol solution (40 mL), the solution was stirred at room temperature for 1 hr, and the reaction mixture was concentrated under reduced pressure. Toluene (about 80 mL) was added thereto, and the mixture was concentrated again under reduced pressure. The residue was subjected to silica gel column chromatography (methanol/ethyl acetate), and the objective fraction was concentrated under reduced pressure to give the title compound (756 mg) as a white solid. MS: [M+H]+ 949.2.
E) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-yl)-2, 10, 18-trihydroxy- 2,10-dioxidohexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(l 2H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer) 7-((5R,7R,8R,12aR,14R,15R,15aS,18R)-14-(6-Amino-9H-purin-9-yl)-2,10- dihydroxy-18-((3-hydroxy-l,l,3,3-tetra(propan-2-yl)disiloxanyl)oxy)-2,10- dioxidohexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7(12H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (756 mg) was dissolved in methanol (2 mL) and triethylamine (0.8 mL), triethylamine trihydrofluoride (3.90 mL) was added thereto, and the mixture was stirred at 50°C for 2 hr. The reaction mixture was allowed to cool to room temperature, neutralized with 1 M aqueous triethylammonium hydrogencarbonate solution (110 mL), and stirred at room temperature for 15 min. The reaction mixture was concentrated under reduced pressure, and the residue was subjected to ODS column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution). The objective fraction was concentrated under reduced pressure, and the residue was freeze-dried to give the title compound (504 mg) as a white solid. 1H NMR (300 MHz, D20) δ 1.20 (18H, t, J = 7.4 Hz), 3.12 (12H, q, J = 7.2 Hz), 4.02-4.16 (4H, m), 4.23-4.37 (3H, m), 4.55 (1H, d, J = 4.5 Hz), 4.82-4.93 (3H, m), 6.12 (1H, s), 6.39 (1H, dd, J = 8.3, 1.5 Hz), 7.19 (1H, d, J = 1.9 Hz), 7.96 (1H, s), 8.11 (1H, s), 8.17 (1H, s). 31P NMR (121 MHz, D20) δ -1.91, -1.80. EXAMPLE 17
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-yl)- 10, 18-dihydroxy- 2,10-dioxido-2-sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(12H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-trimethylamine salt (optical isomer)
Figure imgf000275_0001
Figure imgf000275_0002
A) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 10-(2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4- dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-18-((3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy)-2, 10-dioxido-2-sulfany lhexahydro- 14H- 15,12a- (epoxymethano)-5,8-methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-
14( 12H)-yl)-9H-purin-6-y l)benzamide
[1612] (lR,3R,4R,7S)-3-(6-Benzamido-9H-purin-9-yl)-l-((((2- cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4- ((3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphoryl)oxy)methyl)-2,5-dioxabicyclo[2.2. l]heptan-7-yl hydrogen phosphonate (3.71 g) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (70 mL). 2-Chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (2.15 g) was added thereto, and the mixture was stirred at room temperature for 1 hr under argon atmosphere. 3H-Benzo[c][l,2]dithiol-3-one (674 mg) was added thereto, and the mixture was stirred at room temperature for additional 1 hr. To the reaction mixture was added saturated aqueous sodium hydrogencarbonate solution, and the mixture was extracted with ethyl acetate. The organic layer was washed with saturated brine, and dried over sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (2.78 g). MS: [M+H]+ 1122.2
B) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-yl)- 10-hydroxy- 18-((3- hydroxy- 1 , 1 ,3 ,3 -tetraisopropyldisiloxanyl)oxy)-2, 10-dioxido-2-sulfanylhexahydro- 14H-
15, 12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(l 2H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1613] N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 10-(2-Cyanoethoxy)-7-(5-fluoro-4-oxo-
3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-18-((3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy)-2, 10-dioxido-2-sulfany lhexahydro- 14H- 15,12a- (epoxymethano)-5, 8-methanofuro[3,2-l] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin- 14(12H)-yl)-9H-purin-6-yl)benzamide (2.78 g) was dissolved in 40% methylamine methanol solution (50 rriL), the solution was stirred at room temperature for 1 hr under argon atmosphere, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (30 mg). MS: [M+H]+ 965.3.
C) 7-((5R, 7R, 8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-y 1)- 10, 18-dihydroxy-
2,10-dioxido-2-sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(l 2H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
[1614] To 7-((5R, 7R, 8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-y 1)- 10-hydroxy-
18-((3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy)-2,10-dioxido-2-sulfanylhexahydro- 14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2-
1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7(12H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer) (30 mg) were added triethylamine trihydrofluoride (0.70 mL) and methanol (1 rriL), and the mixture was stirred at 50°C for 3 hr. To the reaction solution was added ethoxy(trimethyl)silane (2.5 mL), the mixture was stirred at room temperature for 30 min, and the solvent was evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and the obtained solid was freeze- dned to give the title compound (25 mg). 1H NMR (300 MHz, D20) 51.19 (18H, t, J = 7.4 Hz), 3.11 (12H, q, J = 7.2 Hz), 3.99-4.09 (3H, m), 4.09-4.17 (2H, m), 4.22-4.29 (1H, m), 4.34-4.38 (1H, m), 4.50-4.54 (2H, m), 4.90-4.96 (1H, m), 5.06 (1H, s), 6.11 (1H, s), 6.35 (1H, dd, J = 8.3, 1.1 Hz), 7.19 (1H, d, J = 2.3 Hz), 7.94 (1H, s), 8.08 (1H, s), 8.16 (1H, s). 31P NMR (121 MHz, D20) δ 55.76, -1.56.
EXAMPLE 18
Synthesis of 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-yl)-2, 18-dihydroxy- 2,10-dioxido-10-sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(12H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000277_0001
A) (lR,3R,4R,7S)-3-(6-benzamido-9H-purin-9-yl)-l-((((2-cyanoethoxy)(((6aR,8R,9R,9aR)- 8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro- 6H-furo[3,2-f [l,3,5,2,4]trioxadisilocin-9-yl)oxy)phosphorothioyl)oxy)methyl)-2,5- dioxabicyclo[2.2.1]heptan-7-yl hydrogen phosphonate
[1615] A mixture of (lS,3R,4R,7S)-3-(6-benzamido-9H-purin-9-yl)-l-(hydroxymethyl)-2,5- dioxabicyclo[2.2.1]heptan-7-yl hydrogen phosphonate (3.0 g) and 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4- tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl
diisopropylphosphoramidite (5.86 g) was subjected to azeotropic dehydration with anhydrous acetonitrile, and suspended in anhydrous THF (25 mL). 5-(Ethylsulfanyl)-2H-tetrazole (2.62 g), which was subjected in advance to azeotropic dehydration with anhydrous acetonitrile, was dissolved in anhydrous acetonitrile (25 mL), the solution was added to the above- mentioned suspension, and the mixture was stirred overnight at room temperature under argon atmosphere. ((Dimethylaminomethylidene)amino)-3H-l ,2,4-dithiazoline-3-thione (2.75 g) was added thereto, and the mixture was stirred at room temperature for additional 30 min. The solvent was evaporated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (4.96 g). MS: [M+H]+ 1106.3.
B) (lR,3R,4R,7S)-3-(6-benzamido-9H-purin-9-yl)-l-((((2-cyanoethoxy)(((2R,3R,4R,5R)-2- (5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4-((3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphorothioyl)oxy)methyl)-2,5-dioxabicyclo[2.2.1]heptan-7-yl hydrogen phosphonate
[1616] (lR,3R,4R,7S)-3-(6-Benzamido-9H-purin-9-yl)-l-((((2- cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)- 2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9- yl)oxy)phosphorothioyl)oxy)methyl)-2,5-dioxabicyclo[2.2.1 ]heptan-7-yl hydrogen phosphonate (4.96 g) was dissolved in a mixed solvent of THF (60 mL) and water (12 mL), and the solution was ice-cooled. Trifluoroacetic acid (12.1 mL) was added thereto, and the mixture was stirred at 0°C for 3 hr. The reaction mixture was quenched with a solution of sodium bicarbonate (18.8 g) in water (100 mL), and extracted with ethyl acetate-THF (3: 1). The organic layer was dried over sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (3.77 g). MS: [M+H]+ 1124.2. C) N-(9-((5R,7R,8R,12aR,14R,15R,15aS,18R)-10-(2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4- dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-18-((3-hydroxy-l,l,3,3- tetraisopropyldisiloxany l)oxy)-2-oxido- 10-sulfidohexahydro- 14H- 15,12a-(epoxymethano)- 5, 8-methanofuro[3,2-l] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14(12H)-yl)-9H- purin-6-yl)benzamide
[1617] (lR,3R,4R,7S)-3-(6-Benzamido-9H-purin-9-yl)-l-((((2- cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4- ((3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphorothioyl)oxy)methyl)-2,5-dioxabicyclo[2.2.1 ]heptan-7-yl hydrogen phosphonate (3.77 g) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (70 mL). 2-Chloro-5,5- dimethyl-l,3,2-dioxaphosphinane 2-oxide (2.17 g) was added thereto, and the mixture was stirred at room temperature for 1 hr under argon atmosphere. Water (2.12 mL) and iodine (1.11 g) were added thereto, and the mixture was stirred at room temperature for additional 1 hr. The reaction mixture was quenched with 10% aqueous sodium thiosulfate solution (15 mL), and the solvent was evaporated under reduced pressure. The residue was diluted with water (100 mL), and the mixture was extracted with ethyl acetate-THF (3: 1). The organic layer was dried over sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (2.21 g). MS: [M+H]+ 1122.2.
D) 7-((5R, 7R, 8R, 12aR, 14R, 15R, 15aS , 18R)- 14-(6-amino-9H-punn-9-y l)-2-hy droxy- 18-((3 - hydroxy-l,l,3,3-tetra(propan-2-yl)disiloxanyl)oxy)-2,10-dioxido-10-sulfanyl-hexahydro-
14H- 15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(l 2H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1618] To N-(9-((5R,7R, 8R, 12aR, 14R, 15R, 15aS, 18R)- 10-(2-cyanoethoxy)-7-(5-fluoro-4- oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-18-((3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy)-2-oxido-10-sulfidohexahydro-14H-15,12a-(epoxymethano)- 5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14(12H)-yl)-9H- purin-6-yl)benzamide (2.38 g) was added 40% methylamine methanol solution (40 mL), and the mixture was stirred at room temperature for 1 hr under argon atmosphere. The obtained mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile), the obtained fraction was concentrated under reduced pressure, and the residue was freeze-dried to give the title compound (710 mg). MS: [M+H]+ 965.2.
E) 7-((5R,7R,8R,12aR,14R,15R,15aS,18R)-14-(6-amino-9H-punn-9-yl)-2,18-dihydroxy- 2,10-dioxido-10-sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(l 2H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer) To a solution of 7-((5R,7R,8R,12aR,14R,15R,15aS,18R)-14-(6-amino-9H-purin-9- yl)-2-hydroxy- 18-((3 -hydroxy- 1 , 1 ,3 ,3 -tetra(propan-2-y l)disiloxanyl)oxy)-2, 10-dioxido- 10- sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7(12H)-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer, derived from tR2) (710 mg) in methanol (20 rriL) was added triethylamine trihydrofluoride (4.80 mL), and the mixture was stirred at 50°C for 3 hr. To the reaction mixture was added ethoxytrimethylsilane (2.29 mL) at room temperature, and the mixture was stirred for 30 min. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and freeze- dried to give the title compound (530 mg). 1H NMR (300 MHz, D20) 51.22 (18H, t, J = 7.2 Hz), 3.14 (12H, q, J = 7.6 Hz), 4.03-4.19 (4H, m), 4.25-4.41 (3H, m), 4.65 (1H, d, J = 4.5 Hz), 4.84 (1H, d, J= 4.5 Hz), 4.91 (1H, s), 4.99 (1H, ddd, J = 10.1, 8.2, 4.3 Hz), 6.14 (1H, s), 6.39 (1H, d, J = 7.9 Hz), 7.17 (1H, d, J = 2.3 Hz), 7.97 (1H, s), 8.11 (1H, s), 8.19 (1H, s). 31P NMR (121 MHz, D20) 552.5,1.74.
EXAMPLE 19
Synthesis of 2-amino-9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15-fluoro-7-(5-fluoro-4-oxo-3 ,4- dihydro-7H-pyrrolo[2,3 -d]pyrimidin-7-yl)-2, 10, 16-trihydroxy-2, 10-dioxidooctahydro- 12H-5,8- methanofuro[3,2-l] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-l,9-dihydro-6H-purin-
6-one di-triethylamine salt (optical isomer)
Figure imgf000281_0001
A) (2R,3R,4R,5R)-2-((((2-cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H- pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f] [1,3,5, 2,4]trioxadisilocin-9-yl)oxy)phosphoryl)oxy)methyl)-4-fluoro-5-(2-isobutylamido-6- oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1620] 2'-Deoxy-2'-fluoro-3'-0-(hydroxy(oxido)phosphoranyl)-N-isobutyrylguanosine (680 mg) and 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin- 7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl diisopropylphosphoramidite (1535 mg) were subjected to azeotropic dehydration with anhydrous acetonitrile (three times), and suspended in anhydrous THF (10.00 ml). To the suspension was added a mixture of 5-(ethylsulfanyl)-2H-tetrazole (633 mg) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) and anhydrous acetonitrile (10 ml), and the mixture was stirred at room temperature for 7 hr under argon atmosphere. To the mixture were added a mixture of 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo- 3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-9-yl diisopropylphosphoramidite (1181 mg, 1.62 mmol) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) and anhydrous acetonitrile (3 ml), and a mixture of 5-(ethylsulfanyl)-2H-tetrazole (633 mg) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) and anhydrous acetonitrile (3 ml), and the mixture was stirred overnight at room temperature under argon atmosphere. To the reaction mixture was added 70% tert-butyl hydroperoxide aqueous solution (0.674 rriL), and the mixture was stirred at room temperature for additional 30 min. To the reaction mixture was added a mixture of sodium thiosulfate pentahydrate (2817 mg) and water (4 mL), and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (1260 mg). MS: [M+H]+ 1062.3.
B) (2R,3R,4R,5R)-2-((((2-cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3- d]pyrimidin-7(4H)-yl)-4-((3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy)-5- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)phosphoryl)oxy)methyl)-4-fluoro-5-(2- isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate
[1621] To a mixture of (2R,3R,4R,5R)-2-((((2-cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-
4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f] [l,3,5,2,4]trioxadisilocin-9-yl)oxy)phosphoryl)oxy)methyl)-4-fluoro-5-(2-isobutylamido-6- oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate (1.26 g), THF (16 ml) and water (4 ml) was added trifluoroacetic acid (3.18 ml) at 0°C, and the mixture was stirred for 4 hr. To the mixture was added an aqueous solution of sodium hydrogencarbonate (4.98 g) , and the mixture was saturated with sodium chloride. The mixture was extracted with ethyl acetate/THF, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (1000 mg). MS: [M+H]+ 1080.3.
C) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5-fluoro-4- oxo-3 ,4-dihydro-7H-pyrrolo[2,3 -d]pyrimidin-7-yl)-2-hydroxy- 16-((3 -hydroxy- 1,1,3,3- tetraisopropyldisiloxanyl)oxy)-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)-6-oxo-6,9-dihydro- 1 H-purin-2- yl)-2-methylpropanamide
[1622] (2R,3R,4R,5R)-2-((((2-Cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H- pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4-((3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy)-5- (hydroxymethyl)tetrahydrofuran-3-yl)oxy)phosphoryl)oxy)methyl)-4-fluoro-5-(2- isobutylamido-6-oxo-lH-purin-9(6H)-yl)tetrahydrofuran-3-yl hydrogen phosphonate (1 g) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (24 mL). 2-Chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (598 mg) was added thereto, and the mixture was stirred at room temperature for 15 min under argon atmosphere. Water (0.584 mL) and iodine (305 mg) were added thereto, and the mixture was stirred at room temperature for additional 25 min. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (800 mg). MS: [M+H]+ 1078.2
D) 2-amino-9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15-fluoro-7-(5-fluoro-4-oxo-3,4- dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,10-dihydroxy-16-((3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy)-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl)- 1 ,9-dihydro-6H-purin-6-one
(optical isomer)
[1623] To N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5- fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-16-((3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy)-2, 10-dioxidooctahydro- 12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-6-oxo-6,9-dihydro-lH-purin-2- yl)-2-methylpropanamide (800 mg, 0.74 mmol) was added 33% methylamine ethanol solution (30 mL), the mixture was stirred overnight at room temperature under argon atmosphere, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (163.4 mg). MS: [M+H]+ 955.3.
E) 2-amino-9-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 15-fluoro-7-(5-fluoro-4-oxo-3,4- dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,10,16-trihydroxy-2,10-dioxidooctahydro-12H-
5, 8-methanofuro [3 ,2-1] [ 1 ,3 , 6,9, 11 ,2, 10] pentaoxadiphosphacyclotetradecin- 14-yl)- 1 ,9- dihydro-6H-purin-6-one di-triethylamine salt (optical isomer)
[1624] A mixture of 2-amino-9-((5R,7R,8R,12aR,14R,15R,15aR,16R)-15-fluoro-7-(5- fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,10-dihydroxy-16-((3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy)-2, 10-dioxidooctahydro- 12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-l,9-dihydro-6H-purin-6-one (optical isomer) (21.4 mg), triethylamine trihydrofluoride (0.183 rriL) and methanol (0.07 rriL) was stirred at 50°C for 1 hr under argon atmosphere. To the reaction mixture was added ethoxy(trimethyl)silane (1.046 mL), the mixture was stirred at room temperature for additional 1 hr, and the solvent was evaporated under reduced pressure. The residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and freeze-dried to give the title compound (4.6 mg). 1H NMR (300 MHz, D20) δ 1.20 (18H, t, J = 7.3 Hz), 3.13 (12H, q, J = 7.3 Hz), 4.07 (2H, d, J = 11.1 Hz), 4.25 (2H, d, J = 7.6 Hz), 4.33-4.99 (4H, m), 5.04-5.25 (1H, m), 5.41-5.70 (1H, m), 6.17 (1H, d, J = 19.0 Hz), 6.38 (1H, d, J = 9.2 Hz), 7.32 (1H, s), 7.79 (1H, brs), 7.95 (1H, s). 31P NMR (121 MHz, D20) δ -1.61, -1.52.
EXAMPLE 20
Synthesis of 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-punn-9-y 1)- 2,10,15,16-tetrahydroxy-2-oxido-10-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
Figure imgf000284_0001
A) (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-((tert-butyldimethylsilyl)oxy)-2-((((2- cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-
2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f] [1,3,5, 2,4]trioxadisilocin-9- yl)oxy)phosphorothioyl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate
[1625] A mixture of (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-((tert- butyldimethylsilyl)oxy)-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (3.0 g) and 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)- yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl
diisopropylphosphoramidite (5.36 g) was subjected to azeotropic dehydration with anhydrous acetonitrile, and suspended in anhydrous acetonitrile (25 mL) and anhydrous THF (15 mL). 5-(Ethylsulfanyl)-2H-tetrazole (2.13 g), which was subjected in advance to azeotropic dehydration with anhydrous acetonitrile, was dissolved in anhydrous acetonitrile (15 mL), the solution was added to the above-mentioned suspension, and the mixture was stirred overnight at room temperature under argon atmosphere. ((Dimethylaminomethylidene)amino)-3H-l,2,4-dithiazoline-3-thione (2.24 g) was added thereto, and the mixture was stirred at room temperature for additional 1 hr. The solvent was evaporated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (5.15 g). MS: [M+H]+ 1208.3.
B) (2R,3R,4R,5R)-5-(6-benzamido-9H-purin-9-yl)-4-((tert-butyldimethylsilyl)oxy)-2-((((2- cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)-yl)-4-
((3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran-3- yl)oxy)phosphorothioyl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate
[1626] (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-4-((tert-butyldimethylsilyl)oxy)-2- ((((2-cyanoethoxy)(((6aR,8R,9R,9aR)-8-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)- yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9- yl)oxy)phosphorothioyl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate (5.15 g) was dissolved in a mixed solvent of THF (48 mL) and water (10 mL), and the solution was ice- cooled. Trifluoroacetic acid (11.5 mL) was added thereto, and the mixture was stirred at 0°C for 3 hr. The reaction mixture was quenched with a solution of sodium bicarbonate (12.5 g) in water (100 mL), and extracted with ethyl acetate- THF. The organic layer was washed with saturated brine, and dried over sodium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (5.13 g). MS: [M+H]+ 1226.4.
C) N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15-((tert-butyl(dimethyl)silyl)oxy)- 10-(2- cyanoethoxy)-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy- 16-((3-hydroxy-l,l,3,3-tetra(propan-2-yl)disiloxanyl)oxy)-2-oxido-10-sulfidooctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H- purin-6-yl)benzamide
[1627] (2R,3R,4R,5R)-5-(6-Benzamido-9H-purin-9-yl)-4-((tert-butyldimethylsilyl)oxy)-2- ((((2-cyanoethoxy)(((2R,3R,4R,5R)-2-(5-fluoro-4-oxo-3H-pyrrolo[2,3-d]pyrimidin-7(4H)- yl)-4-((3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy)-5-(hydroxymethyl)tetrahydrofuran- 3-yl)oxy)phosphorothioyl)oxy)methyl)tetrahydrofuran-3-yl hydrogen phosphonate (5.13 g) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and suspended in anhydrous pyridine (100 mL). 2-Chloro-5,5-dimethyl-l,3,2- dioxaphosphinane 2-oxide (2.70 g) was added thereto, and the mixture was stirred at room temperature for 1 hr under argon atmosphere. Water (2.64 g) and iodine (1.38 g) were added thereto, and the mixture was stirred at room temperature for additional 1 hr. The reaction mixture was quenched with sodium thiosulfate (5.19 g) and water (2.64 g), and extracted with ethyl acetate. The organic layer was washed with water and saturated brine, and dried over anhydrous magnesium sulfate, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (3.53 g). MS: [M+H]+ 1224.4.
D) 7-((5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -((( 1 , 1 - dimethylethyl)dimethylsilyl)oxy)octahydro-2, 10-dihydroxy-l 6- ((3 -hydroxy- 1,1,3,3- tetrakis(l-methylethyl)disiloxanyl)oxy)-2-oxido-10-sulfanyl-5,8-methano-12H-furo[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer)
[1628] To N-(9-((5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15-((tert-butyl(dimethyl)silyl)oxy)-
10-(2-cyanoethoxy)-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2- hydroxy- 16-((3 -hydroxy- 1 , 1 ,3 ,3 -tetra(propan-2-yl)disiloxanyl)oxy)-2-oxido- 10- sulfidooctahydro-12H-5,8-methanofuro[3,2-
1] [1 ,3,6,9, 1 l,2,10]pentaoxadiphosphacyclotetradecin-14-yl)-9H-purin-6-yl)benzamide (3.5 g) was added 40% methylamine methanol solution (50 mL), and the mixture was stirred at room temperature for 1 hr under argon atmosphere. The obtained mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was purified by HPLC (L-column2 ODS, 50x 150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile), the obtained fraction was concentrated under reduced pressure, and the residue was freeze-dried to give the title compound (210 mg). MS: [M+H]+ 1067.4.
E) 7-((5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-purin-9-yl)-2, 10,15,16- tetrahydroxy-2-oxido-10-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer)
[1629] To a solution of 7-((5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(6-amino-9H-purin-9- yl)- 15-(((l , 1 -dimethylethyl)dimethylsilyl)oxy)octahydro-2, 10-dihydroxy- 16-((3-hydroxy- 1 , 1 ,3,3-tetrakis(l -methylethyl)disiloxanyl)oxy)-2-oxido- 10-sulfanyl-5,8-methano-12H- furo[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl)-5-fluoro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer, derived from tR2) (210 mg) in methanol (1.0 mL)-triethylamine (0.4 mL) was added triethylamine trihydrofluoride (0.962 mL), and the mixture was stirred at 50°C for 2.5 hr. To the reaction mixture was added ethoxytrimethylsilane (4.59 mL) at room temperature, and the mixture was stirred for 30 min. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 silica gel column chromatography (10 mM triethylammonium acetate buffer solution/acetonitrile), and freeze-dried to give the title compound (125 mg).
[1630] 1H NMR (300 MHz, D20) 51.13-1.28 (18H, m), 3.12 (12H, q, J = 7.2 Hz), 4.02-4.11
(1H, m), 4.13-4.25 (2H, m), 4.27-4.40 (2H, m), 4.46 (1H, d, J = 6.4 Hz), 4.73-4.79 (2H, m), 4.80-4.91 (1H, m), 5.02 (1H, td, J = 8.8, 4.2 Hz), 6.08 (1H, d, J = 1.7 Hz), 6.35 (1H, d, J = 8.1 Hz), 7.27 (1H, d, J = 1.7 Hz), 7.93 (1H, s), 8.14 (1H, s), 8.18 (1H, s). 31P NMR (121 MHz, D20) 552.4,1.21. EXAMPLE 23
Synthesis of 7-[(5R,7R,8R,12aR,14R,15R,15aS,16R)-14-(6-amino-9H-purin-9-yl)-10,15,16- trihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 1 and 2)
Figure imgf000288_0001
A) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9-yl]-4- {[tert-butyl(dimethyl)silyl]oxy}-2- ({[(2-cyanoethoxy){[(6aR,8R,9R,9aR)-8-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-9-yl]oxy}phosphoryl]oxy}methyl)tetrahydrofuran-3-yl hydrogen phosphonate
(2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-4-{[tert- butyl(dimethyl)silyl]oxy} -2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (250 mg) and 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-9-yl diisopropylphosphoramidoite (359 mg)(Example 24 step C) were subjected to azeotropic dehydration with anhydrous acetonitrile, and anhydrous acetonitrile (1.1 mL) and anhydrous tetrahydrofuran (0.7 mL) were added thereto. To the mixture was added a solution of 5-(ethylsulfanyl)-2H-tetrazole (175 mg) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) in anhydrous acetonitrile (0.75 mL), and the mixture was stirred under argon atmosphere at room temperature for 2 hr. Tert-butyl hydroperoxide (5.5 mol/L) in nonane (0.25 mL) was added thereto, and the mixture was stirred at room temperature for 40 min. The reaction mixture was cooled in ice bath and a solution of sodium thiosulfate (345 mg) in water (0.275 mL) was added. The mixture was allowed to stir at room temperature for 15 min and was concentrated under reduced pressure. The crude product was purified by silica gel column chromatography (methanol/dichloromethane) to give the title compound (318 mg) as a mixture of diastereomers. MS: [M+H]+ 1206.3
B) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-4- {[tert-butyl(dimethyl)silyl]oxy} -2- ({[(2-cyanoethoxy)({(2R,3R,4R,5R)-2-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)-4-[(3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3- yl} oxy)phosphoryl]oxy}methyl)tetrahydrofuran-3-yl hydrogen phosphonate
(2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-4-{[tert- butyl(dimethyl)silyl]oxy}-2-({[(2-cyanoethoxy){[(6aR,8R,9R,9aR)-8-(5-fluoro-3-methyl-4- oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H- furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl]oxy}phosphoryl]oxy}methyl)tetrahydrofuran-3-yl hydrogen phosphonate (315 mg) was dissolved in a mixture of tetrahydrofuran (2.8 mL) and water (0.71 mL) and the solution was allowed to stir and cooled in ice bath. Trifluoroacetic acid (0.71 mL) was added drop wise and the mixture was allowed to stir at 0-5°C for 2hr 15 min. Sodium bicarbonate (1.14 g) was added gradually to the reaction mixture while maintaining good stirring followed by addition of water (3 mL) and ethyl acetate (10 mL). Separated aqueous layer was extracted with ethyl acetate (10 mL). Combined organics was washed with brine (3 mL), dried over anhydrous sodium sulfate, filtered, and the solvent was evaporated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/methylene chloride) to give the title compound (145 mg). MS: [M+H]+ 1224.3 C) N-(9- {(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 15- { [tert-buty l(dimethyl)silyl]oxy } - 10-(2- cyanoethoxy)-7-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-16- [(3 -hydroxy- 1 , 1 ,3 ,3 -tetraisopropyldisiloxany l)oxy] -2, 10-dioxido-2-sulfanyloctahydro- 12H- 5, 8-methanofuro[3,2-l] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl}-9H-purin-
6-yl)benzamide
[1633] (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9-yl]-4-{[tert- butyl(dimethyl)silyl]oxy} -2-( {[(2-cyanoethoxy)( {(2R,3R,4R,5R)-2-(5-fluoro-3-methyl-4- oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)-4-[(3-hydroxy- 1 , 1 ,3 ,3-tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3 - yl}oxy)phosphoryl]oxy}methyl)tetrahydrofuran-3-yl hydrogen phosphonate (143 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine (2.3 rriL) was added thereto. To the mixture was added 2-chloro-5,5-dimethyl- 1,3,2- dioxaphosphinane 2-oxide (75 mg), and the mixture was stirred under argon atmosphere at room temperature for 45 min. Water (75 pL) and 3H-l,2-benzodithiol-3-one 1,1-dioxide (29 mg) were added thereto, and the mixture was stirred at room temperature for additional 40 min. To the reaction mixture was added a solution of sodium thiosulfate pentahydrate (150 mg) in water (0.35 mL), and the mixture was stirred at room temperature for 5 min. The mixture was concentrated, toluene was added thereto, and the mixture was concentrated under reduced pressure (repeat 4X). The crude product was purified by silica gel column chromatography (methanol/dichloromethane) to give the title compound (84 mg) as a mixture of diastereomers. MS: [M+H]+ 1238.3
D) 7- { (5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- { [tert- butyl(dimethyl)silyl] oxy } - 10-hy droxy- 16- [(3 -hydroxy- 1,1,3,3- tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl}-5-fluoro-3-methyl-3,7-dihydro-
4H-pyrrolo[2,3-d]pyrimidin-4-one
[1634] To N-(9- {(5RJR, 8R, 12aR, 14R, 15R, 15aR, 16R)- 15- { [tert-buty l(dimethyl)silyl] oxy } -
10-(2-cyanoethoxy)-7-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7- yl)- 16- [(3 -hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy]-2, 10-dioxido-2-sulfanyloctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl}-9H- purin-6-yl)benzamide(83 mg) was added 33% methylamine ethanol solution (2.0 mL), and the mixture was stirred under argon atmosphere at room temperature for 1 hr, and concentrated under reduced pressure. The crude product was purified by reverse phase chromatography (ISCO RediSepRf Gold HP C18 15.5 g column) eluted with 0 to 70% ACN in lOmM aq NH4OAc to give two isolated single isomers of the title compounds: peak 1 (early fraction, 11 mg) and peak 2 (late fraction, 44.5 mg). MS: [M+H]+ 1081.3
E) 7-[(5R,7R,8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-punn-9-yl)- 10,15,16- trihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 1)
To 7- { (5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- { [tert- butyl(dimethyl)silyl]oxy}-10-hydroxy-16-[(3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl}-5-fluoro-3-methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one (324 mg, peak 2 / late fraction from step D) were added pyridine (6.0 mL) and triethylamine trihydrofluoride (0.303 mL). The reaction mixture was stirred at 55°C for 16 hr. LCMS analysis showed some of monoprotected intermediate. Methanol (2.0 mL) was added and the reaction mixture was stirred at 55°C for 3 hr. LCMS then showed completed reaction. The reaction mixture was concentrated under reduced pressure and water (6.7 mL) and calcium chloride (700 mg) were added. The resulting suspension was stirred for 1 hr and was filtered on a pad of Celite®. The filtrate was concentrated under reduce pressure, and the residue was purified by reverse phase chromatography (ISCO RediSepRf Gold HP C18Aq column) eluted with 0 to 15% ACN in 10 rriM aq triethylammonium acetate to give the title compound (195 mg). MS: [M+H]+ 707.1 1H NMR (400 MHz, D20) δ 1.27 (18H, t, J = 7.3 Hz), 3.19 (12H, q, J = 7.3 Hz), 3.35 (3H, s), 4.06-4.10 (1H, m), 4.18-4.26 (1H, m), 4.32-4.37 (1H, m), 4.39-4.54 (3H, m), 4.63 (1H, d, J = 4.0 Hz), 4.80-4.82 (1H, m), 5.03-5.12 (2H, m), 6.15-6.17 (1H, m), 6.35-6.39 (1H, m), 7.33-7.37 (1H, m), 8.13 (1H, s), 8.15 (1H, s), 8.27 (1H, s). 3 XP NMR (162 MHz, D20) δ -
2.22, 54.80. 19F NMR (376 MHz, D20) δ -164.6. F) 7- [(5RJR, 8R, 12aR, 14R, 15R, 15aS, 16R)- 14-(6-amino-9H-purin-9-yl)- 10,15,16- trihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 2)
Optical isomer 2 was prepared by using the same procedure as for optical isomer 1. 7-
{(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15- { [tert- butyl(dimethyl)silyl]oxy} -10-hydroxy-16-[(3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [1 ,3, 6,9,1 1,2,10]pentaoxadiphosphacyclotetradecin-7-yl}-5-fluoro-3-methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one (24.5 mg, peak 1 / early fraction from step D) give the title compound (1 1.8 mg). MS: [M+H]+ 707.1. lH NMR (400 MHz, D20) δ ppm 1.25 (18 H, t, J=7.22 Hz), 3.17 (q, J=7.24 Hz, 12 H), 3.35 (3H, s), 4.12 - 4.22 (3H, m), 4.40 - 4.53 (3H, m), 4.62 (1H, m), 4.83 - 4.90 (1H, m), 4.93 - 4.98 (1H, m), 5.09 - 5.15 (1H, m), 6.16 (1H, s), 6.28 - 6.36 (1H, m), 7.50 (1H, s), 8.12 (1H, s), 8.15 (1H, s), 8.31 (1H, s). 31P NMR
(162 MHz, D20) δ -2.42, 54.11. 1 9F NMR (376 MHz, D20) δ -165.54
EXAMPLE 24
Synthesis of 7- [(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- fluoro-10,16-dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 1 and 2 )
Figure imgf000293_0001
A) 7-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl]-5-fluoro-3- methyl-pyrrolo[2,3-d]pyrimidin-4-one.
7-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl]-5-fluoro-
3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (300 mg) was dissolved in N,N- dimethylformamide (3.30 mL) and potassium carbonate (192 mg) was added. The suspension was cooled in ice bath. lodomethane (0.080 mL) was added. The mixture was stirred with cooling for 5 min and then stirred at room temperature overnight. The mixture was concentrated and water was added, neutralized with 1M HC1 to pH ~6. The resulted solid was collected by filtration and dried under vacuum overnight to give the title compound (266 mg). MS: [M+H]+ 300.1.
B) 5-fluoro-7-[(6aR,8R,9R,9aS)-9-hydroxy-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-8-yl]-3-methyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one.
[1638] 7-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl]-5-fluoro-3- methyl-pyrrolo[2,3-d]pyrimidin-4-one (985 mg) (pre-azeotroped with acetonitrile 3 times and dried in vacuum for 5 hours) was dissolved in pyridine (9.75 rriL) and N,N- dimethylformamide (4.80 mL). After stirring for 15 min 1,3-dichloro-l, 1,3,3- tetraisopropyldisiloxane (1.02 mL) was added drop wise. The mixture was stirred at room temperature overnight. The mixture was concentrated under reduced pressure and azeotroped with toluene. The residue was partitioned between EtOAc (120 mL) and water (50 mL). Separated organic layer was washed with water (2 X 50 mL) and brine (50 mL), dried over Na2S04, filtered and concentrated under reduced pressure. The residue was purified by chromatography using EtOAc / hexane to give the title compound (1.41 g). MS: [M+H]+ 542.3.
C) 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9- yl diisopropylphosphoramidoite
[1639] In a 15 mL round bottom flask 5-fluoro-7-[(6aR,8R,9R,9aS)-9-hydroxy-2,2,4,4- tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-8-yl]-3-methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one (1.41 g) was azeotroped with dry acetonitrile(3 X 5 mL), dissolved in dry N,N-dimethylformamide (6.17 mL) under Argon. lH-tetrazole 0.45M in acetonitrile (7.05 mL), 1 -methyl- lH-imidazole (123 μΙ_) and 2-cyanoethyl Ν,Ν,Ν',Ν'- tetraisopropylphosphorodiamidite (1.86 mL) were added. The mixture was stirred at room temperature for 1 hour. The mixture was diluted with 70 ml of EtOAc, washed with saturated NaHC03(X 2) and brine, dried over Na2S04, filtered and concentrated under reduced pressure. The crude residue was purified by silica gel chromatography using EtOAc / hexane (0.5% Et3N) to give the title compound (1.87 g). MS: [M+H]+ 742.4.
D) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-2-({[(2- cyanoethoxy){[(6aR,8R,9R,9aR)-8-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f [l,3,5,2,4]trioxadisi yl] oxy } phosphoryl] oxy } methy l)-4-fluorotetrahydrofuran-3 -yl hydrogen phosphonate
[1640] In a 100 mL round bottom flask 2-cyanoethyl (6aR,8R,9R,9aR)-8-(5-fluoro-3- methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2,4,4- tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl
diisopropylphosphoramidoite (937 mg) and (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin- 9-yl]-4-fluoro-2-(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (425 mg) were azeotroped with dry C¾CN(3 X 5 mL), suspended in dry tetrahydrofuran (1.80 mL) and acetonitrile (2.95 mL) under Argon. A solution of 5-(ethylthio)-lH-tetrazole (380 mg) (pre- azeotroped with acetonitrile 3 x 5 mL) in dry acetonitrile (1.80 mL) was added. The mixture was allowed to stir at room temperature for 1 hour. Tert-butyl hydroperoxide (5.5 mol/L) in nonane (425 μL) was added. The mixture was stirred for 40 min at room temperature then cooled in an ice bath. A solution of sodium thiosulfate (500.0 mg) in water (700 μL as added and the mixture was stirred for 10 min. The mixture was concentrated under reduced pressure and the residue was purified by silica gel column chromatography (methanol/DCM). The title compound (1.10 g) as a mixture of two optical isomers was afforded. MS: [M+H]+ 1094.3.
E) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9-yl]-2-({[(2- cyanoethoxy)({(2R,3R,4R,5R)-2-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-5-(hydroxymethyl)-4-[(3-hydroxy-l, 1,3,3- tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3-yl}oxy)phosphoryl]oxy}methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate.
[1641] To a solution of (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-2-({[(2- cyanoethoxy){[(6aR,8R,9R,9aR)-8-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9- yl]oxy}phosphoryl]oxy}methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate (1.10 g) in tetrahydrofuran (11.0 mL) and water (2.50 mL) cooled with an ice bath was slowly added trifluoroacetic acid (2.50 mL). The mixture was stirred with cooling for 4 hours. Sodium bicarbonate (3800 mg) was added, followed by 8 ml of water. The mixture was stirred for 5 min, brought to room temperature and extracted with EtOAc twice. The combined organic layer was washed with brine, dried over Na2S04, filtered and the filtrate was evaporated under reduced pressure to give a crude product. Chromatography using silica gel column (methanol/DCM) afforded the title compound (1.14 g). MS: [M+H]+ 1112.3. F) N-(9- {(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5-fluoro-3 - methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-16-[(3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl} -9H-purin-6-yl)benzamide.
[1642] In a 100 mL round bottom flask (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9- yl]-2-({[(2-cyanoethoxy)({(2R,3R,4R,5R)-2-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)-4-[(3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3-yl}oxy)phosphoryl]oxy}methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate (149 mg) was azeotroped with acetonitrile(3 X 4 mL) and dried under vacuum, dissolved in dry pyridine (2.35 mL) and cooled in an ice bath. 2-Chloro-5,5-dimethyl-l,3,2-dioxaphosphorinane 2-oxide (180 mg) in pyridine (0.120ml) was added. The mixture was allowed to stir at room temperature for 1.5 hour. Water (70.3 μL) was added, followed by 3H-l,2-benzodithiol-3-one (56.2 mg). The mixture was allowed to stir at room temperature for 40 min. Sodium thiosulfate (135 mg) in 1 mL of water was added. The mixture was stirred for 10 min, concentrated under reduced pressure, azeotroped with toluene to remove the pyridine. The residue was purified by silica gel column chromatography (methanol/DCM) to give the title compound as a mixture of two optical isomers (63.6 mg). MS: [M+H]+ 1126.3.
G) 7- {(5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(6-amino-9H-purin-9-yl)-15-fluoro-10- hydroxy-16-[(3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2- sulfanyloctahydro-12H-5,8-methanofuro[3,2- l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl}-5-fluoro-3-methyl-3,7-dihydro-
4H-pyrrolo[2, 3-d] pyrimidin-4-one
[1643] The mixture of two isomers N-(9-{(5R,7R,8R,12aR,14R,15R,15aR,16R)-10-(2- cyanoethoxy)-15-fluoro-7-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)- 16- [(3-hydroxy- 1 , 1 ,3 ,3-tetraisopropyldisiloxanyl)oxy]-2, 10-dioxido-2- sulfanyloctahydro-12H-5,8-methanofuro[3,2-
1] [1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl}-9H-purin-6-yl)benzamide (60.7 mg) was stirred in methylamine (33% wt.) in ethanol (3.00 mL) at room temperature for 1 hour. The volatile substance was evaporated off under reduced pressure. The crude product was purified by reverse phase chromatography (ISCO RediSepRf Gold HP CI 8 column) eluted with 0 to 50% ACN in lOmM aq NH4OAc to give two isolated single isomers of the title compounds: peak 1 (early fraction, 12 mg) and peak 2 (late fraction, 35.6 mg). MS: [M+H]+ 969.3.
H) 7-[(5R,7R,8R,l 2aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15 -fluoro- 10,16- dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2-
I] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro-
4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 1 )
[1644] 15 mL polypropylene conical tube was loaded with 7-
{(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-y 1)- 15-fluoro- 10-hy droxy- 16-[(3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2-sulfanyloctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl} -5- fluoro-3-methyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (35.6 mg, peak2 / late fraction from step G). Pyridine (273 μΐ.) was added, followed by triethylamine trihydrofluoride (27.3 μΐ.) and triethylamine (414 μΐ^). The mixture was allowed to stir at room temperature overnight and at 50 °C for 2 hours. The reaction mixture was cooled in ice bath and diluted with water (1.3 mL). A solution of calcium chloride (146.0 mg) in water (1.0 mL) was added slowly. The mixture was stirred for 30 min then filtered through a plug of Ce te®. The filtrate was concentrated under reduced pressure and the residue was purified by reverse phase chromatography (ISCO RediSepRf Gold HP C18Aq column) eluted with 0 to 10% ACN in lOmM aq triethylammonium acetate to give the title compound (23.9 mg). MS: [M+H]+ 709.2. 1H NMR (400 MHz, METHANOL-d4) δ 8.29 - 8.24 (m, 1H), 8.22 (s, 1H), 8.08 - 8.04 (m, 1H), 7.46 - 7.40 (m, 1H), 6.48 (d, 1H, J=12 Hz), 6.37 (d, 1H, J=16 Hz), 5.80 - 5.57 (m, 1H), 5.33 - 5.12 (m, 1H), 5.05 - 4.95 (m, 1H), 4.50 - 4.42 (m, 2H), 4.41 - 4.34 (m, 1H), 4.34 - 4.24 (m, 2H), 4.08 - 3.96 (m, 1H), 3.57 (s, 3H), 3.52 - 3.48 (m, 1H), 3.25 - 3.11 (m, 12H), 1.39 - 1.24 (m, 18H). 31P NMR (162 MHz, D20) δ-2.45, 55.32. 19F NMR (376.5 MHz, D20) δ- 164.60, -200.71.
I) 7- [(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15-fluoro- 10,16- dihydroxy-2,10-dioxido-2-sulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 2 )
[1645] 15 mL polypropylene conical tube was loaded with 7-
{(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-y 1)- 15-fluoro- 10-hy droxy- 16-[(3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy]-2,10-dioxido-2-sulfanyloctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl} -5- fluoro-3-methyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (12.0 mg, peak 1 / early fraction from step G). Pyridine (92 μΐ.) was added, followed by triethylamine trihydrofluoride (9.2 μΐ.) and triethylamine (140 μΐ^). The mixture was allowed to stir at 50 °C for 2 hours. The reaction mixture was cooled with an ice bath and diluted with water (1.0 mL). A solution of calcium chloride (6.98 mg) in water (1.0 mL) was added slowly. The mixture was stirred for 30 min then filtered through a plug of Celite®. The filtrate was concentrated under reduced pressure and the residue was purified by reverse phase chromatography (ISCO RediSepRf Gold HP C18Aq column) eluted with 0 to 10% ACN in lOmM aq triethylammonium acetate to give the title compound (1.94 mg). MS: [M+H]+ 709.3. 1H NMR (400 MHz, DEUTERIUM OXIDE) δ 8.20 (s, 1H), 8.06 (s, 1H), 7.99 (s, 1H), 7.46 - 7.40 (m, 1H), 6.37 (d, 1H, J=16 Hz), 6.27 (d, 1H, J=8 Hz), 5.83 (dd, 1H, Jl=52 Hz, J2=4 Hz), 4.98 - 4.84 (m, 2H), 4.57 (br d, J = 3.9 Hz, 2H), 4.54 - 4.48 (m, 2H), 4.46 - 4.36 (m, 3H), 4.20 - 4.11 (m, 3H), 3.55 - 3.47 (m, 3H), 3.20 - 3.06 (dd, 12H), 1.28 - 1.12 (t, 18H). 31P NMR (162 MHz, D20) δ-2.52, 53.94. 19F NMR (376.5 MHz, D20) δ-165.55, - 202.45.
EXAMPLE 25
Synthesis of 7- [(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- fluoro-2, 10, 16-trihydroxy-2, 10-dioxidooctahydro- 12H-5,8-methanofuro[3 ,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt
Figure imgf000299_0001
A) N-(9- {(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5-fluoro-3 - methyl-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-16-[(3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy]-2, 10-dioxidooctahydro- 12H-5, 8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl} -9H-purin-6-yl)benzamide In a 100 mL round bottom flask (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9- yl]-2-({[(2-cyanoethoxy)({(2R,3R,4R,5R)-2-(5-fluoro-3-methyl-4-oxo-3,4-dihydro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)-4-[(3-hydroxy-l,l,3,3- tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3-yl}oxy)phosphoryl]oxy}methyl)-4- fluorotetrahydrofuran-3-yl hydrogen phosphonate (1.14 g) was azeotroped with acetonitrile (3 X 4 mL) and dried under vacuum, dissolved in pyridine (18.0 mL) and cooled in an ice bath. 2-Chloro-5,5-dimethyl-l,3,2-dioxaphosphorinane 2-oxide (586 mg) was added in 2 portions. The mixture was allowed to stir at room temperature for 40 min. Water (0.554 mL) was added, followed by 3H-l,2-benzodithiol-3-one 1,1-dioxide (251 mg). The mixture was allowed to stir at room temperature for 40 min. A solution of sodium thiosulfate (810 mg) in 2 mL of water was added. The mixture was concentrated under reduced pressure and azeotroped with toluene to remove the pyridine. The residue was purified by silica gel column chromatography (methanol/DCM) to give the title compound (650 mg). MS: [M+H]+ 1111.3
[1647]
B) 7- {(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-2, 10- dihydroxy- 16- [(3 -hydroxy- 1 , 1 ,3 ,3 -tetraisopropyldisiloxanyl)oxy] -2, 10-dioxidooctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl} -5- fluoro-3-methyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one
[1648] To a 25 rriL round-bottom flask was added N-(9-
{(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 10-(2-cyanoethoxy)- 15-fluoro-7-(5-fluoro-3 -methyl- 4-0X0-3, 4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2-hydroxy-16-[(3-hydroxy-l, 1,3, 3- tetraisopropyldisiloxanyl)oxy]-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin- 14-yl} -9H-purin-6-yl)benzamide (650 mg) and methylamine (33 mass%) in absolute ethanol (22.7 mL). The mixture was stirred at room temperature for 3 hours. The reaction mixture was concentrated under reduced pressure and the residue was purified by by reverse phase chromatography (ISCO RediSepRf Gold HP CI 8 column) eluted with 0 to 60% ACN in lOmM aq NH4OAc to give the title compound (32.0 mg). MS: [M+H]+ 953.3.
C) 7-[(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-2, 10,16- trihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-fluoro-3 -methyl-3,7-dihydro- 4H-pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt.
[1649] 15 mL polypropylene conical tube was loaded with 7-
{(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-2, 10- dihydroxy- 16- [(3 -hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy]-2, 10-dioxidooctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-7-yl} -5- fluoro-3-methyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (32.0 mg) and pyridine(246 L) was added. To the suspension was added triethylamine trihydrofluoride (24.6 μΐ^), followed by triethylamine (372 μΐ^). The mixture was allowed to stir at room temperature overnight. The reaction mixture was cooled in ice bath and diluted with water (lmL). A solution of calcium chloride (18.6 mg) in water (1 mL) was added slowly. The mixture was stirred for 30 min then filtered through a plug of Celite®. The filtrate was concentrated under reduced pressure and the residue was purified by reverse phase chromatography (ISCO RediSepRf Gold HP C18Aq column) eluted with 0 to 5% ACN in lOmM aq triethylammonium acetate to give the title compound (8.3mg). MS: [M+H]+ 693.2. 1H NMR (400 MHz, METHANOL-d4) δ 8.36 (br, IH), 8.22 (s, IH), 8.05 (s, IH), 7.38 (d, IH, j=2), 6.48 (d, IH, j=8), 6.37 (d, IH, J=16 Hz), 5.70 (dd, IH, Jl=52 Hz, J2=4 Hz), 5.20 - 5.07 (m, IH), 4.98 - 4.92 (m, IH), 4.53 (d, IH, J=4 Hz), 4.45 - 4.33 (m, 2H), 4.33 - 4.19 (m, 3H), 4.09 - 4.03 (m, IH), 3.45 (s, 3H), 3.17 (qt, 12H), 1.28(t, 18H). 31P NMR (162 MHz, D20) δ- 1.66, -2.26. 19F NMR (376.5 MHz, D20) δ-164.5, -201.7.
EXAMPLE 26
Synthesis of 7- [(5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-purin-9-yl)- 15- fluoro- 16-hydroxy-2, 10-dioxido-2, 10-disulfanyloctahydro- 12H-5,8-methanofuro[3 ,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-chloro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt (optical isomer 1 and optical isomer 2):
Figure imgf000301_0001
Figure imgf000302_0001
A) (6aR,8R,9R,9aR)-8-(5-chloro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)- 2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl 2-cyanoethyl diisopropylphosphoramidoite
In a 100 mL round bottom flask 5-chloro-7-[(6aR,8R,9R,9aS)-9-hydroxy-2,2,4,4- tetraisopropyltetrahydro-6H-furo[3,2-f [l,3,5,2,4]trioxadisilocin-8-yl]-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (1.469 g) (synthesized in the same manner as in the method of Example 15 A)) was azeotroped with toluene (3 x) and dried in vacuum. The round bottom flask was evacuated and back filled with argon (3 x). Anhydrous N,N-dimethylformamide (5.00 mL) was added to dissolve the starting material with sonication for a minute, followed by 2-cyanoethyl Ν,Ν,Ν',Ν'-tetraisopropylphosphorodiamidite (2.50 mL), 1 -methylimidazole (0.13 mL) and then lH-tetrazole (0.45M in acetonitrile, 6.70 mL). The mixture was stirred under atmosphere of argon at room temperature for 3 hours. The mixture was diluted with EtOAc (200 mL). Saturated NaHCC solution was added. The aqueous layer was extracted with EtOAc twice. The combined EtOAc layer was washed with water then brine, dried over anhydrous Na2S04, filtered. The filtrate was concentrated under reduced pressure to give a crude oily product. The crude material was purified by column chromatography (ISCO RediSepRf DIOL HP Gold 100 g column) eluted with EtOAc:hexanes (1 :9 to 1 : 1) to give the title compound (1.77 g). MS: [M+H]+ 661.3 for the hydrolyzed fragment of the product.
B) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9-yl]-4-fluoro-2- (hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate.
[1651] N- {9-[(2R,3R,4R,5R)-5-{[bis(4-methoxyphenyl)(phenyl)methoxy]methyl}-3-fluoro- 4-hydroxytetrahydrofuran-2-yl]-9H-purin-6-yl}benzamide (2.64 g) was dissolved in anhydrous pyridine (18.0 mL) under argon, cooled with an ice bath. Diphenyl phosphite (1.60 mL) was added slowly over 1 min. The reaction solution was allowed to warm to room temperature and stirred for 1 hour. The second portion of diphenyl phosphite (0.35 mL) was added slowly and the mixture was kept stirring for 30 more min. The mixture was cooled with an ice bath. Water (2.0 mL) was added and the mixture was stirred at room temperature for 30 min. The mixture was concentrated under reduced pressure and azeotroped with toluene to further remove pyridine and water. The residue was dried on vacuum pump. To the residue was added acetic acid (10.0 mL) and water (2.0 mL). The mixture was stirred at room temperature for 30 min. The mixture was concentrated under reduced pressure and azeotroped with toluene, then dried on vacuum pump to give a crude oil, which was chromatographed on a silica column using MeOH/DCM (0/100 to 50 / 50) to afford 1.33 g of the title product as a white solid. MS: [M+H]+ 438.1.
C) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-2-({[{[(6aR,8R,9R,9aR)-8-(5- chloro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro- 6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl]oxy}(2- cyanoethoxy)phosphorothioyl]oxy}methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate.
[1652] In a 250 mL round bottom flask a mixture of (6aR,8R,9R,9aR)-8-(5-chloro-4-oxo-
3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-9-yl 2-cyanoethyl diisopropylphosphoramidoite (2.23 g) and (2R, 3R,4R, 5R)- 5- [6-(benzoylamino)-9H-purin-9-y 1] -4-fluoro-2-
(hydroxymethyl)tetrahydrofuran-3-yl hydrogen phosphonate (1.17 g) was azeotroped with dry acetonitrile ( 25 mL x 3 ), dried on vacuum pump for 1 hour. To the mixture was added anhydrous acetonitrile (20.0 mL) under argon, followed by a solution of 5-(ethylthio)-lH- tetrazole (1.00 g) (pre-azeotroped with dry acetonitrile, 10 mL x 3 and dried on vacuum pump) in anhydrous acetonitrile (10.0 mL). The mixture was stirred at room temperature for 1 hour 20 min. ((Dimethylamino-methylidene)amino)-3H-l,2,4-dithiazoline-3-thione (655 mg) was added and the mixture was stirred at room temperature for 40 min. The mixture was concentrated under reduced pressure. Chromatography on silica column using MeOH / DCM (0 / 100 to 40 / 60) afforded the title compound (1.78 g) as a mixture of 2 optical isomers. MS: [M+H]+ 1112.4.
E) (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-punn-9-yl]-2-({[({(2R,3R,4R,5R)-2-(5-chloro-4- oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)-4-[(3-hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3-yl} oxy)(2- cyanoethoxy)phosphorothioyl]oxy}methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate.
[1653] In a round bottom flask (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9-yl]-2-
({[{[(6aR,8R,9R,9aR)-8-(5-chloro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)- 2,2,4,4-tetraisopropyltetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl]oxy}(2- cyanoethoxy)phosphorothioyl]oxy}methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate (1.73 g) was dissolved in tetrahydrofuran (16 mL) and water (4.0 mL). The solution was cooled with an ice bath. Triflouroacetic acid (4.0 mL) was dropwise added. The mixture was stirred with cooling for 4 hours. At 0°C sodium bicarbonate (7.00 g) was portion wise added, followed by water and EtOAc. The mixture was stirred for 3 min then brought to room temperature. The layers were separated. The aqueous layer was extracted with EtOAc (3 x). The combined EtOAc solution was washed with brine, dried over anhydrous Na2S04, filtered. The filtrate was concentrated under reduce pressure and dried on vacuum pump to give the crude product. The crude material was purified on a silica column using MeOH / DCM (0/100 to 40 / 60) to afford the title product (1.43 g) as a mixture of 2 optical isomers. MS: [M+H]+ 1130.3.
F) N-(9- { (5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)-7-(5 -chloro-4-oxo-3 ,4-dihydro-7H- pyrrolo [2,3 -d] pyrimidin-7-yl)- 10-(2-cyanoethoxy)- 15 -fluoro- 16- [(3 -hydroxy- 1,1,3,3- tetraisopropyldisiloxanyl)oxy]-2-oxido-2-sulfanyl-10-sulfidooctahydro-12H-5,8- methanofuro[3,2-l] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-14-yl} -9H-purin-6- yl)benzamide (mixture of two major optical isomers).
[1654] In a round bottom flask (2R,3R,4R,5R)-5-[6-(benzoylamino)-9H-purin-9-yl]-2-
( { [( { (2R,3R,4R, 5R)-2-(5 -chloro-4-oxo-3 ,4-dihydro-7H-pyrrolo[2, 3-d] pynmidin-7-yl)-5 - (hydroxymethyl)-4-[(3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy]tetrahydrofuran-3- yl}oxy)(2-cyanoethoxy)phosphorothioyl]oxy}methyl)-4-fluorotetrahydrofuran-3-yl hydrogen phosphonate (1.20 g) was azeotroped with dry pyridine (fresh bottle ) / acetonitrile (x 2) then dry acetonitrile. The resulting white solid was dried under vacuum. Under an atmosphere of argon anhydrous pyridine (20.0 mL) (fresh bottle) was added, followed by 2-chloro-5,5- dimethyl-l,3,2-dioxaphosphinane 2-oxide (0.700 g). The clear solution was allowed to stir at room temperature for 1 hour 10 min. Water (0.70 mL) was added, followed by 3H-1,2- benzodithiol-3-one 1,1-dioxide (0.300 g). The mixture was stirred at room temperature for 20 min. The mixture was concentrated under reduced pressure, azeotroped with toluene (x 2), dried on vacuum pump to give a crude residue. The crude residue was chromatographed on a silica column using MeOH / DCM (0/100 to 20 /80). The title products (590 mg) from the early fraction was afforded and identified as the mixture of major isomers of peaks 2 and 4 from LCMS; while the second crop of products (389 mg) from the late fraction was a mixture of all 4 isomers. MS: [M+H]+ 1144.2.
G) 7- { (5R,7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15 -fluoro- 16- [(3 - hydroxy- 1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy]-2, 10-dioxido-2, 10-disulfanyloctahydro-12H- 5,8-methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin-7-yl}-5-chloro- 3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one (single optical isomers 1 and 2 ) Under N2 atmosphere N-(9- {(5R,7R,8R,12aR,14R,15R,15aR,16R)-7-(5-chloro-4- oxo-3,4-dihydro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-10-(2-cyanoethoxy)-15-fluoro-16-[(3- hydroxy-1 , 1 ,3,3-tetraisopropyldisiloxanyl)oxy]-2-oxido-2-sulfanyl- 10-sulfidooctahydro- 12H-5, 8-methanofuro[3,2-l][ 1,3, 6,9,11,2,10]pentaoxadiphosphacyclotetradecin-14-yl}-9H- purin-6-yl)benzamide (0.584 g, mixture of 2 major isomers, early fraction of column chromatograph) was stirred in methylamine (33 mass%) in absolute ethanol (15.0 mL) at room temperature for 2 hours. The mixture was concentrated under reduced pressure and dried on vacuum pump to give crude solid. Two subsequent purifications on silica gel columns, using MeOH / EtOAc (0/100 to 40 / 60) afforded 2 single optical isomers of the title compounds: isomer 1 (early fraction / peak 1, 73 mg) and isomer 2 (late fraction / peak 2, 304 mg), and a mix fraction of peak 1 and 2(0.30 g). MS (optical isomer 1): [M+H]+ 987.2. MS (optical isomer 2): [M+H]+ 987.2. H) 7- [(5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-y 1)- 15-fluoro- 16- hydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-chloro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 1 ). To a polypropylene tube was added 7- {(5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(6- amino-9H-purin-9-yl)-15-fluoro-16-[(3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy]-2,10- dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2-
1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl} -5-chloro-3 ,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer 1, 69.2 mg, early fraction from column chromatography), pyridine (0.40 rriL), followed by triethylamine trihydrofluoride (0.060 mL), then triethylamine (0.90 rriL). The reaction mixture in the sealed propylene tube was stirred at 50°C overnight. The reaction mixture was cooled to room temperature, diluted with water (1.30 mL). A solution of calcium chloride (92.5 mg) in water (1.30 mL) was added. The cloudy white mixture was stirred at room temperature for 1 hour, and then filtered through Celite® using a plastic filter funnel, washed with water (1 mL x 4). The clear aqueous filtrate was concentrated under reduced pressure, azeotroped with toluene for multiple times, dried on vacuum for 10 min to give a crude residue. The crude residue was purified by CI 8 column chromatography (water-acetonitrile/10 mM triethylammonium acetate buffer solution). The product fraction was concentrated under reduced pressure, azeotroped with toluene (x 4), then with endotoxin-free water (x 5). The final residue was dissolved in endotoxin- free water and lyophilized to afford the title product (optical isomer 1, 29.0 mg). MS [M+H]+ 727.0. 1H NMR (400 MHz, deuterium oxide) δ = 8.19 (s, 1H), 8.16 (s, 1H), 7.96 (s, 1H), 7.63 (s, 1H), 6.39 (br d, J = 15.7 Hz, 1H), 6.34 (br d, J = 8.0 Hz, 1H), 5.60 - 5.41 (m, 1H), 5.22 - 5.14 (m, 1H), 5.14 - 5.02 (m, 1H), 4.55 (br d, J = 3.8 Hz, 1H), 4.51 (br d, J = 8.2 Hz, 1H), 4.42 (br s, 1H), 4.40 (br s, 1H), 4.35 - 4.28 (m, 1H), 4.16 - 4.10 (m, 1H), 4.06 (br dd, J = 4.3, 11.5 Hz, 1H), 3.13 (q, J = 7.3 Hz, 12H), 1.21 (t, J = 7.3 Hz, 18H). 31P NMR (162 MHz, deuterium oxide) δ 55.29, 54.54. 19F NMR (376 MHz, deuterium oxide) δ -200.90. I) 7-[(5R,7R,8R,l 2aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-y 1)- 15-fluoro- 16- hydroxy-2,10-dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl]-5-chloro-3,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one di-triethylamine salt ( optical isomer 2 ).
[1657] To a polypropylene tube was added 7- {(5R,7R,8R,12aR,14R,15R,15aR,16R)-14-(6- amino-9H-purin-9-yl)-15-fluoro-16-[(3-hydroxy-l,l,3,3-tetraisopropyldisiloxanyl)oxy]-2,10- dioxido-2,10-disulfanyloctahydro-12H-5,8-methanofuro[3,2-
1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7-yl} -5-chloro-3 ,7-dihydro-4H- pyrrolo[2,3-d]pyrimidin-4-one (optical isomer 2, 186 mg, late fraction from chromatograph). Pyridine (1.1 mL) was added, followed by triethylamine trihydrofluoride (0.161 mL), then triethylamine (2.4 mL). The reaction mixture in the sealed propylene tube was stirred at 50°C overnight. The reaction mixture was cooled to room temperature, diluted with water (3.50 mL). A solution of calcium chloride (250 mg) in water (3.50 mL) was added. The cloudy white mixture was stirred at room temperature for 1 hour. The mixture was filtered through Celite® using a plastic filter funnel, washed with water (3 mL x 4). The clear aqueous filtrate was concentrated under reduced pressure, azeotroped with toluene multiple times, dried on vacuum for 10 min to give a crude residue. The crude residue was purified by CI 8 column chromatography (water-acetonitrile/10 mM triethylammonium acetate buffer solution). The product fraction was concentrated under reduced pressure, azeotroped with toluene (x 4), then with endotoxin-free water (x 5). The final residue was dissolved in endotoxin-free water and lyophilized to afford the title product (optical isomer 2, 109 mg). MS [M+H]+ 727.0.
[1658] 1H NMR (400 MHz, deuterium oxide) δ 8.10 (s, 1H), 7.89 (s, 1H), 7.86 (s, 1H), 7.55
(s, 1H), 6.30 (d, J = 15.9 Hz, 1H), 6.24 (d, J = 8.2 Hz, 1H), 5.49 - 5.27 (m, 1H), 5.07 - 4.86 (m, 2H), 4.85 (d, J = 3.9 Hz, 1H), 4.44 (br d, J = 9.0 Hz, 1H), 4.33 (br d, J = 14.7 Hz, 2H), 4.28 - 4.16 (m, 2H), 3.98 (br dd, J = 5.0, 11.8 Hz, 1H), 3.04 (q, J = 7.4 Hz, 12H), 1.12 (t, J = 7.3 Hz, 18H). 31P NMR (162 MHz, deuterium oxide) δ 55.12, 52.04. 19F NMR (376 MHz, deuterium oxide) δ -200.43. EXAMPLE 27
Linker-payload 1
Figure imgf000308_0001
[1659] To a mixture of 6-(2,5-dioxopyrrol-l-yl)-N-[(lS)-l-[[(l S)-2-[4-
(hydroxymethyl)anilino]-l-methyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]hexanamide (mc-Val-Ala-PAB-OH, Synchem, Elk Grove Village, IL, 0.0822 mmol, 40.0 mg) in anhydrous acetonitrile (19.1 mmol, 1.00 mL, 783 mg) was added cesium iodide (0.0986 mmol, 25.6 mg) and boron trifluoride diethyl etherate (0.0986 mmol, 0.0125 mL, 14.0 mg). The reaction was stirred at room temperature overnight. After 18h of stirring the mixture was diluted with -lOmL of DCM and filtered over a Celite® pad. The solid was washed with DCM. The filtrate was concentrated to provide an orange solid. The crude product (mc-Val- Ala-PAB-I) was used without further purification.
[1660] A vial charged with a solution of disodium (5R,7R,8R,12aR,14R,15R,15aR,16R)-14-
(6-amino-9H-purin-9-yl)-15-fluoro-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-16-hydroxy-2-sulfidooctahydro-12H-5,8-methanofuro[3,2- 1] [1 ,3,6,9, 1 l,2,10]pentaoxadiphosphacyclotetradecin-10-olate 2,10-dioxide (Payload 1, also "compound Ex. 3a", 0.0106 mmol, 7.80 mg) and 6-(2,5-dioxopyrrol-l-yl)-N-[(l S)-l-[[(lS)- 2-[4-(iodomethyl)anilino]-l-methyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]hexanamide (mc-Val-Ala-PAB-I, 0.0208 mmol, 12.4 mg, crude) in N,N-dimethylformamide (5.17 mmol, 0.400 mL, 378 mg) was sealed and heated to 60 °C. In 2h the reaction was cooled to room temperature and purified by chromatography on CI 8 column (continuous gradient from 20- 60% CH3CN/water with 0.1% formic acid) to provide N-[(2S)-l-{[(2S)-l-{[4- ( { [(5R,7R,8R, 12aR, 14R, 15R, 15aR, 16R)- 14-(6-amino-9H-punn-9-yl)- 15-fluoro-7-(5-fluoro- 4-0X0-3 ,4-dihydro-7H-pyrrolo[2, 3-d] pyrimidin-7-yl)- 10,16-dihydroxy-2, 10- dioxidooctahy dro- 12H- 5, 8-methanofuro [3 ,2- lJ [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-2-yl]sulfanyl} methyl)phenyl]amino} - 1 - oxopropan-2-yl]amino} -3-methyl-l -oxobutan-2-yl]-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l - yl)hexanamide (5.5mg, 45% yield) as a white solid. 1H NMR (400 MHz, METHANOL-d4) δ 8.23-8.35 (m, 2H), 8.10 (s, 1H), 7.89-8.02 (m, 1H), 7.84 (s, 1H), 7.52-7.64 (m, 2H), 7.41 (br d, J=8.53 Hz, 2H), 7.22-7.38 (m, 2H), 6.75-6.83 (m, 2H), 6.32-6.43 (m, 2H), 5.71-5.90 (m, 2H), 4.54-4.59 (m, 2H), 4.42-4.51 (m, 2H), 4.07-4.35 (m, 8H), 3.46 (br t, J=7.03 Hz, 2H), 2.27 (br t, J=7.34 Hz, 2H), 2.03-2.15 (m, 2H), 1.53-1.70 (m, 4H), 1.39-1.47 (m, 3H), 1.23- 1.37 (m, 2H), 0.92-1.02 (m, 6H). LCMS: m/z 1163, 1164 [M+H].
EXAMPLE 28
Linker-payload 2
Figure imgf000309_0001
[1661] Linker-payload 2 was generated according to the procedure in Example 27, using 2- amino-9-[(5R,7R, 8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-yl)- 10, 18- dihydroxy-2,10-dioxido-2-sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8- methanofuro[3,2-l] [1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(12H)-yl]-l ,9- dihydro-6H-purin-6-one sesqui-triethylamine salt (Payload 2) in place of Payload 1.
[1662] Payload 2 was prepared according to the method below.
[1663] 2-amino-9-((5R,7R, 8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-purin-9-y 1)- 10,18- dihydroxy-2,10-oxido-2-sulfanylhexahydro-14H-15,12a-(epoxymethano)-5,8- methanofuro[3,2-l] [ 1 ,3 ,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7(l 2H)-yl)- 1,9- dihydro-6H-purin-6-one sesqui-triethylamine salt(optical isomer)
A) (lR,3R,4R,7S)-3-(6-benzamido-9H-purin-9-yl)-l-((((((2R,3R,4R,5R)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)- yl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)-2,5- dioxabicyclo[2.2.1]heptan-7-yl hydrogen phosphonate
[1664] (lS,3R,4R,7S)-3-(6-Benzamido-9H-punn-9-yl)-l-(hydroxymethyl)-2,5- dioxabicyclo[2.2.1]heptan-7-yl hydrogen phosphonate (700 mg) and 5'-0-[bis(4- methoxyphenyl)(phenyl)methyl]-3'-0-[tert-butyl(dimethyl)silyl]-2'-0-{(2- cyanoethoxy)[diisopropylamino]phosphanyl} -N-(2-methylpropanoyl)guanosine (2280 mg) were subjected to azeotropic dehydration with anhydrous acetonitrile, and anhydrous acetonitrile (15 mL) and anhydrous tetrahydrofuran (5 mL) were added thereto. To the mixture was added a mixture of 5-(ethylsulfanyl)-2H-tetrazole (611 mg) (which was subjected to azeotropic dehydration with anhydrous acetonitrile) and anhydrous acetonitrile (10 mL), and the mixture was stirred overnight under argon atmosphere at room temperature. 70% tert-Butyl hydroperoxide (643 μL) was added thereto, and the mixture was stirred at room temperature for 20 min. To the reaction mixture was added a mixture of sodium thiosulfate (5920 mg) and water (3 mL), and the mixture was concentrated under reduced pressure. To the residue was added 80% acetic acid (30 mL), and the mixture was stirred at room temperature for 20 min. The reaction mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography (methanol/ethyl acetate) to give the title compound (980 mg). MS: [M+H]+ 1030.2
B) 2-amino-9-[(5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-purin-9-yl)- 18- { [tert- butyl(dimethyl)silyl] oxy } -2, 10-dihydroxy- 10-oxido-2-sulfidohexahydro- 14H- 15,12a- (epoxymethano)-5,8-methanofuro[3,2-l][l,3,6,9,l l,2,10]pentaoxadiphosphacyclotetradecin- 7(12H)-yl]-l,9-dihydro-6H-purin-6-one (optical isomer)
[1665] (lR,3R,4R,7S)-3-(6-Benzamido-9H-purin-9-yl)-l-((((((2R,3R,4R,5R)-4-((tert- butyldimethylsilyl)oxy)-5-(hydroxymethyl)-2-(2-isobutylamido-6-oxo-lH-purin-9(6H)- yl)tetrahydrofuran-3-yl)oxy)(2-cyanoethoxy)phosphoryl)oxy)methyl)-2,5- dioxabicyclo[2.2. l]heptan-7-yl hydrogen phosphonate (980 mg) was subjected to azeotropic dehydration with anhydrous acetonitrile and anhydrous pyridine, and anhydrous pyridine (50 mL) was added thereto. To the mixture was added 2-chloro-5,5-dimethyl- 1,3,2- dioxaphosphinane 2-oxide (615 mg) at room temperature, and the mixture was stirred under argon atmosphere at room temperature for 1 hr. Water (600 μL) and 3H- benzo[c][l,2]dithiol-3-one (240 mg) were added thereto, and the mixture was stirred at room temperature for additional 30 min. To the reaction mixture was added a mixture of sodium thiosulfate (1180 mg) and water (3 mL), and the mixture was concentrated under reduced pressure. To the residue were added anhydrous acetonitrile (15 mL) and 2-methylpropan-2- amine (5.0 mL), and the mixture was stirred at room temperature for 1.5 hr, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate), and to the obtained residue was added 40% methylamine ethanol solution (30 mL). The mixture was stirred overnight under argon atmosphere at room temperature, and the reaction mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography (methanol/ethyl acetate). The obtained residue was resolved into two diastereomers (tRl and tR2, retention times of which by LC/MS are from shorter to longer in this order) by HPLC (L-column2 ODS, 50x150 mm, mobile phase: 5 mM aqueous ammonium acetate solution/acetonitrile) to give the title compound (38 mg, tRl) and the title compound (322 mg, tR2). MS (tRl): [M+H]+ 817.1. MS (tR2): [M+H]+ 817.1
C) 2-amino-9-[(5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-punn-9-yl)-2, 10, 18- trihydroxy-10-oxido-2-sulfidohexahydro-14H-l 5, 12a-(epoxymethano)-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-7( 12H)-yl] - 1 ,9-dihydro-6H-purin-6-one sesqui-triethylamine salt (optical isomer)
To 2-amino-9-[(5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-purin-9-yl)- 18-
{ [tert-buty l(dimethyl)silyl] oxy } -2, 10-dihydroxy- 10-oxido-2-sulfidohexahy dro- 14H- 15,12a- (epoxymethano)-5, 8-methanofuro[3,2-l] [1,3, 6,9,11,2,10]pentaoxadiphosphacy clotetradecin- 7(12H)-yl]-l,9-dihydro-6H-purin-6-one (optical isomer) (38 mg, tRl) were added methanol (3.0 mL) and triethylamine trihydrofluoride (0.76 mL). The reaction mixture was concentrated to remove the methanol, and the residue was stirred at 55°C for 1 hr. The mixture was cooled to room temperature, ethoxy(trimethyl)silane (4.2 mL) was added thereto, and the mixture was stirred at room temperature for 2 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution) to give the title compound (27 mg). 1H NMR (400 MHz, D20) δ 1.23 (13H, t, J = 7.3 Hz), 3.15 (9H, q, J = 7.3 Hz), 4.04 (1H, d, J = 8.3 Hz), 4.08-4.19 (3H, m), 4.28 (1H, d, J = 12.2 Hz), 4.37-4.52 (2H, m), 4.65 (1H, d, J = 4.2 Hz), 4.90 (1H, d, J = 4.6 Hz), 5.36 (1H, s), 5.55 (1H, td, J = 8.5, 4.0 Hz), 5.98 (1H, d, J = 8.3 Hz), 6.16 (1H, s), 7.94 (1H, s), 8.21 (1H, s), 8.25 (1H, s). 31P NMR (162 MHz, D20) δ-1.45, 53.78.
[1667] Synthesis of 2-amino-9-[(5R,7R,8R,12aR,14R,15R,15aS,18R)-14-(6-amino-9H- purin-9-yl)- 10,18-dihydroxy-2, 10-dioxido-2-sulfanylhexahydro- 14H- 15,12a- (epoxymethano)-5,8-methanofuro[3,2-l] [1,3, 6,9,11,2,1 O]pentaoxadiphosphacy clotetradecin- 7(12H)-yl]-l,9-dihydro-6H-purin-6-one sesqui-triethylamine salt( optical isomer; Payload 2)
[1668] To 2-amino-9-[(5R,7R,8R, 12aR, 14R, 15R, 15aS, 18R)- 14-(6-amino-9H-purin-9-yl)- 18-
{ [tert-buty l(dimethyl)silyl] oxy } -2, 10-dihydroxy- 10-oxido-2-sulfidohexahy dro- 14H- 15,12a- (epoxymethano)-5, 8-methanofuro[3,2-l] [1,3, 6,9,11,2,10]pentaoxadiphosphacy clotetradecin- 7(12H)-yl]-l,9-dihydro-6H-purin-6-one (optical isomer) (322 mg, tR2) were added methanol (3.0 mL) and triethylamine trihydrofluoride (3.2 mL). The reaction mixture was concentrated to remove the methanol, and the residue was stirred at 55°C for 1 hr. The mixture was cooled to room temperature, ethoxy(trimethyl)silane (14 mL) was added thereto, and the mixture was stirred at room temperature for 2 hr. The reaction mixture was concentrated under reduced pressure, and the residue was purified by CI 8 column chromatography (acetonitrile/10 mM triethylammonium acetate buffer solution) to give the title compound (266 mg). 1H NMR (400 MHz, D20) δ 1.23 (14H, t, J = 7.3 Hz), 3.15 (10H, q, J = 7.3 Hz), 4.02 (1H, d, J = 8.1 Hz), 4.13-4.24 (2H, m), 4.27-4.42 (4H, m), 4.59 (1H, d, J = 4.4 Hz), 5.01 (1H, s), 5.11 (1H, d, J = 4.2 Hz), 5.61-5.73 (1H, m), 5.95 (1H, d, J = 8.3 Hz), 6.15 (1H, s), 7.87 (1H, s), 8.00 (1H, s), 8.25 (1H, s). 31P NMR (162 MHz, D20) δ-1.93, 55.44.
EXAMPLE 29
General ADC Conjugation procedure
[1669] A solution of antibody was diluted to the desired reaction concentration with an appropriate buffer. The pH was adjusted to 7 by addition of 0.5 M tris, 25 mM EDTA solution in water (pH 8.0). TCEP (2.2 equiv, 5mM in water) was added with stirring. After 1 hour of incubation at room temperature, 5 equiv of linker-payload (5mM in DMA) was added. After 2 additional hours of gentle stirring at room temperature the mixture was purified twice over 3mL spinOUT desalting columns (G-Bioscience, pre-equilibrated with a buffer containing lOmM histidine, 7.5% sucrose (w/v) and 0.08% polysorbate 20 (w/v) at pH 5.2), and then buffer exchanged to Dulbecco's PBS and concentrated to l~3mg/mL (as determined by UV absorption using a standard IgGl extinction coefficient) using a Vivaspin6 column (GE Healthcare). Sample was then characterized for drug-antibody-ratio (DAR) by QTOF mass spectrometry. The monomer composition of the ADC was determined by size exclusion chromatography (SEC).
Size Exclusion Chromatography (SEC) Protocol Sample Preparation
[1670] Prepare a water blank by adding HPLC water to an HPLC vial. Naked antibody controls and ADC samples are obtained from the chemists. The controls and samples are diluted with 1XPBS if the concentration is above 5mg/mL, or injected neat if the concentration is 5mg/mL or below.
HPLC System Setup
[1671] An Agilent 1100 HPLC system is used for analysis. The system is set up with system wash (5% Acetonitrile in HPLC water) on one pump channel, and the mobile phase (as described above) on a different pump channel. The column used is Tosoh Biosep TSK Gel, G3000SWxl; P/N 8541; 250A; 5um; 7.8mm x 300mm. The flow rate is set to lmL/min, and each run is isocratic with 100% mobile phase [100 mM sodium phosphate, 300 mM sodium chloride, pH 6.8, 10% acetonitrile (v/v)] for 20 minutes. The DAD is set to 280nm. The injection volume for each control, sample, and blank is typically lOuL, but can be adjusted depending on UV absorbance. Data Analysis: All peaks at 280nm within appropriate time window (typically 2-10 minutes) are integrated.
EXAMPLE 30 Preparation of ADC1
[1672] The synthesis was performed according to the General ADC Conjugation Procedure. [1673] Antibody: Antibody 1, an anti-GCC antibody (5F9), 100 uL of a 60 mg/mL solution in a buffer of 50 mM histidine and 100 mM arginine at pH 6.0, receptor target guanylyl cyclase C (GCC)
Antibody 1 heavy chain:
[1674] QVQLQQWGAGLLKPSETLSLTCAVFGGSFSGYYWSWIRQPPGKGLEWIGEIN HRGNTNDNPSLKSRVTISVDTSKNQFALKLSSVTAADTAVYYCARERGYTYGNFDH WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL TSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK (SEQ. ID No. 1)
Antibody 1 light chain:
[1675] EIVMTQ SP ATLS VSPGERATLS CRAS Q S VSRNL AWYQQKPGQ APRLLI YGAS T
RATGIPARFSGSGSGTEFTLΉGSLQSEDFAVYYCQQYKTWPRTFGQGTNVEIKRTVA APSVFIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ. ID No. 2)
[1676] Buffer: 50 mM histidine and 100 mM arginine at pH 6.0, 200 uL, final concentration
20 mg/mL
[1677] Linker-pay load: N- [(2S)- 1 - { [(2S)- 1 - { [4-( { [(5R, 7R, 8R, 12aR, 14R, 15R, 15aR, 16R)-
14-(6-amino-9H-purin-9-yl)-15-fluoro-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-10,16-dihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-2-yl]sulfanyl} methyl)phenyl]amino} - 1 - oxopropan-2-yl]amino}-3-methyl-l-oxobutan-2-yl]-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)hexanamide (Linker-pay load 1)
[1678] Product ADC: ADCl, yield = 1.9 ml at 2.5 mg/mL (79%), DAR 3.5, 99% monomer
(i.e., not aggregated) EXAMPLE 31
Preparation of ADC2
[1679] The synthesis was performed according to the General ADC Conjugation Procedure.
[1680] Antibody: Antibody 2, a non-GCC targeting antibody directed to a membrane- anchored protein over expressed in certain solid tumors including lung and breast, 100 uL at 11.8 mg/mL in 25mM sodium acetate, pH 5.5.
[1681] Buffer: Dulbecco's PBS, pH 7.4, 200 uL, final concentration 4 mg/mL
[1682] Linker-payload: N-[(2S)-l-{[(2S)-l-{[4-({[(5R,7R,8R,l 2aR, 14R, 15R, 15aR, 16R)-
14-(6-amino-9H-purin-9-yl)-15-fluoro-7-(5-fluoro-4-oxo-3,4-dihydro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-10,16-dihydroxy-2,10-dioxidooctahydro-12H-5,8-methanofuro[3,2- 1] [ 1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-2-yl]sulfanyl} methyl)phenyl]amino} - 1 - oxopropan-2-yl]amino}-3-methyl-l-oxobutan-2-yl]-6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)hexanamide (Linker-payload 1)
[1683] Product ADC: ADC2, yield = 0.6 ml at 1.4 mg/mL (70%), DAR 2.6, 99% monomer
EXAMPLE 32 Preparation of ADC3
[1684] The synthesis was performed according to the General ADC Conjugation Procedure.
[1685] Antibody: Antibody 1, 33 uL at 60 mg/mL in a buffer of 50 mM histidine and 100 mM arginine at pH 6.0
[1686] Buffer: 50 mM histidine and 100 mM arginine at pH 6.0, 66 uL final concentration of antibody solution 20 mg/mL
[1687] Linker-payload: N-[(2S)-l- {[(2S)-l- {[4-({[(5R,7R,8R,12aR,14R,15R,15aS,18R)-7-
(2-amino-6-oxo- 1 ,6-dihydro-9H-purin-9-yl)- 14-(6-amino-9H-purin-9-yl)- 10, 18-dihydroxy-
2, 10-dioxidohexahydro-14H- 15,12a-(epoxymethano)-5,8-methanofuro[3,2-
1] [1 ,3,6,9, 11 ,2, 10]pentaoxadiphosphacyclotetradecin-2(l 2H)- yl]sulfanyl}methyl)phenyl]amino}-l-oxopropan-2-yl]amino}-3-methyl-l-oxobutan-2-yl]-6- (2,5-dioxo-2,5-dihydro-lH-pyrrol-l -yl)hexanamide (Linker-payload 2)
[1688] Product ADC: ADC3, yield = 1.9 ml at 1.0 mg/mL (95%),DAR 4.3, 98% monomer EXAMPLE 33
Tritosomal payload release assay - measurement of payload release from linker-payload systems or ADCs in an in vitro lysosome model
Materials:
[1689] Buffer: 47.9 mg/ml of Potassium Phosphate Monobasic (Sigma- Aldrich Product
Number P5379); 6.8 mg/ml of Sodium Phosphate Dibasic (Sigma- Aldrich Product Number S0876), 1.7 mg/ml of Ethylenediaminetetraacetic Acid (Sigma- Aldrich Product Number ED4SS) in purified water. pH was adjusted to 6.0 using IN HC1 or IN KOH.
[1690] Rat Liver Tritosomes purchased from XenoTech
[1691] Linker-payload (10 mM DMSO)
[1692] ADC (1-40 uM in the storage buffer used for production).
Procedure:
[1693] For evaluation of payload release from linker-payload compounds, a 120.95 uM
DMSO working solution was prepared from 10 mM stock solution of linker-payload compounds. Then, the 120.95 uM DMSO working solution was diluted to 1 uM in 225 uL tritosome buffer solution containing 22.4% rat liver tritosomes.
[1694] For evaluation of ADC molecules, 1.86 uL of ADC solution was diluted with 223.1 uL of mixture of rat liver tritosomes in tritosome buffer.
[1695] The solutions thus prepared were incubated for 24 hours at 37 °C. 40 uL aliquots were removed at 0.5, 1, 3, 5, and 24 hours and diluted with 160 uL of 0.1% formic acid in methanol solution in a 96-well plate, which was stored in -80 °C freezer until the completion of the experiment. After collecting the last time point, a fresh 200 uL of 0.1% formic acid in methanol solution and spiked with 150 nM carbutamide which is an internal standard solution was added into the samples. The samples were mixed well and centrifuged at 4000 g for 10 minute, and the 96-well plate was submitted for analysis of payload concentration by LC/MS/MS.
LC/MS/MS system:
[1696] 5 uL of samples were injection into the LC/MS/MS with a Waters Xselect CI 8 CSH
3.5u 2.1mmID x 30mm length column. Mobile phase aqueous solvent contained 0.1% formic acid in water, and mobile phase organic solvent contained 0.1% formic acid in 5% water and 95% acetonitrile. The samples were running in 3 minutes gradient at 1.5 mL/min flow rate. Initially, the instrument was running 100% aqueous mobile phase solvent for 0.5 minutes, and then it was increasing to 100% organic solvent in next 1.5 minutes. The system will hold at 100% organic solvent for another 0.5 minutes, and then it would change to 100% aqueous phase solvent in next 0.5 minutes.
Analysis:
[1697] To monitor and calculate the release of linker-payload and payload from ADC, a peak area or concentration versus time curve was plotted. The data would be analyzed by using Excel-Fit program to calculate linear range rate and tl/2 of formation payload from the tested molecules.
Tritosomal payload release data:
[1698] As shown in Fig. 1, Fig. 2, and Fig. 3, when subjected to the above protocol ADCl,
ADC2, and ADC3 release the expected payloads.
Phospho-IRF3 assay protocol
[1699] HEK293 cells engineered to express the tumor-associated cell surface targets for mAbs Antibody 1 (ADCl and ADC3) and Antibody 2 (ADC2), as well as target non- expressing HEK293 cells (HEK293-Vect), were seeded at 1.5 χ 10E5 cells/well (500 uL/well) in Poly-D-Lysine-coated 24-well plates (Corning) and were cultured overnight. After overnight serum deprivation, the cells were treated with various concentrations of ADCs for 6 hours and then lysed in RIPA buffer (ThermoFisher Scientific) with protease and phosphatase inhibitos (ThermoFisher Scientific). The cell lysates were subjected to Western blotting analysis for phospho-IRF3 (CST) and IRF3 (BD Biosciences). The level of phospho- IRF3 was normalized to its total IRF3.
Phospho-IRF3 assay results
[1700] As shown in Fig. 4, Fig. 5, and Fig. 6, HEK293 cells that express the surface receptor targets for ADCl, ADC2, and ADC3 exhibit the expected increase in the STING pathway marker phospho-IRF3 (pIRF3) when treated with the ADCl, ADC2, and ADC3, repectively. Conversely, the pIRF3 response is not upregulated upon ADC treatment in vector HEK293 cells that do not express the corresponding surface receptor targets.
EXAMPLE 34
Pharmacological profiles of selected cyclic dinucleotides
[1701] The pharmacological profiles of selected cyclic dinucleotides are shown in Table 6.
Figure imgf000318_0001
Protocol of THP-1 Dual Lucia Reporter Gene Assay
[1702] THPl-Dual™ cells (InvivoGen #thpd-nfis) were derived from the human THP-1 monocyte cell line by stable integration of the Lucia luciferase gene, a secreted luciferase reporter gene, under the control of an ISG54 (interferon- stimulated gene) minimal promoter in conjunction with five interferon (IFN)-stimulated response elements. On the day of experiment, the cells were plated to a black, 384- well plate (Corning 356697) at 7500 cells/25 μΕ per well density in growth media (RPMI 1640, 2 mM L-glutamine, 25 mM HEPES,10% heat-inactivated fetal bovine serum, 100 μg/mL Normocin™, 100 U/mL-100 μg/mL Pen-Strep, 10 μg/mL of blasticidin, and 100 μg/mL of Zeocin). The cell plates were dosed with 62.5 nL of the testing compounds, and then incubated at 37°C for 20 hours. At the end of the incubation, 15 μΕΛνβΙΙ of the QUANTI-Luc™ (InvivoGen # rep-qlcl) were added, and luminescence was measured immediately using the LeadSeeker.
Protocol of western blot analyses of downstream signaling pathway activation (TBKl and IRF3)
[1703] 1.5xl06 THP-l-Dual Cells (Invivogen catalog # thpd-nfis) were treated with DMSO or the indicated concentrations of Exl4 for 3 hours. After stimulation, cells were collected on ice, centrifuged at 800 RCF for 5 minutes, and washed once in ice-cold PBS.
[1704] Cell pellets were lysed in 1 % Triton X-100 whole cell lysis buffer (10% glycerol, 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 μΜ EDTA, and 1 μΜ DTT) containing protease and phosphatase inhibitor cocktails (Sigma # P8340 and CalBiochem # 524629, respectively). Cell lysates were cleared of insoluble debris by centrifuging at 16,000 RCF for 10 minutes. The protein concentrations of the lysates were determined by Bradford assay using BSA standards.
[1705] Lysates were denatured in NuPAGE™ LDS Sample Buffer (4X, catalog # NP0008) containing DTT as a reducing agent. Denatured lysates were resolved on NuPAGE™ 4-12% Bis-Tris gels in MES/SDS running buffer and transferred to PVDF membranes using a semi- dry blotting method. Membranes were probed overnight at 4°C for phospho-TBKl SI 72, phospho-IRF3 S396, and GAPDH using antibodies from Cell Signaling Technology (# 5483, # 4947, and # 5174, respectively).
[1706] After an overnight primary probe, membranes were washed extensively, thenprobed with secondary antibody (Alexa Fluor® 680 goat anti-rabbit IgG, Life Technologies # A21109) in Odyssey® Blocking Buffer (catalog # 927-400000) at room temperature. After extensive washing, membranes were developed using a LI-COR ODYSSEY CLx.
[1707] The relative intensities of the phospho-TBKl and phospho-IRF3 bands were quantified and normalized to the levels of GAPDH. GAPDH-normalized phospho-TBKl and phospho-IRF3 values were graphed as fold intensity over the non- stimulated (DMSO) control. See Fig. 7.
Protocol of human plasma stability assay
[1708] The compound was incubated in heparinized human plasma at 37°C for 0, 1, 2, 4, 8 and 24 hours, and the change in compound concentration was measured by LC/MS/MS method. The elimination rate constant (=k(/h)) was calculated based on the fitted curve assuming the exponential decrease of concentration as follows; concentration at time x = initial concentration* exp(-k*x).
Syngeneic tumor model testing
[1709] Exl4 and Ex3a were tested in syngeneic tumor models in mice. When Exl4 and Ex3a were administered intravenously (every 3 days, 3 times), anti-tumor effects were observed. See Fig. 8 and Fig. 9 for the anti-tumor effect colon carcinoma CT-26 syngeneic mice model, and Fig. 10 and Fig. 11 for the anti -tumor effect in the colon carcinoma B16F10 syngeneic mice model.
The protocol for the anti-tumor effect evaluation
[1710] 8x104 B16F10 and 2x105 CT-26 mouse tumor cells were subcutaneously implanted in the flank of female C57BL/6 (B16F10) and Balb/C (CT-26) mice (n=7 per group). Vehicle (lxPBS), compound Ex3a (30 mg/kg) or Exl4 (1.0 mg/kg) were intravenously administered (final volume of 100 μΕ) to tumor-bearing mice once the tumor volume has reached 100 mm (Day 0). Vehicle, Ex3a or Exl4 were given every 3 days for a total of 3 doses (q3dx3). Tumor and body weight measurements were taken three times per week using vernier calipers and mettler scale, respectively. Tumor volumes were determined by multiplying the square of the width ('W'), measured along the short axis of the tumor, by one-half the length ('L') measured along the short axis of the tumor (V = W x 0.5L)
[1711] The compounds of the Examples are shown in the following tables. MS in the tables means actual measured value. The compound example 9 was synthesized in the same manner as in the method of Example 5.
Table 1-1
Figure imgf000321_0001
Table 1-2
Figure imgf000322_0001
Table 1-3
Figure imgf000323_0001
Table 1-4
Figure imgf000324_0001
Table 1-5
Figure imgf000325_0001
Figure imgf000326_0001
EXAMPLE 35
8ΉΝΟ-ί>ιηάιη8 test
[1712] Test compound (2 μΕ), Streptavidin-Terbium (4 μΕ, Cisbio), Fluorescein-labeled
2',3'-cGAMP (c[G(2',5')p-2'-Fluo-AHC-A(3',5')p]) (Biolog, Germany) and biotinylated 8ΉΝϋ protein (2 μΕ, wild-type, WT) were mixed using assay buffer (Dulbecco's Phosphate- Buffered Saline (Wako Pure Chemical Industries, Ltd.) containing 0.01% bovine serum albumin free of fatty acid (Wako Pure Chemical Industries, Ltd.)), and the mixture was left to stand at room temperature for 3 hr (The final concentration: Streptavidin-Terbium; diluted by 1/1000, FITC-cGAMP; 1 μΜ, biotinylated STING protein; 100 nM). The time-resolved fluorescence resonance energy transfer (TR-FRET) was measured at the wavelength of 520 nm and 486 nm by En Vision (PerkinElmer, Waltham, MA, US). The inhibition rate of the binding of wild- type STING protein and 2',3'-cGAMP of the test compound was calculated using the ratio of the count at 520 nm divided by the count at 486 nm. The results are shown in Tables 2 and 2A.
[1713] The above-mentioned biotinylated STING protein (wild-type (WT)) was prepared by the following method. Preparation method of biotinylated wild-type STING protein
[1714] ECOS (trade name) Competent E.coli BL21(DE3) was purchased from Nippon Gene
Co., Ltd. Ampicillin, kanamycin, NaCl, glycerol, isopropylthiogalactoside, (+)-biotin, imidazole, SEM nuclease recombinant and BCA protein assay kit were purchased from Wako Pure Chemical Industries, Ltd. Tryptone, Bacto, and Yeast Extract, Bacto were purchased from Difco Laboratories, tris buffered saline (TBS) tablets, pH7.6 was purchased from Takara Bio Inc., Lysozyme (Egg White), 6x Cryst was purchased from Seikagaku Corporation, and cOmplet (trade name) and EDTA-free protease inhibitor cocktail were purchased from Roche. Ni-NTA Superflow Cartridge manufactured by QIAGEN was used, and HiLoad 26/60 Superdex 200 pg manufactured by GE Healthcare was used.
[1715] Into pRSFlb (Novagen) having altered multiple cloning site was inserted Escherichia coli BirA, and transfected to ECOS JM109, whereby pRH8/FLAG-BirA was constructed. pET21HH/His-Avi-SUMO-FLAG-hTMEM173(139-379)(H232R) (which was constructed by the method mentioned in the EXAMPLE 36) and pRH8/FLAG-BirA for Avi tag biotinylation were simultaneously transformed to ECO (trade name) Competent E.coli BL21(DE3) to prepare His-Avi-SUMO-FLAG-hSTING (139-379, H232R)-expressing cell line. The expressing cell line was added to LB medium (10 g/L Tryptone, 5 g/L Yeast Extract, 5 g/L NaCl) containing ampicillin (100 μg L) and kanamycin (50 μg/L), and the mixture was pre-cultured at 30°C, and expanded to TB medium (12 g/L Tryptone, 24 g/L Yeast Extract, 4 mL/L Glycerol, 2.3 g/L KH2PO4, 12.5 g/L K2HPO4) containing the same antibiotics, and the mixture was cultured at 37°C. When the turbidity of the culture solution reached 500 KU, the culture temperature was reduced to 16°C, 0.1 mM isopropylthiogalactoside and 50 uM (+)-biotin were added thereto, and the mixture was cultured for additional 16 hr.
[1716] The culture solution was centrifuged, the obtained fungus bodies were suspended in
Lysis Buffer (50 mM TrisHCl, 150 mM NaCl, 20 mM Imidazole, 1 mg/mL Lysozyme, 5 U/mL SEM Nuclease, recombinant, Complete ED TA- free, pH7.6), and the protein was extracted by ultrasonic fragmentation. The reagent was added thereto so that the salt concentration of the extract was adjusted to 300 mM NaCl, and the supernatant was collected by centrifugation. The obtained supernatant was passed through NiNTA superflow Cartridge equilibrated with Wash Buffer (50 mM TrisHCl, 300 mM NaCl, 20 mM Imidazole, pH7.6), and the Cartridge was washed with Wash Buffer, and eluted with Elution Buffer (50 mM TrisHCl, 300 mM NaCl, 250 mM Imidazole, pH7.6). The eluate was passed through HiLoad 26/60 Superdex 200 pg column equilibrated with Storage Buffer (50 mM TrisHCl, 150 mM NaCl, pH7.6), and the eluted fraction was collected as biotinylated His-Avi-SUMO-FLAG- hSTING (139-379, H232R). The protein concentration was measured using BCA protein assay kit, and the fraction was cryopreserved at -80°C until used.
Table 2: STING-binding test
Figure imgf000328_0001
Table 2A: STING-binding test
Example No. IC50 (μΜ)
23 (optical isomer 1) 0.17
23 (optical isomer 2) 20
24 (optical isomer 1) 0.029
24 (optical isomer 2) 0.29
25 0.083 26 (optical isomer 1) 0.53
26 (optical isomer 2) 0.075
[1717] As is clear from the above-mentioned results, the compound of the present disclosure inhibits the binding of wild-type STING protein and the natural ligand 2',3'-cGAMP, that is, the compound of the present disclosure binds to wild-type STING protein.
EXAMPLE 36
Reporter gene assay
Preparation of various plasmids
(i) Expression plasmid construction of human TMEMl 73 and the like
[1718] Expression plasmid of human STING (in the present specification, sometimes to be referred to as human TMEMl 73) in E. coli was obtained by overlap extension PCR for introduction of mutation using human TMEMl 73 cDNA Clone (GeneCopoeia) as a template. First, PCRs were performed using two kinds of Primer (5'- CCTGGCCCCAGCTGAGATCTCTG-3' (C-hTMEM(139aa)-F) (SEQ. ID No. 3) and 5'- GTAAACCCGATCCTTGATGCCAGCACGGTCACCGGTC-3' (hTMEMl 73(H232R)-R)) (SEQ. ID No. 4) and two kinds of Primer (5'- CTGCCCCAGCAGACCGGTGACCGTGCTGGCATCAAG-3' (hTMEMl 73(H232R)-F) (SEQ. ID No. 5) and 5'-ATAATAGCGGCCGCTCAAGAGAAATCCGTGCGGAGAGG-3' (hTMEMl 73 -st-Not-R) (SEQ. ID No. 6). The PCR was each performed using PnmeStar MAX DNA Polymerase (Takara Bio Inc.) successively (1) at 98°C for 1 min, (2) 25-times repetitions of at 98°C for 10 sec and at 72°C for 10 sec, and (3) at 72°C for 1 mm. Then, the PCR was performed using the obtained segment as a template, and using two kinds of Primer (C- hTMEM( 139aa)-F and hTMEMl 73-st-Not-R). The PCR was performed using PrimeStar GXL DNA Polymerase (Takara Bio Inc.) successively (1) at 98°C for 1 min, (2) 35-times repetitions of at 98°C for 10 sec and at 72°C for 1.5 min, and (3) at 72°C for 1 min. The obtained segment was cut with Not I (Takara Bio Inc.), inserted into the Stu I/Not I site of vector wherein His-Avi-SUMO Tag was attached to pET21a (Novagen), using Ligation High (Toyobo Co., Ltd), and transfected to ECOS JM109 (Nippon Gene Co., Ltd.), whereby pET21HH/His-Avi-SUMO-hTMEM173(139-379)(H232R) was constructed.
[1719] Second, the PCR was performed using this plasmid as a template, and using two kinds of Primer (5'-
CGACTACAAGGACGACGATGACAAGGGATCCCTGGCCCCAGCTGAGATCTCTG- 3' (C-FLAG-Bam-hTMEMl 73(139aa)-F) (SEQ. ID No. 7) and hTMEMl 73-st-Not-R). The PCR was performed using PrimeStar MAX DNA Polymerase successively (1) at 98°C for 1 min, (2) 25-times repetitions of at 98°C for 10 sec and at 72°C for 10 sec, and (3) at 72°C for 1 min. The obtained segment was cut with Not I, inserted into the Stu I/Not I site of pET21a to which His-Avi-SUMO Tag was attached, using Ligation High, as mentioned above, and transfected to ECOS JM109, whereby pET21HH/His-Avi-SUMO-FLAG-hTMEMl 73(139- 379)(H232R) was constructed.
[1720] Expression plasmid for Reporter Assay was obtained by overlap extension PCR for introduction of mutation using human TMEM173 cDNA Clone as a template, as mentioned above. First, PCRs were performed using two kinds of Primer (5'- GTACCCATACGATGTTCCAGATTACGCTGGATCCGCCACCATGCCCCACTCCAGC CTGCATC-3' (HA-Bam-ko-hTMEMl 73 -F) (SEQ. ID No. 8) and hTMEMl 73(H232R)-R) and two kinds of Primer (hTMEMl 73(H232R)-F and hTMEMl 73-st-Not-R). The PCR was each performed using PrimeStar MAX DNA Polymerase successively (1) at 98°C for 1 min, (2) 25-times repetitions of at 98°C for 10 sec and at 72°C for 10 sec, and (3) at 72°C for 1 min. Then, the PCR was performed using the obtained segment as a template, and using two kinds of Primer (5'-
ATAATATCTAGAATTCGCCACCATGTACCCATACGATGTTCCAGATTACGC-3' (Xba-Eco-ko-HA-F) (SEQ. ID No. 9) and hTMEMl 73-st-Not-R). The PCR was performed using PrimeStar GXL DNA Polymerase successively (1) at 98°C for 1 min, (2) 35-times repetitions of at 98°C for 10 sec, at 65°C for 5 sec and at 72°C for 1.5 min, and (3) at 72°C for 1 min. The obtained segment was cut with Xba I (Takara Bio Inc.) and Not I, inserted into the Nhe I/Not I site of Zeocin-resistance vector wherein multiple cloning site was inserted into pcDNA3.3 (Invitrogen), using Ligation High, and transfected to ECOS JM109, whereby pcDNA3.3zeo/HA-hTMEM173(H232R) was constructed. [1721] Plasmid expressing human mutated-type TMEM173 (R232H) was constructed by
PCR using human TMEM173 cDNA Clone (GeneCopoeia) as a template, and using two kinds of Primer (5'-
TTCC AGATTACGCTGGATCCGCC ACC ATGCCCCACTCC AGCCTGCATC-3 ' (Bam- ko-hTEME173vl-F) (SEQ. ID No. 10) and 5'-
CCTCTAGACTCGAGCGGCCGCTCAAGAGAAATCCGTGCGGAGAGG-3'
(hTMEM173-st-Not-R2) (SEQ. ID No. 11). The PCR was performed using PrimeStar MAX DNA Polymerase (Takara Bio Inc.) successively (1) at 98°C for 1 min, (2) 30-times repetitions of at 98°C for 10 sec and at 68°C for 10 sec, and (3) at 72°C for 1 mm. The obtained segment was inserted into the Bam Hi/Not I site of vector wherein HA- Tag was attached to pcDNA3.1(+) (ThermoFischer), using Gibson Assembly (NEB), and transfected to ECOS JM109 (Nippon Gene Co., Ltd.), whereby pcDNA3.1HA/HA-hTMEM173vl was constructed.
[1722] Plasmid expressing human wild-type TMEM173 (H232R) was constructed by PCR using pcDNA3.3zeo/HA-hTMEM173(H232R) plasmid as a template, and using two kinds of Primer (5'-GGAGACCCAAGCTGGCTAGCGCCACCATGTACCCATACGATG-3' (Nhe- ko-HA-F) (SEQ. ID No. 12) and 5'-
CCTCTAGACTCGAGCGGCCGCTCAAGAGAAATCCGTGCGGAGAGG-3'
(hTMEM173-st-Not-R2) (SEQ. ID No. 11). The PCR was performed using PrimeStar MAX DNA Polymerase successively (1) at 98°C for 1 min, (2) 30-times repetitions of at 98°C for 10 sec and at 72°C for 35 sec, and (3) at 72°C for 1 min. The obtained segment was inserted into the Nhe I/Not I site of pcDNA3.1zeo (ThermoFischer) using Gibson Assembly, and transfected to ECOS JM109, whereby pcDNA3.1zeo/HA-hTMEM173(H232R) was constructed.
(ii) Firefly luciferase expression plasmid construction
[1723] Firefly luciferase expression plasmid was constructed by inserting CMV Promoter into Reporter vector. The PCR was performed using pcDNA3.1(+) vector (Invitrogen) as a template, and using two kinds of Primer (5'-
ATAAT AAGATCTGTTGAC ATTGATT ATTGACT AGTT ATTAAT AG- 3 ' (CMVPro- Bglll-F) (SEQ. ID No. 13) and 5'- ATAATAAAGCTTGAGCTCTGCTTATATAGACCTCCC-3' (CMVPro-Hindlll-R) (SEQ. ID No. 14). The PCR was performed using PrimeStar MAX DNA Polymerase successively (1) at 98°C for 1 min, (2) 25-times repetitions of at 98°C for 10 sec and at 68°C for 3 sec, and (3) at 72°C for 1 min. The obtained segment was cut with Bgl II and Hind III (Takara Bio Inc.), inserted into the Bgl II/Hind III site of pGL4.17 (Promega Corporation) using Ligation High (Toyobo Co., Ltd), and transfected to ECOS JM109, whereby pGL4.17/CMV Pro was constructed.
Reporter gene assay (1)
[1724] A stable expressing 293 T cell line transfected with pNL[NLucP/ISRE/Hygro]vector
(Promega, Fitchburg, WI, US) was constructed. pcDNA3.3zeo/HA-hTMEM173(H232R) was transfected to the cells using FugeneHD (Promega, Fitchburg, WI, US), and the cells were cultured for one day using Dulbecco's Modified Eagle's Medium (DMEM) (Wako Pure Chemical Industries, Ltd.) containing 10% fetal bovine serum. The cells were collected, and cryopreserved by CELLB ANKER 1 (Nippon Zenyaku Kogyo Co., Ltd.).
[1725] On the day of the assay, the test compound diluted with assay buffer (DMEM containing 0.1% bovine serum albumin free of fatty acid) was added to a white 384- well plate (Corning, NY, US) by 10 μΕΛνβΙΙ. The cryopreserved cells were thawed, and the cells suspended in assay buffer were seeded thereto by 10 μΕΛνβΙΙ (10000 cells/well). The cells were cultured at 37°C under 5% C02 condition for 20 hr, and NanoGlo reagent (Promega, Fitchburg, WI, US) solution (20 μΕ) was added thereto. After incubated for 5 min, the luminescence level was measured using En Vision (PerkinElmer, Waltham, MA, US). The activity level of each test compound was calculated when the count in the cells treated with 2',3'-cGAMP (30 μΜ) was considered as 100%, and the count in the cells treated with the solvent was considered as 0%. The results are shown in Table 3.
Table 3: STING agonistic activity test
activity level of
Example No.
test compound (30 μΜ)
1 77%
2 77%
3 76% 3a 107%
5 100%
14 71%
15 81%
16 123%
17 99%
18 81%
20 125%
[1726] As is clear from the above-mentioned results, the compound of the present disclosure has an agonist activity against wild-type STING.
Reporter gene assay (2)
[1727] A stable expressing 293 T cell line transfected with pNL[NLucP/ISRE7Hygro]vector
(Promega, Fitchburg, WI, US) was constructed. A suspension, which was prepared by transfecting pcDNA3.1zeo/HA-hTMEM173(H232R) or pcDNA3.1HA/HA-hTMEM173vl together with firefly luciferase expression plasmid to the cells using FugeneHD (Promega, Fitchburg, WI, US), was added to a 384- well plate (Corning, NY, US), and the cells were cultured for two days. The culture solution was removed, and the test compound diluted with assay buffer (50 mM HEPES pH 7.0, 100 mM KC1, 3 mM MgCl2, 85 mM Sucrose, 0.1 mM DTT, 0.2% BSA, 1 mM ATP, 0.1 mM GTP, 10 μg/ml Digitonm) was added thereto by 15 μΕΛνβΙΙ. The cells were cultured at 37°C under 5% C02 condition for 30 min, and the assay buffer was removed. Dulbecco's Modified Eagle's Medium (DMEM) (Wako Pure Chemical Industries, Ltd.) containing 10% fetal bovine serum was added thereto by 20 μΕΛνβΙΙ, and the cells were cultured at 37°C under 5% C02 condition for 4 hr. Luminescence signals derived from firefly luciferase and NanoLuc Luciferase were each measured using En Vision (PerkinElmer, Waltham, MA, US) according to Nano-Glo Dual-Luciferase Reporter Assay System (Promega, Fitchburg, WI, US) protocol. The ratio of the count of NanoLuc Luciferase divided by the count of firefly luciferase was used for culculation. The activity level of each test compound was calculated when the ratio in the cells treated with 2',3'- cGAMP (30 μΜ) was considered as 100%, and the ratio in the cells treated with the solvent was considered as 0%. The results are shown in Table 4. Table 4: STING agonistic activity test
Figure imgf000334_0001
[1728] As is clear from the above-mentioned results, the compound of the present disclosure has an agonist activity against wild-type STING and mutated-type STING (R232H).
EXAMPLE 37
Phosphorylated IRF3 protein detection in FaDu cell
[1729] Human larynx cancer cell line FaDu cell (ATCC) was seeded, the medium was replaced with serum free medium one day after the seeding. After the replacement, the cell was cultured for one day, and to the cell were added the natural ligand 2',3'-cGAMP (the final concentration; 30 μΜ) and test compound (the final concentration; 15 μΜ or 30 μΜ). 6 hr after the addition, the cell was washed with PBS, the cell extract was prepared, and the phosphorylated IRF3 protein was detected by ELISA method or Western blotting method. The IRF3 protein phosphorylation activity of the test compound was calculated when the value in the sample with adding the natural ligand 2',3'-cGAMP at the final concentration of 30 μΜ was considered as 100%. The results are shown in Table 5. Table 5: IRF3 protein phosphorylation test
Figure imgf000335_0001
[1730] As is clear from the above-mentioned results, the compound of the present disclosure promotes the phosphorylation of IRF3, which is the downstream signal of STING, as in natural ligand 2',3'-cGAMP. That is to say, the compound of the present disclosure activates the downstream signal of STING, as a STING agonist.
EXAMPLE 38
Formulation Example
[1731] A medicament containing the compound of the present disclosure as an active ingredient can be produced, for example, based on the following composition.
1. capsule
(1) the compound obtained in Example 1 10 mg
(2) lactose 90 mg
(3) crystalline cellulose 70 mg
(4) magnesium stearate 10 mg
1 capsule 180 mg
[1732] (1), (2), (3) and 5 mg of (4) are blended and granulated. Thereto is added the remaining 5 mg of (4), and the total amount is filled in a gelatin capsule.
2. tablet
(1) the compound obtained in Example 1 10 mg
(2) lactose 35 mg
(3) cornstarch 150 mg
(4) crystalline cellulose 30 mg
(5) magnesium stearate 5 mg
1 tablet 230 mg [1733] (1), (2), (3), 20 mg of (4) and 2.5 mg of (5) are blended and granulated. Thereto is added the remaining 10 mg of (4) and the remaining 2.5 mg of (5), and the mixture is compression formed to give a tablet.
Industrial Applicability
[1734] The compound of the present disclosure may have a STING agonistic activity.
Therefore, the compound of the present disclosure may be used as a STING agonist, and may be useful as an agent for the prophylaxis or treatment of STING-related diseases including cancer and the like.
[1735] It is to be understood that the foregoing described embodiments and exemplifications are not intended to be limiting in any respect to the scope of the disclosure, and that the claims presented herein are intended to encompass all embodiments and exemplifications whether or not explicitly presented herein
[1736] All patents, patent applications, and publications cited herein are fully incorporated by reference in their entirety.

Claims

WHAT IS CLAIMED IS:
1. A compound having Formula I):
Figure imgf000337_0001
or a pharmaceutically acceptable salt thereof, wherein:
the partial structure represented by formula (A-l):
Figure imgf000337_0002
is a partial structure represented by formula (IIA), or formula (IIB):
Figure imgf000337_0003
R1 and R2 are each independently a hydroxy group or a halogen atom;
B1 is a group represented by formula (B1-A) or formula (B1-B):
Figure imgf000337_0004
R13, R14, R15, R16 and R17 are each independently a hydrogen atom or a substituent; Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
Rla is a hydrogen atom or a substituent;
B2 is a group represented by formula (B2-A) or formula (B2-B):
Figure imgf000338_0001
R , R , R , R* and R are each independently a hydrogen atom or a substituent;
Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
R2a is a hydrogen atom or a substituent;
X1 and X2 are each independently an oxygen atom or a sulfur atom; and
Q\ Λ Q3 and Q4 are each independently an oxygen atom or a sulfur atom,
provided that:
1 2
at least one of B or B is:
Figure imgf000338_0002
wherein:
R18 is hydrogen or C1-6 alkyl; and
R19 a halogen atom.
2. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R19 is fluoro or chloro.
3. The compound of claims 1 or 2, or a pharmaceutically acceptable salt thereof, having formula (X):
Figure imgf000339_0001
4. The compound of claims 1 or 2, or a pharmaceutically acceptable salt thereof, having formula (XI).
Figure imgf000339_0002
5. The compound of any one of claims 1-4, or a pharmaceutically acceptable salt thereof, wherein R1 is a hydroxy group.
6. The compound of any one of claims 1-4, or a pharmaceutically acceptable salt thereof, wherein R1 is fluoro atom.
7. The compound of any one of claims 1-3, 5, or 6, or a pharmaceutically acceptable salt thereof, wherein R2 is a hydroxyl group.
8. The compound of any one of claims 1-3, 5, or 6, or a pharmaceutically acceptable salt thereof, wherein R is a fluoro atom.
9. The compound of any one of claims 1-8, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
10. The compound of any one of claims 1-9, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
11. The compound of any one of claims 1-9, or a pharmaceutically acceptable salt thereof, wherein Q2 is a sulfur atom.
12. The compound of any one of claims 1-3 or 5-11, or a pharmaceutically acceptable salt thereof, having the formula (XII):
Figure imgf000340_0001
13. The compound of any one of claims 1, 2, 4-6, or 9-11, or a pharmaceutically acceptable salt thereof, having the formula XIII):
Figure imgf000340_0002
14. The compound of any one of claims 1-13, or a pharmaceutically acceptable salt thereof, wherein B1 is:
Figure imgf000340_0003
15. The compound of any one of claims 1-13, or a pharmaceutically acceptable salt thereof, wherein B2 is:
Figure imgf000341_0001
16. The compound of any one of claims 2-15, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom.
17. The compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, wherein R 18 is hydrogen.
18. The compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, wherein R18 is methyl.
19. The compound of any one of claims 14 or 16-18, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000341_0002
Figure imgf000342_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
20. The compound of claim 19, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000342_0002
Figure imgf000343_0001
Figure imgf000344_0001
21. The compound of claim 20, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000344_0002
2
22. The compound of claim 21 , or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000344_0003
and
23. The compound of any one of claims 15-18, or a pharmaceutically acceptable salt thereof, wherein B1 is selected from the group consisting of:
Figure imgf000345_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
Figure imgf000346_0001
Figure imgf000347_0001
25. The compound of claim 24, or a pharmaceutically acceptable salt thereof, wherein B1 ted from the group consisting of:
Figure imgf000347_0002
Figure imgf000348_0001
26. The compound of claim 25, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000348_0002
27. The compound of claim 1, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
Figure imgf000348_0003
Figure imgf000349_0001
Figure imgf000350_0001
Figure imgf000351_0001
Figure imgf000352_0001
28. The compound of claim 27, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
Figure imgf000353_0001
Figure imgf000354_0001
Figure imgf000355_0001
Figure imgf000356_0001
29. The compound of claim 27, or a pharmaceutically acceptable salt thereof, selected from the group consisting of:
Figure imgf000356_0002
30. The compound of any one of claims 1-29, wherein the pharmaceutically acceptable salt is the triethylamine salt or the sodium salt.
31. A pharmaceutical composition comprising the compound of any one of claims 1-30, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
32. A compound having Formula (XIV):
(CD-L)n-A (XIV)
or a pharmaceutically acceptable salt thereof, wherein:
CD is a group represented by any one of Formula (XX) - (XXIX)
Figure imgf000357_0001
XXIII XXIV XXV
Figure imgf000357_0002
XXVI XXVII XXVII I or
Figure imgf000358_0001
XXIX
R1 and R2 are each independently a hydroxy group, hydrogen, amino group, or a halogen atom; B3 and B4 are independently an optionally substituted 5- to 14-membered aromatic heterocyclic group;
X1 and X2 are each independently an oxygen atom, CH2, or a sulfur atom;
Q 1 , Q2 , Q 3 , and Q 4 are each independently an oxygen atom or a sulfur atom;
L is a linker;
A is an antibody, antibody fragment, or antigen-binding fragment; and
n is 1-10.
33. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein R1 and R2 are each independently a hydroxy group or a halogen atom.
34. The compound of claims 32 or 33, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are each independently an oxygen atom or a sulfur atom.
35. The compound of any one of claims 32-34, or a pharmaceutically acceptable salt thereof, wherein Q1 and Q3 are an oxygen atom.
36. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX- A):
Figure imgf000359_0001
37. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXI- A):
Figure imgf000359_0002
38. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXII-A):
Figure imgf000359_0003
39. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIII-A):
Figure imgf000359_0004
40. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIV-A):
Figure imgf000360_0001
41. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXV- A):
Figure imgf000360_0002
42. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVI-A :
Figure imgf000360_0003
43. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVII-A):
Figure imgf000360_0004
XXVII-A
44. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVIII-A):
Figure imgf000361_0001
XXVIII-A
45. The compound of claim 32, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIX-A :
Figure imgf000361_0002
46. The compound of any one of claims 32-45, or a pharmaceutically acceptable salt thereof, wherein:
-X3-T-Z-Q-
Figure imgf000361_0003
o is 1, 2, or 3; or
X3 is absent;
T is a peptide, or is absent;
Z is a spacer;
Q is a heterobifunctional group or heterotrifunctional group.
47. The compound of claim 46, or a pharmaceutically acceptable salt thereof, having the formula (XXX):
Figure imgf000362_0001
48. The compound of claim 46, or a pharmaceutically acceptable salt thereof, having the formula (XXXI):
Figure imgf000362_0002
49. The compound of any one of claims 46-48, or a pharmaceutically acceptable salt thereof, wherein:
Figure imgf000362_0003
Figure imgf000362_0004
R and R are independently selected from the group consisting of hydrogen and optionally substituted C1-6 alkyl.
50. The compound of claim 49, or a pharmaceutically acceptable salt thereof, wherein:
Figure imgf000363_0001
51. The compound of any one of claims 46-50, or a pharmaceutically acceptable salt thereof, wherein:
Figure imgf000363_0002
m is 1, 2, 3, 4, 5, or 6; and
s is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
52. The compound of any one of claims 46-48, or a pharmaceutically acceptable salt thereof, wherein:
X3 is -CH2-;
O
Z is P ; and
p is 1, 2, 3, 4, 5, 6, 7, 8, 9,
53. The compound of any one of claims 46-48, or a pharmaceutically acceptable salt thereof, wherein:
3 i -CH2CH2-;
Figure imgf000363_0003
q is 1, 2, 3, 4, 5, or 6; and
r is 1, 2, 3, 4, 5, or 6.
54. The compound of any one of claims 46-53, or a pharmaceutically acceptable salt thereof, wherein Q is a heterobifunctional group selected from the group consisting of:
Figure imgf000364_0001
R is hydrogen or C1-6 alkyl;
R30a and R30 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, Ci-6 alkoxy, -CN, -N02, and -OH;
R31a and R31 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, -N(CH3)2, Ci-6 alkoxy, -CN, -N02, and -OH; and
* indicates the attachment point to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the antibody.
55. The compound of claim 51, or a pharmaceutically acceptable salt thereof, having formula (XXXII):
Figure imgf000365_0001
(XXXII) wherein:
R10a and R10 are independently C1-3 alkyl; and
m is 2, 3, 4, or 5.
56. The compound of claim 52, or a pharmaceutically acceptable salt thereof, having formula (XXXIII):
Figure imgf000365_0002
(ΧΧΧΙΠ) wherein p is 4, 5, or 6.
57. The compound of claim 53, or a pharmaceutically acceptable salt thereof, having formula (XXXIV):
Figure imgf000366_0001
(XXXIV) wherein:
q is 1, 2, or 3; and
r is 1, 2, or 3.
58. The compound of any one of claims 32-57, or a pharmaceutically acceptable salt thereof, wherein n is 2-8.
59. The compound of any one of claims 32-58, or a pharmaceutically acceptable salt
3 4
thereof, wherein B and B are independently an optionally substituted 8- to 14-membered fused bicyclic aromatic heterocyclic.
60. The compound of claim 59, or a pharmaceutically acceptable salt thereof, wherein: B3 is a group represented by formula (B3-A) or formula (B3-B):
Figure imgf000366_0002
R13, R14, R15, R16 and R17 are each independently a hydrogen atom or a substituent;
Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
Rla is a hydrogen atom or a substituent;
B4 is a group represented by formula (B4-A) or formula (B4-B):
Figure imgf000367_0001
R , R , R , R and R are each independently a hydrogen atom or a substituent;
Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
R2a is a hydrogen atom or a substituent.
61. The compound of any one of claims 32-60, or a pharmaceutically acceptable salt thereof, wherein at least one of B3 or B4 is:
Figure imgf000367_0002
R is hydrogen or C1-6 alkyl; and
R19 is a halogen atom.
62. The compound of claim 61, or a pharmaceutically acceptable salt thereof, wherein B is:
Figure imgf000367_0003
The compound of claim 61, or a pharmaceutically acceptable salt thereof, wherein B4
Figure imgf000367_0004
64. The compound of any one of claims 61-63, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom.
65. The compound of any one of claims 61-64, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
66. The compound of any one of claims 61-64, or a pharmaceutically acceptable salt thereof, wherein R18 is methyl.
67. The compound of any one of claims 62 or 64- 66, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000368_0001
Figure imgf000369_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
68. The compound of claim 67, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000369_0002
Figure imgf000370_0001
Figure imgf000371_0001
The compound of claim 68, or a pharmaceutically acceptable salt thereof, wherein
B is selected from the group consisting of:
Figure imgf000371_0002
70. The compound of claim 69, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting of:
Figure imgf000371_0003
71. The compound of any one of claims 63-66, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000372_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
Figure imgf000373_0001
Figure imgf000374_0001
73. The compound of claim 72, or a pharmaceutically acceptable salt thereof, wherein Bected from the group consisting of:
Figure imgf000374_0002
Figure imgf000375_0001
74. The compound of claim 73, or a pharmaceutically acceptable salt thereof, wherein B is selected from the group consisting f:
Figure imgf000375_0002
^ and ^
75. The compound of any one of claims 32-39, 44, or 46-74, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
76. The compound of any one of claims 32-39, 44, or 46-74,, or a pharmaceutically acceptable salt thereof, wherein Q is a sulfur atom.
77. The compound of any one of claims 32-35, 40-43, 45, 46, 49-54, or 58-74, or a pharmaceutically acceptable salt thereof, wherein Q4 is an oxygen atom.
78. The compound of any one of claims 32-35, 40-43,45, 46, 49-54, or 58-74, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
79. The compound of any one of claims 32-78, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are an oxygen atom and R1 and R2 are independently a hydroxy group, a fluoro atom, or a chloro atom.
80. The compound of any one of claims 32-79, or a pharmaceutically acceptable salt thereof, wherein the antibody is an anti-GCC antibody.
81. The compound of claim 80, or a pharmaceutically acceptable salt thereof, wherein the antibody is an anti-GCC antibody comprising a heavy chain region comprising amino acid sequence SEQ. ID. No. 1.
82. The compound of claims 80 or 81, or a pharmaceutically acceptable salt thereof, wherein the antibody is an anti-GCC antibody comprising a light chain region comprising amino acid sequence SEQ. ID. No. 2.
83. A pharmaceutical composition comprising the compound of any one of claims 32-82, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
84. A method of treating a patient comprising administering to the patient a therapeutically effective amount of the compound of any one of claims 1-30 or 32-82, or a pharmaceutically acceptable salt thereof, wherein the patient has cancer.
85. The method of claim 84, wherein the cancer is any one or more of the cancers of Table 7.
86. The method of claim 85, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
87. The method of any one of claims 84-86 further comprising administering a therapeutically effective amount of a second therapeutic agent useful in the treatment of cancer.
88. The pharmaceutical composition of claims 31 or 83 for use in treating cancer.
89. The pharmaceutical composition of claim 88, wherein the cancer is any one or more of the cancers of Table 7.
90. The pharmaceutical composition of claim 88, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
91. A compound of any one of claims 1-30 or 32-82, or a pharmaceutically acceptable salt thereof, for use in treatment of cancer.
92. The compound of claim 91, wherein the cancer is any one or more of the cancers of Table 7.
93. The compound of claim 91, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
94. Use of a compound of any one of claims 1-30 or 32-82, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for treatment of cancer.
95. The use of claim 94, wherein the cancer is any one or more of the cancers of Table 7.
96. The use of claim 94, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
97. A kit comprising the compound of any one of claims 1-30 or 32-82, or a
pharmaceutically acceptable salt, and instructions for administering the compound, or a
pharmaceutically acceptable salt thereof, to a patient having cancer.
98. The kit of claim 97, wherein the cancer is any one or more of the cancers of Table 7.
99. The kit of claim 97, wherein the cancer is selected from the group consisting of solid tumor and lymphoma.
100. The kit of any one of claims 97-99 further comprising one or more additional therapeutic agents.
101. A compound having Formula (XL) : CD-I^-R28 (XL)
or a pharmaceutically acceptable salt thereof, wherein:
CD is a group represented by any one of Formula (XX) - (XXIX):
Figure imgf000378_0001
XXIX R1 and R2 are each independently a hydroxy group, hydrogen, amino group, or a halogen atom; B3 and B4 are independently an optionally substituted 5- to 14-membered aromatic heterocyclic group;
X 11 and X 2z are each independently an oxygen atom, CH2, or a sulfur atom;
Q\ Q2 > θΛ and Q4 are eacn independently an oxygen atom or a sulfur atom;
L1 is a linker;
R28 is selected from the group consisting of -N3, -ONH2, -OH, -CN, -N02, -CHO, - NR29C(=0)CH=CH2, -SH, -S(=0)2(CH=CH2), -NR29C(=0)CH2Br, -NR29C(=0)CH2I, - C(= HNH2, -C02H, -NH2, -C≡CH,
Figure imgf000379_0001
R is hydrogen or C1-6 alkyl;
R30a and R30 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, Ci-6 alkoxy, -CN, -N02, and -OH; and
R31a and R31 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, -N(CH3)2, Ci-6 alkoxy, -CN, -N02, and -OH.
102. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein
R 1 and R 2 are each independently a hydroxy group or a halogen atom.
103. The compound of claims 101 or 102, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are each independently an oxygen atom or a sulfur atom.
104. The compound of any one of claims 101-103, or a pharmaceutically acceptable salt thereof, wherein Q1 and Q3 are an oxygen atom.
105. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX- A):
Figure imgf000380_0001
106. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXI- A):
Figure imgf000380_0002
107. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXII- A):
Figure imgf000380_0003
108. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIII-A):
Figure imgf000381_0001
109. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIV-A):
Figure imgf000381_0002
110. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXV- A :
Figure imgf000381_0003
111. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVI-A :
Figure imgf000381_0004
112. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVII-A):
Figure imgf000382_0001
XXVII-A
113. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVIII-A):
Figure imgf000382_0002
XXVIII-A
114. The compound of claim 101, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIX-A):
Figure imgf000382_0003
115. The compound of any one of claims 101-114, or a pharmaceutically acceptable salt thereof, wherein:
1 is -X3-T-Z-;
Figure imgf000382_0004
o is 1, 2, or 3; or
X3 is absent;
T is a peptide, or is absent; and
Z is a spacer. The compound of claim 115, or a pharmaceutically acceptable salt thereof, wherein:
Figure imgf000383_0001
R and R are independently selected from the group consisting of hydrogen and optionally substituted C1-6 alkyl.
117. The compound of claim 116, or a pharmaceutically acceptable salt thereof, wherein:
XJ is
Figure imgf000383_0002
118. The compound of any one of claims 115-117, or a pharmaceutically acceptable salt thereof, wherein:
O
Z IS ^ m or -(CH2CH20)s-;
m is 1, 2, 3, 4, 5, or 6; and
s is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
119. The compound of claim 115 , or a pharmaceutically acceptable salt thereof, wherein: X3 is -CH2-; o
Z is p ; and
p is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
120. The compound of claim 115, or a pharmaceutically acceptable salt thereof, wherein: 3 i -CH2CH2-;
Figure imgf000384_0001
q is 1, 2, 3, 4, 5, or 6; and
r is 1, 2, 3, 4, 5, or 6.
121. The compound of any one of claims 101-120, or a pharmaceutically acceptable salt thereof ',, wwhheerreeiinn B3
B3 aanndd B 4
B4 aaire independently an optionally substituted 8- to 14-membered fused bicyclic aromatic heterocyclic.
122. The compound of claim 121, or a pharmaceutically acceptable salt thereof, wherein: B3 is a group represented by formula (B3-A) or formula (B3-B):
Figure imgf000384_0002
R13, R14, R15, R16 and R17 are each independently a hydrogen atom or a substituent;
Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
Rla is a hydrogen atom or a substituent;
B4 is a group represented by formula (B4-A) or formula (B4-B):
Figure imgf000384_0003
R 23 , R 24 , R 25 , R 26 and R 27 are each independently a hydrogen atom or a substituent;
Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C; R2a is a hydrogen atom or a substituent.
123. The compound of any one of claims 101-122, or a pharmaceutically acceptable salt
3 4
thereof, wherein at least one of BJ or B" is:
Figure imgf000385_0001
R is hydrogen or C1-6 alkyl; and
R19 is a halogen atom.
124. The compound of claim 123, or a pharmaceutically acceptable salt thereof, wherein
Figure imgf000385_0002
The compound of claim 123, or a pharmaceutically acceptable salt thereof, wherein
Figure imgf000385_0003
126. The compound of any one of claims 123-125, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom.
127. The compound of any one of claims 123-126, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
128. The compound of any one of claims 123-126, or a pharmaceutically acceptable salt thereof, wherein R18 is methyl.
129. The compound of any one of claims 124 or 126-128, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000386_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or any available nitrogen atom with a C1-6 alkyl group.
Figure imgf000387_0001
Figure imgf000388_0001
131. The compound of claim 130, or a pharmaceutically acceptable salt thereof, whereinected from the group consisting of:
Figure imgf000389_0001
132. The compound of claim 131, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000389_0002
133. The compound of any one of claims 125-128, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000389_0003
Figure imgf000390_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
134. The compound of claim 133, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000390_0002
Figure imgf000391_0001
Figure imgf000392_0001
135. The compound of claim 134, or a pharmaceutically acceptable salt thereof, wherein B i lected from the group consisting of:
Figure imgf000392_0002
136. The compound of claim 135, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000393_0001
137. The compound of any one of claims 101-108, 113, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q is an oxygen atom.
138. The compound of any one of claims claims 101-108, 113, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q2 is a sulfur atom.
139. The compound of any one of claims 101-104, 109-112, 114, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q4 is an oxygen atom.
140. The compound of any one of claims 101-104, 109-112, 114, or 115-136, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
141. The compound of any one of claims 101-142, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are an oxygen atom and R1 and R2 are independently a hydroxy group or a fluoro atom atom.
142. The compound of any one of claims 101-141, wherein R
Figure imgf000393_0002
143. The compound of claim 142, selected from the group consisting of:
Figure imgf000394_0001
A compound having Formula (XLI):
(CD-L2)U-DA (XLI)
or a pharmaceutically acceptable salt thereof, wherein:
CD is a group represented by any one of Formula (XX) - (XXIX):
Figure imgf000394_0002
XX XXI XXII
Figure imgf000395_0001
Figure imgf000395_0002
XXIX
R1 and R2 are each independently a hydroxy group, hydrogen, amino group, or a halogen atom;
B3 and B4 are independently an optionally substituted 5- to 14-membered aromatic heterocyclic group;
X1 and X2 are each independently an oxygen atom, CH2, or a sulfur atom;
Q 1 , Q2 , Q 3 , and Q 4 are each independently an oxygen atom or a sulfur atom;
L2 is a linker; or
L2 is absent;
DA is a drug delivery agent; and u is 1-1000.
145. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein
R 1 and R 2 are each independently a hydroxy group or a halogen atom.
146. The compound of claims 144 or 145, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are each independently an oxygen atom or a sulfur atom.
147. The compound of any one of claims 144-146, or a pharmaceutically
1 3
acceptable salt thereof, wherein Q and Q are an oxygen atom.
148. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XX- A):
Figure imgf000396_0001
149. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXI- A):
Figure imgf000396_0002
150. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXII- A):
Figure imgf000397_0001
151. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIII-A):
Figure imgf000397_0002
152. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIV-A):
Figure imgf000397_0003
152. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXV- A :
Figure imgf000397_0004
153. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVI-A):
Figure imgf000398_0001
154. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula XXVII-A):
Figure imgf000398_0002
XXVII-A
155. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXVIII-A):
Figure imgf000398_0003
XXVIII-A
156. The compound of claim 144, or a pharmaceutically acceptable salt thereof, wherein CD is group represented by Formula (XXIX-A):
Figure imgf000398_0004
XXIX-A
157. The compound of any one of claims 144-156, or a pharmaceutically acceptable salt thereof, wherein B3 and B4 are independently an optionally substituted 8- to 14-membered fused bicyclic aromatic heterocyclic.
158. The compound of claim 157, or a pharmaceutically acceptable salt thereof, wherein: B3 is a group represented by formula (B3-A) or formula (B3-B):
Figure imgf000399_0001
R13, R14, R15, R16 and R17 are each independently a hydrogen atom or a substituent;
Y11, Y12, Y13, Y14, Y15 and Y16 are each independently N or CRla;
Z11, Z12, Z13, Z14, Z15 and Z16 are each independently N or C;
Rla is a hydrogen atom or a substituent;
B4 is a group represented by formula (B4-A) or formula (B4-B):
Figure imgf000399_0002
R , R , R , R and R are each independently a hydrogen atom or a substituent;
Y21, Y22, Y23, Y24, Y25 and Y26 are each independently N or CR2a;
Z21, Z22, Z23, Z24, Z25 and Z26 are each independently N or C;
R2a is a hydrogen atom or a substituent.
159. The compound of any one of claims 144-158, or a pharmaceutically acceptable salt
3 4
thereof, wherein at least one of BJ or B" is:
Figure imgf000400_0001
R is hydrogen or C1-6 alkyl; and
R19 is a halogen atom.
160. The compound of claim 159, or a pharmaceutically acceptable salt thereof, wherein
Figure imgf000400_0002
The compound of claim 159, or a pharmaceutically acceptable salt thereof, wherein
Figure imgf000400_0003
162. The compound of any one of claims 159-161, or a pharmaceutically acceptable salt thereof, wherein R19 is a fluoro atom.
163. The compound of any one of claims 159-162, or a pharmaceutically acceptable salt thereof, wherein R18 is hydrogen.
164. The compound of any one of claims 159-162, or a pharmaceutically acceptable salt thereof, wherein R 18 is methyl.
165. The compound of any one of claims 159 or 162-164, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisting of:
Figure imgf000401_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, C1-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
Figure imgf000402_0001
Figure imgf000403_0001
167. The compound of claim 166, or a pharmaceutically acceptable salt thereof, wherein lected from the rou consistin of:
Figure imgf000403_0002
Figure imgf000404_0001
168. The compound of claim 167, or a pharmaceutically acceptable salt thereof, wherein B4 is selected from the group consisti
Figure imgf000404_0002
" and "^
169. The compound of any one of claims 161-164, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000404_0003
Figure imgf000405_0001
each of which is optionally and independently substituted at:
(i) any available carbon atom with a halo, C1-6 alkyl, Ci-6 alkoxy, C1-6 alkylthio, or amino group; and/or
(ii) any available nitrogen atom with a C1-6 alkyl group.
170. The compound of claim 169, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000405_0002
Figure imgf000406_0001
Figure imgf000407_0001
171. The compound of claim 170, or a pharmaceutically acceptable salt thereof, wherein
B is selected from the group consisting of:
Figure imgf000407_0002
172. The compound of claim 171, or a pharmaceutically acceptable salt thereof, wherein B3 is selected from the group consisting of:
Figure imgf000407_0003
173. The compound of any one of claims 144-151, 155, or 157-172, or a pharmaceutically acceptable salt thereof, wherein Q2 is an oxygen atom.
174. The compound of any one of claims 144-151, 155, or 157-172, or a pharmaceutically acceptable salt thereof, wherein Q2 is a sulfur atom.
175. The compound of any one of claims 144-147, 152-154, 156, or 157-172, or a pharmaceutically acceptable salt thereof, wherein Q4 is an oxygen atom.
176. The compound of any one of claims 144-147, 152-154, 156, or 157-172,, or a pharmaceutically acceptable salt thereof, wherein Q4 is a sulfur atom.
177. The compound of any one of claims 144-176, or a pharmaceutically acceptable salt thereof, wherein X1 and X2 are an oxygen atom and R1 and R2 are independently a hydroxy group, a fluoro atom, or a chloro atom.
178. The compound of any one of claims 144-177, or a pharmaceutically acceptable salt thereof, wherein u is 1-100.
179. The compound of claim 178, or a pharmaceutically acceptable salt thereof, wherein u is 1-10.
180. The compound of claim 179, or a pharmaceutically acceptable salt thereof, wherein u is 1-5.
181. The compound of claim 180, or a pharmaceutically acceptable salt thereof, wherein u is 1.
182. The compound of any one of claims 144-181, or a pharmaceutically acceptable salt thereof, wherein:
L is -X -T -Z -Q -;
Figure imgf000409_0001
v is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 ; or
X4 is absent;
T1 is a peptide, or is absent;
Z1 is a spacer;
QA is a heterobifunctional group or heterotrifunctional group, or is absent.
183. The compound of claim 182, or a pharmaceutically acceptable salt thereof, wherein:
Figure imgf000409_0002
T
R10c and R10d are independently selected from the group consisting of hydrogen and optionally substituted Ci-6 alkyl.
184. The compound of claim 183, or a pharmaceutically acceptable salt thereof, wherein:
X4 is
Figure imgf000409_0003
185. The compound of any one of claims 182-184, or a pharmaceutically acceptable salt thereof, wherein:
Z1 is ¾ m1 or -(CH2CH20)si-;
mi is 1, 2, 3, 4, 5, or 6; and
si is 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10.
186. The compound of claim 182, or a pharmaceutically acceptable salt thereof, wherein:
X4 is -CH2-
O
Z1 is P1 ; and
pi is 1, 2, 3, 4, 5, 6, 7, 8, 9,
187. The compound of claim 182, or a pharmaceutically acceptable salt thereof, wherein:
X4 is -CH2CH2-;
H
z1 is q1 Γ1
qi is 1, 2, 3, 4, 5, or 6; and
ri is 1, 2, 3, 4, 5, or 6.
188. The compound of any one of claims 182, 186, or 187, or a pharmaceutically acceptable salt thereof, wherein T1 is absent.
189. The compound of any one of claims 182-188, or a pharmaceutically acceptable salt thereof, wherein QA is a heterobifunctional group selected from the group consisting of:
Figure imgf000410_0001
R is hydrogen or C1-6 alkyl;
R30a and R30 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, Ci-6 alkoxy, -CN, -N02, and -OH;
R31a and R31 are independently selected from the group consisting of hydrogen, C1-6 alkyl, halo, -C(=0)OR29, -NH2, -N(C¾)2, Ci-6 alkoxy, -CN, -N02, and -OH; and
* indicates the attachment point to any available carbon atom, nitrogen atom, oxygen atom, or sulfur atom attached to the drug delivery agent.
190. The compound of claim 182, or a pharmaceutically acceptable salt thereof, wherein X4, T1, and QA are absent.
191. The compound of any one of claims 144-190, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises lipids, steroids, vitamins, carbohydrates, proteins, peptides, polyamines, polyethylene glycols, or peptidomimetics, or any combinations thereof.
192. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises lipids.
193. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises steroids.
194. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises vitamins.
195. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises carbohydrates.
196. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises proteins.
197. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises peptides.
198. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises polyamines.
199. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises polyethylene glycols.
200. The compound of claim 191, or a pharmaceutically acceptable salt thereof, wherein the drug delivery agent comprises peptidomimetics.
PCT/IB2017/057588 2016-12-01 2017-12-01 Cyclic dinucleotide Ceased WO2018100558A2 (en)

Priority Applications (30)

Application Number Priority Date Filing Date Title
EP21157239.1A EP3868384B1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
EA201991315A EA038805B1 (en) 2017-11-21 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
RS20210562A RS61818B1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
KR1020197019077A KR102640802B1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as STING (stimulator of interferon genes) agonists
LTEP17817176.5T LT3512861T (en) 2016-12-01 2017-12-01 CYCLIC DINUCLEOTIDES AS STING (INTERFERON GENE STIMULATORS) AGONISTS
BR112019011120-4A BR112019011120B1 (en) 2016-12-01 2017-12-01 CYCLIC DINUCLEOTIDE COMPOUNDS, RELATED COMPOSITION AND USE
PL17817176T PL3512861T3 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
AU2017370004A AU2017370004B2 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as STING (stimulator of interferon genes) agonists
UAA201907162A UA126390C2 (en) 2016-12-01 2017-12-01 CYCLIC DINUCLEOTIDE COMPOUND AS AN AGONIST OF STING (STIMULATOR OF INTERFERON GENES)
CA3045762A CA3045762A1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
JP2019527462A JP6633255B1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as STING (stimulator of interferon genes) agonists
ES17817176T ES2866948T3 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as STING agonists (interferon gene stimulator)
EP17817176.5A EP3512861B1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
MX2019006397A MX2019006397A (en) 2016-12-01 2017-12-01 Cyclic purine dinucleotides as sting (stimulator of inteferon genes) agonists.
CN201780074714.9A CN110325543B (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as STING (stimulator of interferon genes) agonists
HRP20210726TT HRP20210726T1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of inteferon genes) agonists
NZ754737A NZ754737B2 (en) 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
SI201730756T SI3512861T1 (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
PE2019001164A PE20210255A1 (en) 2016-12-01 2017-12-01 CYCLIC DINUCLEOTIDE AS STING AGONISTS (INTERFERON GENES STIMULATOR)
MYPI2019003124A MY190460A (en) 2016-12-01 2017-12-01 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
DK17817176.5T DK3512861T3 (en) 2016-12-01 2017-12-01 CYCLIC DINUCLEOTIDES AS STING (STIMULATOR OF INTERFERONGENES) AGONISTS
US16/185,258 US10980825B2 (en) 2016-12-01 2018-11-09 Cyclic dinucleotide
IL267020A IL267020B (en) 2016-12-01 2019-05-30 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
PH12019501222A PH12019501222A1 (en) 2016-12-01 2019-05-31 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
ZA2019/04311A ZA201904311B (en) 2016-12-01 2019-06-28 Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
CONC2019/0007032A CO2019007032A2 (en) 2016-12-01 2019-06-28 Cyclic dinucleotide as sting agonists (interferon gene stimulator)
US17/065,242 US11666594B2 (en) 2016-12-01 2020-10-07 Antibody-drug conjugates comprising a cyclic dinucleotide
CY20211100384T CY1124196T1 (en) 2016-12-01 2021-05-06 CYCLIC DINUCLEOTIDES AS STING AGENTS (INTERFERON GENE stimulator)
US18/310,467 US12171777B2 (en) 2016-12-01 2023-05-01 Methods of making a cyclic dinucleotide
US18/936,247 US20250205270A1 (en) 2016-12-01 2024-11-04 Antibody-drug conjugate precursors comprising a cyclic dinucleotide

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
JP2016234553 2016-12-01
JP2016-234553 2016-12-01
JP2017-107216 2017-05-30
JP2017107216A JP2018090562A (en) 2016-12-01 2017-05-30 Cyclic dinucleotide
US201762589300P 2017-11-21 2017-11-21
US62/589,300 2017-11-21

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/185,258 Continuation US10980825B2 (en) 2016-12-01 2018-11-09 Cyclic dinucleotide

Publications (4)

Publication Number Publication Date
WO2018100558A2 true WO2018100558A2 (en) 2018-06-07
WO2018100558A3 WO2018100558A3 (en) 2018-07-19
WO2018100558A9 WO2018100558A9 (en) 2019-05-09
WO2018100558A8 WO2018100558A8 (en) 2019-06-20

Family

ID=66179467

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2017/057588 Ceased WO2018100558A2 (en) 2016-12-01 2017-12-01 Cyclic dinucleotide

Country Status (30)

Country Link
US (4) US10980825B2 (en)
EP (2) EP3512861B1 (en)
JP (2) JP6633255B1 (en)
KR (1) KR102640802B1 (en)
CN (1) CN110325543B (en)
AU (1) AU2017370004B2 (en)
CA (1) CA3045762A1 (en)
CL (1) CL2019001485A1 (en)
CO (1) CO2019007032A2 (en)
CY (1) CY1124196T1 (en)
DK (1) DK3512861T3 (en)
EC (1) ECSP19046507A (en)
ES (1) ES2866948T3 (en)
HR (1) HRP20210726T1 (en)
HU (1) HUE054450T2 (en)
IL (1) IL267020B (en)
JO (1) JOP20170192A1 (en)
LT (1) LT3512861T (en)
MA (1) MA46245A (en)
MX (1) MX2019006397A (en)
MY (1) MY190460A (en)
PE (1) PE20210255A1 (en)
PH (1) PH12019501222A1 (en)
PL (1) PL3512861T3 (en)
PT (1) PT3512861T (en)
RS (1) RS61818B1 (en)
SI (1) SI3512861T1 (en)
UA (1) UA126390C2 (en)
WO (1) WO2018100558A2 (en)
ZA (1) ZA201904311B (en)

Cited By (100)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019043634A2 (en) 2017-08-30 2019-03-07 Beijing Xuanyi Pharmasciences Co., Ltd. Cyclic di-nucleotides as stimulator of interferon genes modulators
WO2019084060A1 (en) 2017-10-24 2019-05-02 Silverback Therapeutics, Inc. Conjugates and methods of use thereof for selective delivery of immune-modulatory agents
WO2019125974A1 (en) * 2017-12-20 2019-06-27 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
WO2019129880A1 (en) 2017-12-29 2019-07-04 Invivogen Pro-cyclic dinucleotides and pro-cyclic dinucleotide conjugates for cytokine induction
WO2019165374A1 (en) 2018-02-26 2019-08-29 Gilead Sciences, Inc. Substituted pyrrolizine compounds as hbv replication inhibitors
WO2019183578A1 (en) 2018-03-23 2019-09-26 Codiak Biosciences, Inc. Extracellular vesicles comprising sting-agonist
WO2019195181A1 (en) 2018-04-05 2019-10-10 Gilead Sciences, Inc. Antibodies and fragments thereof that bind hepatitis b virus protein x
WO2019193533A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'2'-cyclic dinucleotides
WO2019193542A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides
WO2019193543A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides
WO2019200247A1 (en) 2018-04-12 2019-10-17 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
WO2019211799A1 (en) 2018-05-03 2019-11-07 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide
US10519188B2 (en) 2016-03-18 2019-12-31 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use
WO2020028097A1 (en) 2018-08-01 2020-02-06 Gilead Sciences, Inc. Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid
WO2020041720A1 (en) 2018-08-24 2020-02-27 Codiak Biosciences, Inc. Extracellular vesicles targeting dendritic cells and uses thereof
WO2020050406A1 (en) 2018-09-06 2020-03-12 第一三共株式会社 Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
WO2020056008A1 (en) 2018-09-12 2020-03-19 Silverback Therapeutics, Inc. Compositions for the treatment of disease with immune stimulatory conjugates
WO2020057546A1 (en) 2018-09-21 2020-03-26 上海迪诺医药科技有限公司 Cyclic dinucleotide analogue, pharmaceutical composition thereof, and application
WO2020065408A1 (en) 2018-09-27 2020-04-02 Pierre Fabre Medicament Sulfomaleimide-based linkers and corresponding conjugates
WO2020092528A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity
WO2020092621A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
US10662416B2 (en) 2016-10-14 2020-05-26 Precision Biosciences, Inc. Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome
EP3558324A4 (en) * 2016-12-20 2020-08-05 Merck Sharp & Dohme Corp. CYCLIC DINUCLEOTIDE STING AGONISTS FOR CANCER TREATMENT
WO2020178768A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
WO2020178769A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides and prodrugs thereof
WO2020178770A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
WO2020191361A2 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Extracellular vesicles for vaccine delivery
WO2020191369A1 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Process for preparing extracellular vesicles
WO2020191377A1 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Extracellular vesicle conjugates and uses thereof
WO2020214652A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020214663A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020227421A1 (en) 2019-05-09 2020-11-12 Aligos Therapeutics, Inc. Modified cyclic dinucleoside compounds as sting modulators
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
WO2020229982A1 (en) 2019-05-10 2020-11-19 Takeda Pharmaceutical Company Limited Antibody drug conjugates
WO2020237025A1 (en) 2019-05-23 2020-11-26 Gilead Sciences, Inc. Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors
WO2020263830A1 (en) 2019-06-25 2020-12-30 Gilead Sciences, Inc. Flt3l-fc fusion proteins and methods of use
WO2021003445A1 (en) 2019-07-03 2021-01-07 Codiak Biosciences, Inc. Extracellular vesicles targeting t cells and uses thereof
WO2021005541A1 (en) 2019-07-09 2021-01-14 Takeda Pharmaceutical Company Limited Administration of sting agonist and checkpoint inhibitors
WO2021007160A1 (en) 2019-07-05 2021-01-14 Tambo, Inc. Trans-cyclooctene bioorthogonal agents and uses in cancer and immunotherapy
WO2021034804A1 (en) 2019-08-19 2021-02-25 Gilead Sciences, Inc. Pharmaceutical formulations of tenofovir alafenamide
WO2021046426A1 (en) * 2019-09-06 2021-03-11 Sperovie Biosciences, Inc. Cyclic dinucleotide sting agonists tethered to a pd-1 or ctla-4 antibodies
WO2021062290A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Methods of producing extracellular vesicles
WO2021062060A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Sting agonist comprising exosomes combined with il-12 displaying exosomes for treating a tumour
WO2021062317A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Extracellular vesicle compositions
WO2021062058A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Sting agonist comprising exosomes for treating neuroimmunological disorders
US10966999B2 (en) 2017-12-20 2021-04-06 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
WO2021067644A1 (en) 2019-10-01 2021-04-08 Silverback Therapeutics, Inc. Combination therapy with immune stimulatory conjugates
WO2021067181A1 (en) 2019-09-30 2021-04-08 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
WO2021113765A1 (en) 2019-12-06 2021-06-10 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
US11033569B2 (en) 2016-07-06 2021-06-15 Sperovie Biosciences, Inc. Compounds,Compositions, and methods for the treatment of disease
US11033635B2 (en) * 2019-07-19 2021-06-15 Immunesensor Therapeutics, Inc. Antibody-STING agonist conjugates and their use in immunotherapy
WO2021168274A1 (en) 2020-02-21 2021-08-26 Silverback Therapeutics, Inc. Nectin-4 antibody conjugates and uses thereof
US11110106B2 (en) 2018-10-29 2021-09-07 Venenum Biodesign, LLC Sting agonists for treating bladder cancer and solid tumors
WO2021177438A1 (en) 2020-03-06 2021-09-10 第一三共株式会社 Antibody-drug conjugate including novel cyclic dinucleotide derivative
WO2021184017A1 (en) 2020-03-13 2021-09-16 Codiak Biosciences, Inc. Extracellular vesicles for treating neurological disorders
WO2021188959A1 (en) 2020-03-20 2021-09-23 Gilead Sciences, Inc. Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same
WO2021189047A2 (en) 2020-03-20 2021-09-23 Codiak Biosciences, Inc. Extracellular vesicles for therapy
WO2021206158A1 (en) 2020-04-10 2021-10-14 小野薬品工業株式会社 Method of cancer therapy
WO2021216572A1 (en) 2020-04-20 2021-10-28 Massachusetts Institute Of Technology Lipid compositions for delivery of sting agonist compounds and uses thereof
US11161864B2 (en) 2018-10-29 2021-11-02 Venenum Biodesign, LLC Sting agonists
WO2021237100A1 (en) 2020-05-21 2021-11-25 Codiak Biosciences, Inc. Methods of targeting extracellular vesicles to lung
US11203610B2 (en) 2017-12-20 2021-12-21 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
WO2022006327A1 (en) 2020-07-01 2022-01-06 Silverback Therapeutics, Inc. Anti-asgr1 antibody conjugates and uses thereof
WO2022031894A1 (en) 2020-08-07 2022-02-10 Gilead Sciences, Inc. Prodrugs of phosphonamide nucleotide analogues and their pharmaceutical use
WO2022032191A1 (en) 2020-08-07 2022-02-10 Tambo, Inc. Trans-cyclooctene bioorthogonal agents and uses in cancer and immunotherapy
WO2021260061A3 (en) * 2020-06-24 2022-02-24 Sapreme Technologies B.V. Saponin derivatives for use in medicine
WO2022050300A1 (en) 2020-09-02 2022-03-10 第一三共株式会社 NOVEL ENDO-β-N-ACETYLGLUCOSAMINIDASE
WO2021261996A3 (en) * 2020-06-24 2022-03-10 Sapreme Technologies B.V. Hydrazone-based saponin derivatives
WO2022055929A1 (en) * 2020-09-08 2022-03-17 The Board Of Regents Of The University Of Texas System Polyvalent sting activating compositions and uses thereof
WO2022066883A1 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Extracellular vesicles comprising kras antigens and uses thereof
WO2022066898A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Methods of producing extracellular vesicles
WO2022066928A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Process for preparing extracellular vesicles
WO2022066934A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Process for preparing extracellular vesicles
WO2022097117A1 (en) 2020-11-09 2022-05-12 Takeda Pharmaceutical Company Ltd. Antibody drug conjugates
WO2022107027A1 (en) 2020-11-18 2022-05-27 Takeda Pharmaceutical Company Limited Administration of sting agonist, checkpoint inhibitors, and radiation
US11400108B2 (en) 2017-02-21 2022-08-02 Board Of Regents, The University Of Texas System Cyclic dinucleotides as agonists of stimulator of interferon gene dependent signalling
US11453697B1 (en) 2015-08-13 2022-09-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
WO2022241134A1 (en) 2021-05-13 2022-11-17 Gilead Sciences, Inc. COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS
WO2022245671A1 (en) 2021-05-18 2022-11-24 Gilead Sciences, Inc. Methods of using flt3l-fc fusion proteins
WO2022271677A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271659A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271684A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271650A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
US11542293B2 (en) 2017-11-10 2023-01-03 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
US11584774B2 (en) 2017-09-11 2023-02-21 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
EP4137499A1 (en) 2021-08-17 2023-02-22 Ustav organicke chemie a biochemie AV CR, v.v.i. 7-substituted 7-deazaadenine-containing 2,3 -cyclic dinucleotides
WO2023056468A1 (en) 2021-09-30 2023-04-06 Codiak Biosciences, Inc. Extracellular vesicle comprising cholesterol tagged sting-agonist
US11638716B2 (en) 2017-08-31 2023-05-02 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11707531B2 (en) 2017-09-11 2023-07-25 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
WO2023167238A1 (en) 2022-03-02 2023-09-07 第一三共株式会社 METHOD FOR PRODUCING Fc-CONTAINING MOLECULE
RU2809547C2 (en) * 2018-09-06 2023-12-12 Даити Санкио Компани, Лимитед New cyclic dinucleotide derivative and its antibody-drug conjugate
WO2024020164A2 (en) 2022-07-21 2024-01-25 Firefly Bio, Inc. Glucocorticoid receptor agonists and conjugates thereof
WO2024048490A1 (en) 2022-08-29 2024-03-07 第一三共株式会社 Antibody-drug conjugate including mutant fc region
US12291548B2 (en) 2018-07-10 2025-05-06 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2025240242A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2025240243A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus
WO2025240244A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection
WO2025240246A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2026053159A1 (en) 2024-09-06 2026-03-12 Takeda Pharmaceutical Company Limited Dazostinag or conjugates thereof for treatment of adenoid cystic carcinomas
WO2026053158A1 (en) 2024-09-06 2026-03-12 Takeda Pharmaceutical Company Limited Dazostinag or conjugates thereof for treatment of neuroendocrine neoplasms

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JOP20170192A1 (en) 2016-12-01 2019-01-30 Takeda Pharmaceuticals Co Cyclic dinucleotide
EP3573718B1 (en) * 2017-01-27 2022-06-01 Janssen Biotech, Inc. Cyclic dinucleotides as sting agonists
KR102558127B1 (en) * 2020-10-23 2023-07-24 아주대학교산학협력단 Composition comprising arylpiperazine derivative for activating stimulator of interferon gene dependent signalling
CN116490244A (en) * 2020-11-18 2023-07-25 武田药品工业株式会社 Administration of STING agonists, checkpoint inhibitors, and radiation
CN118873678A (en) * 2023-01-18 2024-11-01 泰励生物科技(上海)有限公司 Antibody-drug conjugates and their uses

Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1989011486A1 (en) 1988-05-26 1989-11-30 University Patents, Inc. Nucleoside and polynucleotide thiophosphoramidite and phosphorodithioate compounds and processes
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US20050164235A1 (en) 2003-04-17 2005-07-28 Muthiah Manoharan Modified iRNA agents
US7626014B2 (en) 2004-04-27 2009-12-01 Alnylam Pharmaceuticals Single-stranded and double-stranded oligonucleotides comprising a 2-arylpropyl moiety
US7709226B2 (en) 2001-07-12 2010-05-04 Arrowsmith Technology Licensing Llc Method of humanizing antibodies by matching canonical structure types CDRs
WO2011003025A1 (en) 2009-07-01 2011-01-06 Rutgers, The State University Of New Jersey Synthesis of cyclic diguanosine monophosphate and thiophosphate analogs thereof
WO2011005761A1 (en) 2009-07-06 2011-01-13 Ontorii, Inc Novel nucleic acid prodrugs and methods use thereof
WO2011050242A1 (en) 2009-10-23 2011-04-28 Millennium Pharmaceuticals, Inc. Anti-gcc antibody molecules and related compositions and methods
US8034921B2 (en) 2006-11-21 2011-10-11 Alnylam Pharmaceuticals, Inc. IRNA agents targeting CCR5 expressing cells and uses thereof
WO2013075035A1 (en) 2011-11-18 2013-05-23 Alnylam Pharmaceuticals Rnai agents, compositions and methods of use thereof for treating transthyretin (ttr) associated diseases
US20130315923A1 (en) 2012-04-26 2013-11-28 Thomas Jefferson University Anti-gcc antibody molecules and related compositions and methods
WO2013185052A1 (en) 2012-06-08 2013-12-12 Aduro Biotech Compostions and methods for cancer immunotherapy
WO2014093936A1 (en) 2012-12-13 2014-06-19 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
WO2014179760A1 (en) 2013-05-03 2014-11-06 The Regents Of The University Of California Cyclic di-nucleotide induction of type i interferon
WO2014179335A1 (en) 2013-04-29 2014-11-06 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
WO2014189805A1 (en) 2013-05-18 2014-11-27 Auro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2014189806A1 (en) 2013-05-18 2014-11-27 Aduro Biotech, Inc. Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling
WO2015017652A1 (en) 2013-07-31 2015-02-05 Memorial Sloan-Kettering Cancer Center Sting crystals and modulators
WO2015077354A1 (en) 2013-11-19 2015-05-28 The University Of Chicago Use of sting agonist as cancer treatment
WO2015185565A1 (en) 2014-06-04 2015-12-10 Glaxosmithkline Intellectual Property Development Limited Cyclic di-nucleotides as modulators of sting
WO2016096174A1 (en) 2014-12-16 2016-06-23 Invivogen Fluorinated cyclic dinucleotides for cytokine induction
WO2016096577A1 (en) 2014-12-16 2016-06-23 Invivogen Combined use of a chemotherapeutic agent and a cyclic dinucleotide for cancer treatment
WO2016120305A1 (en) 2015-01-29 2016-08-04 Glaxosmithkline Intellectual Property Development Limited Cyclic dinucleotides useful for the treatment of inter alia cancer
WO2016145102A1 (en) 2015-03-10 2016-09-15 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene" -dependent signalling
WO2017027645A1 (en) 2015-08-13 2017-02-16 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
WO2017075477A1 (en) 2015-10-28 2017-05-04 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2017191579A1 (en) 2016-05-05 2017-11-09 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase

Family Cites Families (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2257704B (en) 1991-07-18 1995-03-01 Erba Carlo Spa Cyclic oligonucleotides phosphorothioates
EP1645561A1 (en) 2003-07-15 2006-04-12 Mitsui Chemicals, Inc. Method of synthesizing cyclic bisdinucleoside
WO2005030186A2 (en) 2003-07-28 2005-04-07 Univ Maryland Method for attenuating virulence of microbial pathogens and for inhibiting microbial biofilm formation
US7592326B2 (en) 2004-03-15 2009-09-22 Karaolis David K R Method for stimulating the immune, inflammatory or neuroprotective response
JP4931798B2 (en) 2004-03-15 2012-05-16 ケイ.アール. カラオリス,デイヴィッド Methods for immune, inflammatory or neuroprotective responses
US20090012038A1 (en) 2004-10-18 2009-01-08 Spormann Alfred M Methods for microbial biofilm destruction and interference with microbial cellular physiology
EP1782826A1 (en) 2005-11-08 2007-05-09 GBF Gesellschaft für Biotechnologische Forschung mbH PQS and c-diGMP and its conjugates as adjuvants and their uses in pharmaceutical compositions
US8076303B2 (en) * 2005-12-13 2011-12-13 Spring Bank Pharmaceuticals, Inc. Nucleotide and oligonucleotide prodrugs
WO2009133560A1 (en) 2008-04-29 2009-11-05 Smart Assays Non-hydrolyzable and permeable cyclic bis-[nucleotide monophosphate] derivatives and uses thereof
US8450293B2 (en) 2010-08-10 2013-05-28 Rutgers, The State University Of New Jersey Synthesis and characterization of C8 analogs of c-di-GMP
US9090646B2 (en) 2012-12-05 2015-07-28 Rutgers, The State University Of New Jersey Biotinylated compounds
KR102255996B1 (en) 2012-12-19 2021-05-26 보드 오브 리전츠, 더 유니버시티 오브 텍사스 시스템 Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
WO2014109256A1 (en) 2013-01-09 2014-07-17 国立大学法人東北大学 Triazole-linked cyclic dinucleotide analogue
US9549944B2 (en) * 2013-05-18 2017-01-24 Aduro Biotech, Inc. Compositions and methods for inhibiting “stimulator of interferon gene”—dependent signalling
CA2931146C (en) 2013-11-22 2022-06-28 Brock University Use of fluorinated cyclic dinucleotides as oral vaccine adjuvants
KR102586317B1 (en) * 2014-12-22 2023-10-06 바스프 에스이 Use of a chemical mechanical polishing (cmp) composition for polishing of cobalt and/or cobalt alloy comprising substrates
FR3037784B1 (en) * 2015-06-29 2017-12-15 Gexfix Sa DEVICE FOR EXTERNALLY DYNAMIC OSTEOSYNTHESIS FASTENING
WO2017011444A1 (en) 2015-07-13 2017-01-19 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating b cell cancers
WO2017011622A1 (en) 2015-07-14 2017-01-19 Spring Bank Pharmaceuticals, Inc. Compounds and compositions that induce rig-i-and other pattern recongnition receptors
WO2017019896A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to pd-1
US20170146519A1 (en) 2015-11-20 2017-05-25 Oregon Health & Science University Sting agonists and methods of selecting sting agonists
EP3366691A1 (en) 2015-12-03 2018-08-29 GlaxoSmithKline Intellectual Property Development Limited Cyclic purine dinucleotides as modulators of sting
DE212016000029U1 (en) 2015-12-07 2017-07-30 Opi Vi - Ip Holdco Llc Compositions of antibody construct agonist conjugates
WO2017106740A1 (en) 2015-12-16 2017-06-22 Aduro Biotech, Inc. Methods for identifying inhibitors of "stimulator of interferon gene"-dependent interferon production
SG11201805888SA (en) 2016-01-11 2018-08-30 Innate Tumor Immunity Inc Cyclic dinucleotides for treating conditions associated with sting activity such as cancer
WO2017123657A1 (en) 2016-01-11 2017-07-20 Gary Glick Cyclic dinucleotides for treating conditions associated with sting activity such as cancer
MX390014B (en) 2016-03-18 2025-03-20 Immune Sensor Llc CYCLIC DINUCLEOTIDE COMPOUNDS AND METHODS OF USE.
TWI663991B (en) 2016-03-23 2019-07-01 中央研究院 Thin shell polymer nanoparticle and use thereof
BR112018070602A2 (en) 2016-04-07 2019-02-05 Glaxosmithkline Ip Dev Ltd compound, pharmaceutical composition, use of the compound, and method for treating a disease or disorder
PL3440076T3 (en) 2016-04-07 2022-09-05 Glaxosmithkline Intellectual Property Development Limited HETEROCYCLICAL AMIDES USEFUL AS PROTEIN MODULATORS
EP3448393A1 (en) 2016-04-25 2019-03-06 Invivogen Novel complexes of immunostimulatory compounds, and uses thereof
EP3507367A4 (en) 2016-07-05 2020-03-25 Aduro BioTech, Inc. Locked nucleic acid cyclic dinucleotide compounds and uses thereof
CA3029644A1 (en) 2016-07-06 2018-01-11 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2018009652A1 (en) 2016-07-06 2018-01-11 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
CA3030830A1 (en) 2016-07-15 2018-01-18 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2018013887A1 (en) 2016-07-15 2018-01-18 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
US20190345191A1 (en) 2016-08-31 2019-11-14 Innate Tumor Immunity, Inc. Cyclic dinucleotide analogs for treating conditions associated with sting (stimulator of interferon genes) activity
US10537590B2 (en) 2016-09-30 2020-01-21 Boehringer Ingelheim International Gmbh Cyclic dinucleotide compounds
CN110036001B (en) 2016-10-04 2022-03-22 默沙东公司 Benzo[b]thiophene compounds as STING agonists
EP3523314A1 (en) 2016-10-07 2019-08-14 Biolog Life Science Institute Forschungslabor Und Biochemica-Vertrieb GmbH Cyclic dinucleotides containing benzimidazole, method for the production of same, and use of same to activate stimulator of interferon genes (sting)-dependent signaling pathways
JOP20170188A1 (en) 2016-11-25 2019-01-30 Janssen Biotech Inc Cyclic dinucleotides as sting agonists
JOP20170192A1 (en) 2016-12-01 2019-01-30 Takeda Pharmaceuticals Co Cyclic dinucleotide
JP2018090562A (en) * 2016-12-01 2018-06-14 武田薬品工業株式会社 Cyclic dinucleotide
CA3047394A1 (en) 2016-12-20 2018-06-28 Merck Sharp & Dohme Corp. Combinations of pd-1 antagonists and cyclic dinucleotide sting agonists for cancer treatment
AU2017378783A1 (en) 2016-12-20 2019-07-04 Merck Sharp & Dohme Corp. Cyclic dinucleotide sting agonists for cancer treatment
WO2018119117A1 (en) 2016-12-22 2018-06-28 The Regents Of The University Of California Methods of producing cyclic dinucleotides
US11021511B2 (en) 2017-01-27 2021-06-01 Janssen Biotech, Inc. Cyclic dinucleotides as sting agonists
EP3573718B1 (en) 2017-01-27 2022-06-01 Janssen Biotech, Inc. Cyclic dinucleotides as sting agonists
EP3574018A4 (en) 2017-01-27 2020-10-07 Silverback Therapeutics, Inc. Tumor targeting conjugates and methods of use thereof
US20200055883A1 (en) 2017-02-17 2020-02-20 Eisai R&D Management Co., Ltd. Cyclic di-nucleotides derivative for the treatment of cancer
EP3585379A4 (en) 2017-02-21 2020-12-02 Board of Regents, The University of Texas System CYCLIC DINUCLEOTIDES AS AGONISTS OF THE STIMULATOR OF INTERFERON-DEPENDENT SIGNALING
CN106667914B (en) 2017-03-13 2022-02-01 杭州星鳌生物科技有限公司 Composition of targeted liposome-cyclic dinucleotide, preparation method and application of targeted liposome-cyclic dinucleotide in resisting tumors
JOP20190218A1 (en) 2017-03-22 2019-09-22 Boehringer Ingelheim Int Modified cyclic dinucleotide compounds
WO2018198084A1 (en) 2017-04-27 2018-11-01 Lupin Limited Cyclic di-nucleotide compounds with tricyclic nucleobases
AR113224A1 (en) 2017-04-28 2020-02-19 Novartis Ag ANTIBODY CONJUGATES INCLUDING A STING AGONIST
UY37695A (en) 2017-04-28 2018-11-30 Novartis Ag BIS 2’-5’-RR- (3’F-A) (3’F-A) CYCLE DINUCLEOTIDE COMPOUND AND USES OF THE SAME
KR102782200B1 (en) 2017-08-30 2025-03-17 에이제이 사이언시즈 (이씽) 코., 엘티디 Cyclic dinucleotides as stimulators of interferon gene regulators
CN111051328B (en) 2017-08-31 2023-11-03 百时美施贵宝公司 Cyclic dinucleotides as anticancer agents
KR20250021628A (en) 2017-08-31 2025-02-13 브리스톨-마이어스 스큅 컴퍼니 Cyclic dinucleotides as anticancer agents
PE20210340A1 (en) 2017-09-15 2021-02-22 Aduro Biotech Inc COMPOUNDS CONTAINING PYRAZOLOPYRIMIDINONE AND THEIR USES
MX2023005381A (en) 2020-11-09 2023-05-23 Takeda Pharmaceuticals Co Antibody drug conjugates.

Patent Citations (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1989011486A1 (en) 1988-05-26 1989-11-30 University Patents, Inc. Nucleoside and polynucleotide thiophosphoramidite and phosphorodithioate compounds and processes
US7709226B2 (en) 2001-07-12 2010-05-04 Arrowsmith Technology Licensing Llc Method of humanizing antibodies by matching canonical structure types CDRs
US20050164235A1 (en) 2003-04-17 2005-07-28 Muthiah Manoharan Modified iRNA agents
US7745608B2 (en) 2003-04-17 2010-06-29 Alnylam Pharmaceuticals, Inc. Modified iRNA agents
US7626014B2 (en) 2004-04-27 2009-12-01 Alnylam Pharmaceuticals Single-stranded and double-stranded oligonucleotides comprising a 2-arylpropyl moiety
US8034921B2 (en) 2006-11-21 2011-10-11 Alnylam Pharmaceuticals, Inc. IRNA agents targeting CCR5 expressing cells and uses thereof
WO2011003025A1 (en) 2009-07-01 2011-01-06 Rutgers, The State University Of New Jersey Synthesis of cyclic diguanosine monophosphate and thiophosphate analogs thereof
WO2011005761A1 (en) 2009-07-06 2011-01-13 Ontorii, Inc Novel nucleic acid prodrugs and methods use thereof
WO2011050242A1 (en) 2009-10-23 2011-04-28 Millennium Pharmaceuticals, Inc. Anti-gcc antibody molecules and related compositions and methods
WO2013075035A1 (en) 2011-11-18 2013-05-23 Alnylam Pharmaceuticals Rnai agents, compositions and methods of use thereof for treating transthyretin (ttr) associated diseases
US20130315923A1 (en) 2012-04-26 2013-11-28 Thomas Jefferson University Anti-gcc antibody molecules and related compositions and methods
WO2013185052A1 (en) 2012-06-08 2013-12-12 Aduro Biotech Compostions and methods for cancer immunotherapy
WO2014093936A1 (en) 2012-12-13 2014-06-19 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
WO2014179335A1 (en) 2013-04-29 2014-11-06 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
WO2014179760A1 (en) 2013-05-03 2014-11-06 The Regents Of The University Of California Cyclic di-nucleotide induction of type i interferon
WO2014189805A1 (en) 2013-05-18 2014-11-27 Auro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2014189806A1 (en) 2013-05-18 2014-11-27 Aduro Biotech, Inc. Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling
WO2015017652A1 (en) 2013-07-31 2015-02-05 Memorial Sloan-Kettering Cancer Center Sting crystals and modulators
WO2015077354A1 (en) 2013-11-19 2015-05-28 The University Of Chicago Use of sting agonist as cancer treatment
WO2015185565A1 (en) 2014-06-04 2015-12-10 Glaxosmithkline Intellectual Property Development Limited Cyclic di-nucleotides as modulators of sting
WO2016096174A1 (en) 2014-12-16 2016-06-23 Invivogen Fluorinated cyclic dinucleotides for cytokine induction
WO2016096577A1 (en) 2014-12-16 2016-06-23 Invivogen Combined use of a chemotherapeutic agent and a cyclic dinucleotide for cancer treatment
WO2016120305A1 (en) 2015-01-29 2016-08-04 Glaxosmithkline Intellectual Property Development Limited Cyclic dinucleotides useful for the treatment of inter alia cancer
WO2016145102A1 (en) 2015-03-10 2016-09-15 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene" -dependent signalling
WO2017027645A1 (en) 2015-08-13 2017-02-16 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
WO2017027646A1 (en) 2015-08-13 2017-02-16 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
WO2017075477A1 (en) 2015-10-28 2017-05-04 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2017191579A1 (en) 2016-05-05 2017-11-09 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase

Non-Patent Citations (60)

* Cited by examiner, † Cited by third party
Title
"Comprehensive Heterocyclic Chemistry III", vol. 1-14, ELSEVIER
"Design of Molecules", vol. 7, 1990, HIROKAWA SHOTEN, article "Development of Pharmaceuticals", pages: 163 - 198
"Jikken Kagaku Kouza, 5th", vol. 13-19, CHEMICAL SOCIETY OF JAPAN
"ORGANIC SYNTHESES Collective", vol. I-VII, JOHN WILEY & SONS INC
"Shin Jikken Kagaku Kouza", vol. 14-15, CHEMICAL SOCIETY OF JAPAN
AL-LAZIKANI B ET AL., J MOL BIOL, vol. 273, 1997, pages 927 - 948
AL-LAZIKANI ET AL., J. MOLEC. BIOL., vol. 273, 1997, pages 927 - 948
AOKI, CANCER GENE THERAPY, vol. 8, 2001, pages 783 - 787
BIOCHEMISTRY, vol. 55, 2016, pages 837 - 849
BIOCONJUGATE CHEM., vol. 21, 2010, pages 5 - 13
CELL RES, vol. 25, 2015, pages 539 - 550
CELL, 2015, pages 1018 - 1030
CHEM. REV., vol. 114, 2014, pages 9154 - 9218
CHOTHIA C ET AL., J MOL BIOL, vol. 227, 1992, pages 799 - 817
CHOTHIA C; LESK AM, J MOL BIOL, vol. 196, 1987, pages 901 - 917
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
DORONINA ET AL., NAT. BIOTECHNOL., vol. 21, 2003, pages 778 - 784
H. VU ET AL., TETRAHEDRON LETT., vol. 32, 1991, pages 3005 - 3008
HAUBNER, JOUR. NUCL. MED., vol. 42, 2001, pages 326 - 336
IMMUNITY, vol. 41, 2014, pages 830 - 842
IMMUNITY, vol. 41, 2014, pages 843 - 852
J CONTROL RELEASE, vol. 189, 2014, pages 141 - 9
JIE JACK LI: "Modern Organic Synthesis in the Laboratory A Collection of Standard Experimental Procedures", OXFORD UNIVERSITY
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KABAT ET AL.: "Sequences of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KIYOSHI TOMIOKA; KAGAKUDOJIN: "Comprehensive Organic Transformations", 1989, VCH PUBLISHERS INC., article "Strategic Applications of Named Reactions in Organic Synthesis"
L. F. TIETZE; TH. EICHER; NANKODO, FINE ORGANIC CHEMISTRY
LAM, NATURE, vol. 354, 1991, pages 82 - 84
LEFRANC M-P ET AL., NUCLEIC ACIDS RES, vol. 27, 1999, pages 209 - 212
LEFRANC M-P, THE IMMUNOLOGIST, vol. 7, 1999, pages 132 - 136
MACCALLUM RM ET AL., J MOL BIOL, vol. 262, 1996, pages 732 - 745
MARSHALL ET AL., SCIENCE, vol. 259, 1993, pages 1564 - 1570
MARTIN A.: "Antibody Engineering", vol. 31, 2001, SPRINGER-VERLAG, article "Protein Sequence and Structure Analysis of Antibody Variable Domains", pages: 422 - 439
MOL. CELL, vol. 154, 2013, pages 748 - 762
MOLECULAR THERAPY: NUCLEIC ACIDS, vol. 6, 2017, pages 249 - 258
NANOMEDICINE (LOND, vol. 10, no. 19, 2015, pages 2989 - 3001
NAT CHEM BIOL, vol. 10, 2014, pages 1043 - 1048
ORGANIC NAME REACTIONS, THE REACTION MECHANISM AND ESSENCE
P.J.KOCIENSKI: "Protecting Groups 3rd Ed.", 2004, THIEME
PHARMA. RES., vol. 32, 2015, pages 3526 - 3540
R.P. LYER ET AL., J. AM. CHEM. SOC., vol. 112, 1990, pages 1253 - 1254
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
ROGUSKA ET AL., PROC. NATL. ACAD. SCI., vol. 91, no. 3, 1994, pages 969 - 973
ROGUSKA ET AL., PROTEIN ENG., vol. 9, no. 10, 1996, pages 895 - 904
SCI. TRANSL. MED., vol. 283, 2015, pages 283ra52
SIMEONI ET AL., NUCL. ACIDS RES., vol. 31, 2003, pages 2717 - 2724
SUBBARAO ET AL., BIOCHEMISTRY, vol. 26, 1987, pages 2964 - 2972
THE AAPS JOURNAL, vol. 17, 2015, pages 339 - 351
THEODORA W. GREENE; PETER G. M. WUTS: "Protective Groups in Organic Synthesis", 2007, WILEY-INTERSCIENCE, INC.
THER ADV VACCINES, vol. 7, 2013, pages 131 - 143
TRAMONTANO A ET AL., J MOL BIOL, vol. 215, no. 1, 1990, pages 175 - 82
TRENDS IN IMMUNOLOGY, vol. 35, 2014, pages 88 - 93
TROUT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 626 - 629
TURK ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1559, 2002, pages 56 - 68
UMEMOTO ET AL., INT. J. CANCER, vol. 43, 1989, pages 677 - 684
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
VOGEL ET AL., AM. CHEM. SOC, vol. 118, 1996, pages 1581 - 1586
ZITZMANN, CANCER RES., vol. 62, 2002, pages 5139 - 43

Cited By (155)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11453697B1 (en) 2015-08-13 2022-09-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
US10519188B2 (en) 2016-03-18 2019-12-31 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use
US11299512B2 (en) 2016-03-18 2022-04-12 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use
US11744845B2 (en) 2016-07-06 2023-09-05 F-star Therapeutics, Inc. Compounds,compositions, and methods for the treatment of disease
US11033569B2 (en) 2016-07-06 2021-06-15 Sperovie Biosciences, Inc. Compounds,Compositions, and methods for the treatment of disease
US10662416B2 (en) 2016-10-14 2020-05-26 Precision Biosciences, Inc. Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome
US11274285B2 (en) 2016-10-14 2022-03-15 Precision Biosciences, Inc. Engineered meganucleases specific for recognition sequences in the Hepatitis B virus genome
EP3558324A4 (en) * 2016-12-20 2020-08-05 Merck Sharp & Dohme Corp. CYCLIC DINUCLEOTIDE STING AGONISTS FOR CANCER TREATMENT
US12036231B2 (en) 2017-02-21 2024-07-16 Board Of Regents, The University Of Texas System Cyclic dinucleotides as agonists of stimulator of interferon gene dependent signalling
US11400108B2 (en) 2017-02-21 2022-08-02 Board Of Regents, The University Of Texas System Cyclic dinucleotides as agonists of stimulator of interferon gene dependent signalling
US11773132B2 (en) 2017-08-30 2023-10-03 Beijing Xuanyi Pharmasciences Co., Ltd. Cyclic di-nucleotides as stimulator of interferon genes modulators
WO2019043634A2 (en) 2017-08-30 2019-03-07 Beijing Xuanyi Pharmasciences Co., Ltd. Cyclic di-nucleotides as stimulator of interferon genes modulators
US11638716B2 (en) 2017-08-31 2023-05-02 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US12390668B2 (en) 2017-09-11 2025-08-19 Invox Pharma Limited Compounds, compositions, and methods for the treatment of disease
US11584774B2 (en) 2017-09-11 2023-02-21 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11707531B2 (en) 2017-09-11 2023-07-25 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US12187761B2 (en) 2017-09-11 2025-01-07 Invox Pharma Limited Compounds, compositions, and methods for the treatment of disease
WO2019084060A1 (en) 2017-10-24 2019-05-02 Silverback Therapeutics, Inc. Conjugates and methods of use thereof for selective delivery of immune-modulatory agents
US12054512B2 (en) 2017-11-10 2024-08-06 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
US11542293B2 (en) 2017-11-10 2023-01-03 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
US11203610B2 (en) 2017-12-20 2021-12-21 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
US11685761B2 (en) 2017-12-20 2023-06-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
EP3727401A4 (en) * 2017-12-20 2022-04-06 Merck Sharp & Dohme Corp. CYCLIC DINUCLEOTIDE COMPOUNDS USED AS STING AGONISTS
WO2019125974A1 (en) * 2017-12-20 2019-06-27 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
US10966999B2 (en) 2017-12-20 2021-04-06 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
US11730817B2 (en) 2017-12-29 2023-08-22 Invivogen Pro-cyclic dinucleotides and pro-cyclic dinucleotide conjugates for cytokine induction
WO2019129880A1 (en) 2017-12-29 2019-07-04 Invivogen Pro-cyclic dinucleotides and pro-cyclic dinucleotide conjugates for cytokine induction
WO2019165374A1 (en) 2018-02-26 2019-08-29 Gilead Sciences, Inc. Substituted pyrrolizine compounds as hbv replication inhibitors
WO2019183578A1 (en) 2018-03-23 2019-09-26 Codiak Biosciences, Inc. Extracellular vesicles comprising sting-agonist
WO2019195181A1 (en) 2018-04-05 2019-10-10 Gilead Sciences, Inc. Antibodies and fragments thereof that bind hepatitis b virus protein x
WO2019193543A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides
WO2019193542A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides
US11292812B2 (en) 2018-04-06 2022-04-05 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′-cyclic dinucleotides
US11149052B2 (en) 2018-04-06 2021-10-19 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′-cyclic dinucleotides
WO2019193533A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'2'-cyclic dinucleotides
US11788077B2 (en) 2018-04-12 2023-10-17 Precision Biosciences, Inc. Polynucleotides encoding optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome
US11142750B2 (en) 2018-04-12 2021-10-12 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome
WO2019200247A1 (en) 2018-04-12 2019-10-17 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
WO2019211799A1 (en) 2018-05-03 2019-11-07 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide
US12291548B2 (en) 2018-07-10 2025-05-06 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2020028097A1 (en) 2018-08-01 2020-02-06 Gilead Sciences, Inc. Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid
WO2020041720A1 (en) 2018-08-24 2020-02-27 Codiak Biosciences, Inc. Extracellular vesicles targeting dendritic cells and uses thereof
US12370263B2 (en) 2018-09-06 2025-07-29 Daiichi Sankyo Company, Limited Cyclic dinucleotide derivative based antibody-drug conjugates
KR20210057066A (en) 2018-09-06 2021-05-20 다이이찌 산쿄 가부시키가이샤 Novel Cyclic Dinucleotide Derivatives and Antibody Drug Conjugates
WO2020050406A1 (en) 2018-09-06 2020-03-12 第一三共株式会社 Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
RU2809547C2 (en) * 2018-09-06 2023-12-12 Даити Санкио Компани, Лимитед New cyclic dinucleotide derivative and its antibody-drug conjugate
KR20250078590A (en) 2018-09-06 2025-06-02 다이이찌 산쿄 가부시키가이샤 Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
KR20230122685A (en) 2018-09-06 2023-08-22 다이이찌 산쿄 가부시키가이샤 Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
CN112714649A (en) * 2018-09-06 2021-04-27 第一三共株式会社 Novel cyclic dinucleotide derivatives and antibody drug conjugates thereof
KR20230028589A (en) 2018-09-06 2023-02-28 다이이찌 산쿄 가부시키가이샤 Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
EP4524154A2 (en) 2018-09-06 2025-03-19 Daiichi Sankyo Company, Limited Antibody-drug conjugates of cyclic dinucleotide derivatives
WO2020056008A1 (en) 2018-09-12 2020-03-19 Silverback Therapeutics, Inc. Compositions for the treatment of disease with immune stimulatory conjugates
US12152051B2 (en) 2018-09-21 2024-11-26 Shanghai De Novo Pharmatech Co., Ltd. Cyclic dinucleotide analogue, pharmaceutical composition thereof, and application
WO2020057546A1 (en) 2018-09-21 2020-03-26 上海迪诺医药科技有限公司 Cyclic dinucleotide analogue, pharmaceutical composition thereof, and application
WO2020065408A1 (en) 2018-09-27 2020-04-02 Pierre Fabre Medicament Sulfomaleimide-based linkers and corresponding conjugates
US12011485B2 (en) 2018-09-27 2024-06-18 Pierre Fabre Medicament Sulfomaleimide-based linkers and corresponding conjugates
US11161864B2 (en) 2018-10-29 2021-11-02 Venenum Biodesign, LLC Sting agonists
US11110106B2 (en) 2018-10-29 2021-09-07 Venenum Biodesign, LLC Sting agonists for treating bladder cancer and solid tumors
US11883420B2 (en) 2018-10-29 2024-01-30 Venenum Biodesign, LLC Sting agonists for treating bladder cancer and solid tumors
EP4671244A1 (en) 2018-10-31 2025-12-31 Gilead Sciences, Inc. SUBSTITUTED 6-AZABENZIMIDAZOLE COMPOUNDS AS HPK1 HIBITORS
WO2020092528A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity
EP4371987A1 (en) 2018-10-31 2024-05-22 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
WO2020092621A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
WO2020178769A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides and prodrugs thereof
WO2020178770A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
US12318403B2 (en) 2019-03-07 2025-06-03 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′-cyclic dinucleotides and prodrugs thereof
WO2020178768A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
US11766447B2 (en) 2019-03-07 2023-09-26 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
WO2020191361A2 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Extracellular vesicles for vaccine delivery
EP4671268A2 (en) 2019-03-21 2025-12-31 Lonza Sales AG METHOD FOR THE PRODUCTION OF EXTRACELLULAR VESCLES
WO2020191377A1 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Extracellular vesicle conjugates and uses thereof
WO2020191369A1 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Process for preparing extracellular vesicles
US12502427B2 (en) 2019-03-21 2025-12-23 Lonza Sales Ag Extracellular vesicles for vaccine delivery
WO2020214663A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
EP4458416A2 (en) 2019-04-17 2024-11-06 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020214652A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
US11787833B2 (en) 2019-05-09 2023-10-17 Aligos Therapeutics, Inc. Modified cyclic dinucleoside compounds as sting modulators
WO2020227421A1 (en) 2019-05-09 2020-11-12 Aligos Therapeutics, Inc. Modified cyclic dinucleoside compounds as sting modulators
WO2020229982A1 (en) 2019-05-10 2020-11-19 Takeda Pharmaceutical Company Limited Antibody drug conjugates
WO2020237025A1 (en) 2019-05-23 2020-11-26 Gilead Sciences, Inc. Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors
WO2020263830A1 (en) 2019-06-25 2020-12-30 Gilead Sciences, Inc. Flt3l-fc fusion proteins and methods of use
WO2021003445A1 (en) 2019-07-03 2021-01-07 Codiak Biosciences, Inc. Extracellular vesicles targeting t cells and uses thereof
WO2021007160A1 (en) 2019-07-05 2021-01-14 Tambo, Inc. Trans-cyclooctene bioorthogonal agents and uses in cancer and immunotherapy
WO2021005541A1 (en) 2019-07-09 2021-01-14 Takeda Pharmaceutical Company Limited Administration of sting agonist and checkpoint inhibitors
CN114080228A (en) * 2019-07-09 2022-02-22 武田药品工业株式会社 Administration of STING agonists and checkpoint inhibitors
US12403154B2 (en) 2019-07-09 2025-09-02 Takeda Pharmaceutical Company Limited Administration of sting agonist and checkpoint inhibitors
JP2022540605A (en) * 2019-07-09 2022-09-16 武田薬品工業株式会社 Administration of STING agonists and checkpoint inhibitors
US11213592B2 (en) 2019-07-19 2022-01-04 Immunesensor Therapeutics, Inc. Antibody-sting agonist conjugates and their use in immunotherapy
US11033635B2 (en) * 2019-07-19 2021-06-15 Immunesensor Therapeutics, Inc. Antibody-STING agonist conjugates and their use in immunotherapy
US12311030B2 (en) 2019-07-19 2025-05-27 Immunesensor Therapeutics, Inc. Antibody-sting agonist conjugates and their use in immunotherapy
WO2021034804A1 (en) 2019-08-19 2021-02-25 Gilead Sciences, Inc. Pharmaceutical formulations of tenofovir alafenamide
WO2021046426A1 (en) * 2019-09-06 2021-03-11 Sperovie Biosciences, Inc. Cyclic dinucleotide sting agonists tethered to a pd-1 or ctla-4 antibodies
WO2021062058A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Sting agonist comprising exosomes for treating neuroimmunological disorders
WO2021062290A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Methods of producing extracellular vesicles
WO2021062060A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Sting agonist comprising exosomes combined with il-12 displaying exosomes for treating a tumour
WO2021062317A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Extracellular vesicle compositions
WO2021067181A1 (en) 2019-09-30 2021-04-08 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
EP4458975A2 (en) 2019-09-30 2024-11-06 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
WO2021067644A1 (en) 2019-10-01 2021-04-08 Silverback Therapeutics, Inc. Combination therapy with immune stimulatory conjugates
WO2021113765A1 (en) 2019-12-06 2021-06-10 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
EP4567109A2 (en) 2019-12-06 2025-06-11 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
US12410418B2 (en) 2019-12-06 2025-09-09 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome
US11179473B2 (en) 2020-02-21 2021-11-23 Silverback Therapeutics, Inc. Nectin-4 antibody conjugates and uses thereof
WO2021168274A1 (en) 2020-02-21 2021-08-26 Silverback Therapeutics, Inc. Nectin-4 antibody conjugates and uses thereof
US12364768B2 (en) 2020-02-21 2025-07-22 Araris Biotech Ag Nectin-4 antibody conjugates and uses thereof
KR20220151630A (en) 2020-03-06 2022-11-15 다이이찌 산쿄 가부시키가이샤 Antibody Drug Conjugates Containing Novel Cyclic Dinucleotide Derivatives
WO2021177438A1 (en) 2020-03-06 2021-09-10 第一三共株式会社 Antibody-drug conjugate including novel cyclic dinucleotide derivative
WO2021184017A1 (en) 2020-03-13 2021-09-16 Codiak Biosciences, Inc. Extracellular vesicles for treating neurological disorders
WO2021189047A2 (en) 2020-03-20 2021-09-23 Codiak Biosciences, Inc. Extracellular vesicles for therapy
WO2021188959A1 (en) 2020-03-20 2021-09-23 Gilead Sciences, Inc. Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same
WO2021206158A1 (en) 2020-04-10 2021-10-14 小野薬品工業株式会社 Method of cancer therapy
WO2021216572A1 (en) 2020-04-20 2021-10-28 Massachusetts Institute Of Technology Lipid compositions for delivery of sting agonist compounds and uses thereof
WO2021237100A1 (en) 2020-05-21 2021-11-25 Codiak Biosciences, Inc. Methods of targeting extracellular vesicles to lung
WO2021260061A3 (en) * 2020-06-24 2022-02-24 Sapreme Technologies B.V. Saponin derivatives for use in medicine
WO2021261996A3 (en) * 2020-06-24 2022-03-10 Sapreme Technologies B.V. Hydrazone-based saponin derivatives
WO2021260054A3 (en) * 2020-06-24 2022-04-21 Sapreme Technologies B.V. Saponin derivatives for use in medicine
WO2022006327A1 (en) 2020-07-01 2022-01-06 Silverback Therapeutics, Inc. Anti-asgr1 antibody conjugates and uses thereof
US11541126B1 (en) 2020-07-01 2023-01-03 Silverback Therapeutics, Inc. Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof
EP4295917A2 (en) 2020-08-07 2023-12-27 Tambo, Inc. Trans-cyclooctene bioorthogonal agents and uses in cancer and immunotherapy
WO2022031894A1 (en) 2020-08-07 2022-02-10 Gilead Sciences, Inc. Prodrugs of phosphonamide nucleotide analogues and their pharmaceutical use
EP4667477A2 (en) 2020-08-07 2025-12-24 Gilead Sciences, Inc. Prodrugs of phosphonamide nucleotide analogues and their pharmaceutical use
WO2022032191A1 (en) 2020-08-07 2022-02-10 Tambo, Inc. Trans-cyclooctene bioorthogonal agents and uses in cancer and immunotherapy
WO2022050300A1 (en) 2020-09-02 2022-03-10 第一三共株式会社 NOVEL ENDO-β-N-ACETYLGLUCOSAMINIDASE
WO2022055929A1 (en) * 2020-09-08 2022-03-17 The Board Of Regents Of The University Of Texas System Polyvalent sting activating compositions and uses thereof
US12036319B2 (en) 2020-09-08 2024-07-16 The Board Of Regents Of The University Of Texas System Polyvalent sting activating compositions and uses thereof
WO2022066934A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Process for preparing extracellular vesicles
WO2022066928A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Process for preparing extracellular vesicles
WO2022066898A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Methods of producing extracellular vesicles
WO2022066883A1 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Extracellular vesicles comprising kras antigens and uses thereof
WO2022097117A1 (en) 2020-11-09 2022-05-12 Takeda Pharmaceutical Company Ltd. Antibody drug conjugates
US12221460B2 (en) 2020-11-09 2025-02-11 Takeda Pharmaceutical Company Limited Antibody drug conjugates
US11725024B2 (en) 2020-11-09 2023-08-15 Takeda Pharmaceutical Company Limited Antibody drug conjugates
JP2023550740A (en) * 2020-11-18 2023-12-05 武田薬品工業株式会社 Administration of STING agonists, checkpoint inhibitors, and radiation
WO2022107027A1 (en) 2020-11-18 2022-05-27 Takeda Pharmaceutical Company Limited Administration of sting agonist, checkpoint inhibitors, and radiation
WO2022241134A1 (en) 2021-05-13 2022-11-17 Gilead Sciences, Inc. COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS
WO2022245671A1 (en) 2021-05-18 2022-11-24 Gilead Sciences, Inc. Methods of using flt3l-fc fusion proteins
WO2022271677A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271650A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271684A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271659A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
US12589162B2 (en) 2021-08-06 2026-03-31 Tambo, Inc. Trans-cyclooctene prodrug of monomethyl auristatin E
EP4137499A1 (en) 2021-08-17 2023-02-22 Ustav organicke chemie a biochemie AV CR, v.v.i. 7-substituted 7-deazaadenine-containing 2,3 -cyclic dinucleotides
WO2023020640A1 (en) 2021-08-17 2023-02-23 Ustav Organicke Chemie A Biochemie Av Cr, V. V. I. 7-substituted 7-deazaadenine-containing 2',3'-cyclic dinucleotides
WO2023056468A1 (en) 2021-09-30 2023-04-06 Codiak Biosciences, Inc. Extracellular vesicle comprising cholesterol tagged sting-agonist
WO2023167238A1 (en) 2022-03-02 2023-09-07 第一三共株式会社 METHOD FOR PRODUCING Fc-CONTAINING MOLECULE
WO2024020164A2 (en) 2022-07-21 2024-01-25 Firefly Bio, Inc. Glucocorticoid receptor agonists and conjugates thereof
KR20250054799A (en) 2022-08-29 2025-04-23 다이이찌 산쿄 가부시키가이샤 Antibody drug conjugates comprising a mutant Fc region
WO2024048490A1 (en) 2022-08-29 2024-03-07 第一三共株式会社 Antibody-drug conjugate including mutant fc region
WO2025240242A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2025240243A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus
WO2025240244A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection
WO2025240246A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2026053159A1 (en) 2024-09-06 2026-03-12 Takeda Pharmaceutical Company Limited Dazostinag or conjugates thereof for treatment of adenoid cystic carcinomas
WO2026053158A1 (en) 2024-09-06 2026-03-12 Takeda Pharmaceutical Company Limited Dazostinag or conjugates thereof for treatment of neuroendocrine neoplasms

Also Published As

Publication number Publication date
CO2019007032A2 (en) 2019-10-21
US20250205270A1 (en) 2025-06-26
MX2019006397A (en) 2019-08-14
US20240066047A1 (en) 2024-02-29
DK3512861T3 (en) 2021-05-03
CL2019001485A1 (en) 2020-01-10
CY1124196T1 (en) 2022-05-27
MA46245A (en) 2019-07-24
JP2020055860A (en) 2020-04-09
LT3512861T (en) 2021-05-25
EP3512861A2 (en) 2019-07-24
PT3512861T (en) 2021-04-29
US20210137962A9 (en) 2021-05-13
JOP20170192A1 (en) 2019-01-30
US20190192549A1 (en) 2019-06-27
IL267020B (en) 2022-01-01
IL267020A (en) 2019-07-31
ZA201904311B (en) 2022-04-28
CN110325543A (en) 2019-10-11
JP7229907B2 (en) 2023-02-28
WO2018100558A3 (en) 2018-07-19
SI3512861T1 (en) 2021-08-31
CA3045762A1 (en) 2018-06-07
BR112019011120A2 (en) 2019-10-01
US11666594B2 (en) 2023-06-06
CN110325543B (en) 2023-03-31
EP3512861B1 (en) 2021-02-17
US20210106607A1 (en) 2021-04-15
US12171777B2 (en) 2024-12-24
HRP20210726T1 (en) 2021-10-01
US10980825B2 (en) 2021-04-20
AU2017370004B2 (en) 2022-03-10
NZ754737A (en) 2025-08-29
WO2018100558A8 (en) 2019-06-20
EP3868384B1 (en) 2026-02-25
PH12019501222A1 (en) 2019-12-02
AU2017370004A1 (en) 2019-07-11
KR102640802B1 (en) 2024-02-26
JP6633255B1 (en) 2020-01-22
EP3868384A1 (en) 2021-08-25
KR20190113768A (en) 2019-10-08
ES2866948T3 (en) 2021-10-20
HUE054450T2 (en) 2021-09-28
PE20210255A1 (en) 2021-02-10
RS61818B1 (en) 2021-06-30
JP2020504085A (en) 2020-02-06
ECSP19046507A (en) 2019-09-30
UA126390C2 (en) 2022-09-28
PL3512861T3 (en) 2021-09-20
MY190460A (en) 2022-04-21
WO2018100558A9 (en) 2019-05-09

Similar Documents

Publication Publication Date Title
US12171777B2 (en) Methods of making a cyclic dinucleotide
AU2023201159B2 (en) Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
TWI769195B (en) Cyclic dinucleotide
HK40008780B (en) Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
HK40008780A (en) Cyclic dinucleotides as sting (stimulator of interferon genes) agonists
BR112019011120B1 (en) CYCLIC DINUCLEOTIDE COMPOUNDS, RELATED COMPOSITION AND USE
RU2809547C2 (en) New cyclic dinucleotide derivative and its antibody-drug conjugate
EA038805B1 (en) Cyclic dinucleotides as sting (stimulator of interferon genes) agonists

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17817176

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2017817176

Country of ref document: EP

Effective date: 20190410

ENP Entry into the national phase

Ref document number: 2019527462

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3045762

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019011120

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: DZP2019000324

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 15123

Country of ref document: GE

WWE Wipo information: entry into national phase

Ref document number: 15123/1

Country of ref document: GE

WWE Wipo information: entry into national phase

Ref document number: NC2019/0007032

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20197019077

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017370004

Country of ref document: AU

Date of ref document: 20171201

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112019011120

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190530

WWP Wipo information: published in national office

Ref document number: NC2019/0007032

Country of ref document: CO

WWG Wipo information: grant in national office

Ref document number: NC2019/0007032

Country of ref document: CO

WWG Wipo information: grant in national office

Ref document number: 754737

Country of ref document: NZ