WO2018074979A1 - Truncated crispr-cas proteins for dna targeting - Google Patents
Truncated crispr-cas proteins for dna targeting Download PDFInfo
- Publication number
- WO2018074979A1 WO2018074979A1 PCT/SG2017/050523 SG2017050523W WO2018074979A1 WO 2018074979 A1 WO2018074979 A1 WO 2018074979A1 SG 2017050523 W SG2017050523 W SG 2017050523W WO 2018074979 A1 WO2018074979 A1 WO 2018074979A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- δηνη
- arec1
- arec2
- polypeptide
- aruvciii
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/746—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for lactic acid bacteria (Streptococcus; Lactococcus; Lactobacillus; Pediococcus; Enterococcus; Leuconostoc; Propionibacterium; Bifidobacterium; Sporolactobacillus)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1267—Gram-positive bacteria
- C07K16/1275—Streptococcus (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
Definitions
- the present invention generally relates to engineered and optimized CRISPR-Cas proteins and their applications in the site-specific modification of a target DNA.
- CRISPR-Cas has gained so much popularity in such a short time is that the element that targets the Cas endonuclease to the correct location in the genome is simply a short piece of guide RNA, which is straightforward to design and cheap to synthesize.
- the Cas enzyme performs two important and distinct functions. First, it is able to bind to specific loci in the genome with the aid of the guide RNA and a short sequence in the targeted DNA, called the protospacer adjacent motif (PAM). Cas proteins from different bacteria will recognize different PAMs in general. Various protein domains are involved in interacting with the DNA, including the REC1 , REC2, and PI domains. Second, the Cas enzyme can cleave both strands of the DNA upon binding, thereby generating a double-stranded break. The Cas protein contains two nuclease domains, the HNH and RuvC domains, each of which cut opposite strands of the DNA.
- PAM protospacer adjacent motif
- the overall domain architecture of the Cas9 enzyme from Streptococcus pyogenes is shown in Figure 1 . Since the two functions of the Cas enzyme may be separated, it is possible to utilize the CRISPR-Cas system only for the purpose of DNA targeting and not for DNA cleavage. To disable the cleavage function, the common practice is to mutate a catalytic residue in each of the two nuclease domains (D10A and H840A in SpCas9).
- dCas catalytically dead Cas enzyme
- adeno-associated virus (AAV) vectors are extensively used because the virus can transduce many different cell types, appears to elicit little immune response, and reliably and permanently inserts its gene into a safe genomic locus on human chromosome 19.
- AAV adeno-associated virus
- the packaging limit of AAV vectors is around 4.5 kb, excluding the inverted terminal repeats, and this is close to the size of the commonly used SpCas9, which is around 4.2 kb.
- the packaging limit of AAV vectors is around 4.5 kb, excluding the inverted terminal repeats, and this is close to the size of the commonly used SpCas9, which is around 4.2 kb.
- the invention relates to a polypeptide having at least 50% sequence identity to Streptococcus pyogenes Cas9 having the amino acid sequence set forth in SEQ ID NO:1 over its entire length, wherein said polypeptide comprises at least one deletion selected from the group consisting of ⁇ ( ⁇ 775-909), ARuvCIII-b ( ⁇ 1002-1074), AREC1 -a ( ⁇ 510-655), AREC1 - b ( ⁇ 525-587), AREC1 -C ( ⁇ 662-710), AREC2 ( ⁇ 180-308), AREC2-a ( ⁇ 212-244), AREC2-b ( ⁇ 244-276), AREC2-C ( ⁇ 276-308), AREC2-d ( ⁇ 199-283), AREC2-e ( ⁇ 198-257), AREC2-f ( ⁇ 235- 286), AREC2-g ( ⁇ 217-266), AREC3 ( ⁇ 498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , and wherein
- the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ⁇ ( ⁇ 510-655 ⁇ 775-909), AREC1 -c ⁇ ( ⁇ 662-710 ⁇ 775-909), AREC2 ⁇ ( ⁇ 180-308 ⁇ 775-909), AREC2-d ⁇ ( ⁇ 199-283 ⁇ 775- 909), ⁇ ARuvCIII-b ( ⁇ 775-909 ⁇ 1002-1074), AREC3 ⁇ ( ⁇ 498-712 ⁇ 775-909), AREC3 ⁇ ARuvCIII-b ( ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), AREC2 AREC3 ⁇ ARuvCIII-b ( ⁇ 180- 308 ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), and AREC2 ⁇ ARuvCIII-b ( ⁇ 180-308 ⁇ 775-909 ⁇ 1002-1074).
- the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof.
- the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -c ⁇ G12R, AREC1 -c ⁇ T13K, AREC1 -C ⁇ T13R, AREC1 -C ⁇ N14K, AREC1 -C ⁇ N497K, AREC1 -C ⁇ T657K, AREC1 - c ⁇ T657R, AREC1 -C ⁇ N767K, AREC1 -C ⁇ T770K, AREC1 -C ⁇ T770R, AREC1 -C ⁇ Q920K, AREC1 -C ⁇ Q920R, AREC1 -C ⁇ S1109R, AREC1 -C ⁇ D1135K, AREC1 -C ⁇ D1135R, AREC1 -C ⁇ S1338R, AREC1 -C ⁇ T657R T13K, AREC1 -C ⁇ T657R N497
- the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs:14-30.
- the polypeptide is further codon optimized for expression in a eukaryotic cell, preferably in a mammalian or human cell.
- the invention relates to a polypeptide having at least 50% sequence identity to Staphylococcus aureus Cas9 having the amino acid sequence set forth in SEQ ID NO:2, Neiserria meningitides Cas9 having the amino acid sequence set forth in SEQ ID NO:3, Acidaminococcus sp.
- the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ⁇ ( ⁇ 510-655 ⁇ 775-909), AREC1 -C ⁇ ( ⁇ 662-710 ⁇ 775-909), AREC2 ⁇ ( ⁇ 180-308 ⁇ 775-909), AREC2-d ⁇ ( ⁇ 199-283 ⁇ 775- 909), ⁇ ARuvCIII-b ( ⁇ 775-909 ⁇ 1002-1074), AREC3 ⁇ ( ⁇ 498-712 ⁇ 775-909), AREC3 ⁇ ARuvCIII-b ( ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), AREC2 AREC3 ⁇ ARuvCIII-b ( ⁇ 180- 308 ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), and AREC2 ⁇ ARuvCIII-b ( ⁇ 180-308 ⁇ 775-909 ⁇ 1002-1074).
- the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 .
- the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -c ⁇ G12R, AREC1 -c ⁇ T13K, AREC1 -C ⁇ T13R, AREC1 -c ⁇ N14K, AREC1 -c ⁇ N497K, AREC1 -c ⁇ T657K, AREC1 - c ⁇ T657R, AREC1 -C ⁇ N767K, AREC1 -C ⁇ T770K, AREC1 -C ⁇ T770R, AREC1 -C ⁇ Q920K, AREC1 -C ⁇ Q920R, AREC1 -C ⁇ S1109R, AREC1 -C ⁇ D1 135K, AREC1 -C ⁇ D1135R, AREC1 -C ⁇ S1338R, AREC1 -C ⁇ T657R T13K, AREC1 -C ⁇ T657R N4
- the invention relates to a nucleic acid molecule comprising or consisting of a nucleic acid encoding a polypeptide described herein.
- the nucleic acid molecule is a recombinant expression vector.
- the vector further comprises at least one regulatory element for controlling expression of the polypeptide.
- the invention relates to a composition comprising the polypeptide or nucleic acid molecule described herein.
- the invention in a fifth aspect, relates to a method of site-specific engineering of a target DNA, the method comprising contacting the target DNA with a CRISPR-Cas system comprising the polypeptide, nucleic acid molecule or composition described herein, wherein the CRISPR-Cas DNA-binding activity of the polypeptide recruits an effector domain to the target DNA.
- the effector domain includes but is not limited to transcriptional regulatory domains, histone- modifying domains, chromatin remodelers, fluorescent proteins, and deaminases.
- the target DNA is extrachromosomal or is part of a chromosome in vitro, in vivo, or in a cell.
- the CRISPR-Cas nuclease activity of the polypeptide introduces a single-stranded nick or double stranded break in the target DNA.
- the invention relates to use of the polypeptide, nucleic acid molecule or composition described herein in site-directed nucleic acid modification, preferably as a component in a CRISPR-Cas system.
- Figure 1 shows the schematic illustration of the different domains of Streptococcus pyogenes Cas9 (SpCas9).
- Figure 2 shows the schematic illustration of ARuvCIII, ARuvCIII-a, and ARuvCIII-b.
- Figure 3 shows the schematic illustration of AREC1 -a, AREC1 -b, AREC1 -c, and AREC3.
- Figure 4 shows the schematic illustration of AREC2, AREC2-a, AREC2-b, AREC2-C, AREC2-d, AREC2-e, AREC-f, and AREC2-g.
- Figure 5 shows the schematic illustration of ⁇ -a, ⁇ -b, ⁇ -c, ⁇ -d, ⁇ -e, and ⁇ -f.
- Figure 6 shows the results of reporter assays of 41 different truncated constructs, with deletions in various parts of the REC or NUC lobe,
- Figure 7 shows a boxplot that summarizes the results of reporter assays of different truncated constructs.
- 2x indicates that a fluorescence reporter with two binding sites for the dCas9-VPR enzyme was used, while 3x indicates that a fluorescence reporter with three binding sites was used.
- 24hr and 48hr indicates the time after transfection when the assays were performed.
- Figure 8 shows the results of quantitative real-time PCR (qRT-PCR) experiments to measure the expression levels of (a) ACTC, (b) ASCL1 , (c) MIAT, and (d) TTN in HEK293 cells, when the cells were transfected with different truncated constructs and a relevant guide RNA targeting the endogenous gene-of-interest. In these experiments, the cells were harvested 48 hours after transfection.
- qRT-PCR quantitative real-time PCR
- Figure 9 shows the results of experiments evaluating the effect of deleting the REC3 domain, either by itself or in combination with other domains, (a) Reporter assays of various REC3 truncations in comparison with the original full-length protein (WT) and three other truncations ( ⁇ , ARuvCIII-b ⁇ , and AREC1 -c) that we had found to perform similarly to wildtype. (b) Expression levels of either MIAT or TTN in HEK293 cells measured by qRT-PCR, when the cells were transfected with different REC3 truncated constructs and a corresponding gRNA targeting the gene-of-interest.
- Figure 10 shows a ribbon diagram of dSpCas9 bound to a gRNA and a target DNA. The residues that are within 5A of the DNA are represented as sticks.
- Figure 1 1 shows the reporter assays of constructs, each of which has 1 mutation introduced into deletions of HNH and REC1 -c ("2ple").
- Figure 12 shows the reporter assays of constructs, each of which has 2 different mutations introduced into deletions of HNH and REC1 -C ("2ple").
- Figure 13 shows the reporter assays of constructs, each of which has 1 mutation introduced into HNH, REC2, and RuvCIII-b ("3ple").
- the invention relates to a polypeptide having at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% sequence identity to Streptococcus pyogenes Cas9 having the amino acid sequence set forth in SEQ ID NO:1 over its entire length, wherein said polypeptide comprises at least one deletion selected from the group consisting of ⁇ ( ⁇ 775-909), ARuvCIII-b ( ⁇ 1002-1074
- polypeptide is used interchangeably herein with “peptide” and "protein”, and refers to polymers of at least two amino acids connected by peptide bonds.
- the polymer may comprise amino acid analogues or modified amino acids, it may be linear or branched, and it may be interrupted by non-amino acids.
- the term also encompasses an amino acid polymer that has been modified naturally or artificially; for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation to a labeling moiety.
- this term relates to polymers of naturally occurring amino acids, as defined below, which may optionally be modified as defined above, but does not comprise non-amino acid moieties in the polymer backbone.
- amino acid refers to natural and/or unnatural or synthetic amino acids, including both the D and L optical isomers, amino acid analogs (for example norleucine is an analog of leucine) and derivatives known in the art.
- naturally occurring amino acid relates to the 20 naturally occurring L-amino acids, namely Gly (G), Ala (A), Val (V), Leu (L), lie (I), Phe (F), Cys (C), Met (M), Pro (P), Thr (T), Ser (S), Glu (E), Gin (Q), Asp (D), Asn (N), His (H), Lys (K), Arg (R), Tyr (Y), and Trp (W).
- the peptides and polypeptides are shown in the N- to C-terminal orientation.
- sequence identity refers to the relatedness between two amino acid sequences or between two nucleotide sequences.
- sequence identity refers to the relatedness between two amino acid sequences or between two nucleotide sequences.
- sequence identity is determined using the Needleman- Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice er a/., 2000, Trends Genet. 16: 276-277), preferably version 5.0.0 or later.
- the parameters used are gap open penalty of 10, gap extension penalty of 0.5, and the EBLOSUM62 (EMBOSS version of BLOSUM62) substitution matrix.
- deletion refers to a removal of a portion of one or more amino acid residues from the amino acid sequence of the reference polypeptide.
- the polypeptide is truncated compared to the reference amino acid sequence in that it comprises one or more deletions described herein.
- a polypeptide having a deletion denoted as Aa-b is one whose amino acid residues of positions a- b inclusive are deleted, while a first fragment of amino acid residues 1 to (a-1 ) and a second fragment of amino acid residues (b+1 ) to the C-terminus are joined together by a peptide bond via an optional linker.
- the polypeptide has a length of at least 500 aa, preferably up to 600, 700, 800, 900, 1000, 1 100, 1200, 1300, or 1360 aa.
- 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, or 14 of the deletions ⁇ ( ⁇ 775-909), ARuvCIII-b ( ⁇ 1002-1074), AREC1 -a ( ⁇ 510-655), AREC1 -b ( ⁇ 525- 587), AREC1 -C ( ⁇ 662-710), AREC2 ( ⁇ 180-308), AREC2-a ( ⁇ 212-244), AREC2-b ( ⁇ 244-276), AREC2-C ( ⁇ 276-308), AREC2-d ( ⁇ 199-283), AREC2-e ( ⁇ 198-257), AREC2-f ( ⁇ 235-286), AREC2-g ( ⁇ 217-266), and AREC3 ( ⁇ 498-712) are present in the polypeptide described herein, meaning that any one or more of the deletions described herein may be present in the polypeptide individually or in different combinations.
- the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ⁇ ( ⁇ 510-655 ⁇ 775-909), AREC1 -C ⁇ ( ⁇ 662-710 ⁇ 775-909), AREC2 ⁇ ( ⁇ 180-308 ⁇ 775-909), AREC2-d ⁇ ( ⁇ 199-283 ⁇ 775- 909), ⁇ ARuvCIII-b ( ⁇ 775-909 ⁇ 1002-1074), AREC3 ⁇ ( ⁇ 498-712 ⁇ 775-909), AREC3 ⁇ ARuvCIII-b ( ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), AREC2 AREC3 ⁇ ARuvCIII-b ( ⁇ 180- 308 ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), and AREC2 ⁇ ARuvCIII-b ( ⁇ 180-308 ⁇ 775-909 ⁇ 1002-1074).
- the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof.
- These mutations are intended to introduce positively charged amino acids (lysine or arginine) to enhance the binding between the polypeptide and the target DNA.
- the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1-c ⁇ G12R, AREC1-c ⁇ T13K, AREC1-c ⁇ T13R, AREC1-C ⁇ N14K, AREC1-C ⁇ N497K, AREC1-C ⁇ T657K, AREC1- c ⁇ T657R, AREC1-C ⁇ N767K, AREC1-C ⁇ T770K, AREC1-C ⁇ T770R, AREC1-C ⁇ Q920K, AREC1-C ⁇ Q920R, AREC1-C ⁇ S1109R, AREC1-C ⁇ D1135K, AREC1-C ⁇ D11
- the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs:14-30.
- the invention relates to a polypeptide having at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% sequence identity to Staphylococcus aureus Cas9 having the amino acid sequence set forth in SEQ ID NO:2, Neiserria meningitides Cas9 having the amino acid sequence set forth in SEQ ID NO:3, Acidaminococcus sp.
- the equivalent or corresponding counterpart residues between the two amino acid sequences are determined, typically based on the sequence or structural homology between the sequences.
- the amino acid sequence of the Streptococcus pyogenes Cas9 is directly compared to the sequence of a second nuclease. After aligning the sequences, using one or more of the homology alignment programs well known in the art, such as CLUSTALW (for example using conserved residues between species), allowing for necessary insertions and deletions in order to maintain alignment (i. e.
- the residues equivalent or corresponding to particular amino acid residues in the primary sequence of the Streptococcus pyogenes Cas9 are defined. Alignment of conserved residues preferably should conserve at least 20%, preferably at least 30%, preferably at least 40%, preferably at least 50%, preferably at least 60%, preferably at least 70%, preferably at least 80%, preferably at least 90%, preferably at least 95%, more preferably at least 96%, even more preferably at least 98%, even more preferably at least 99% and most preferably 100% of residues.
- Equivalent or corresponding counterpart residues may also be defined by determining structural homology between the nucleases, that is at the level of tertiary structure for the nucleases or certain domains thereof whose structures have been determined.
- equivalent or corresponding residues are defined as those, for which the atomic coordinates of two or more of the mainchain atoms of a particular amino acid residue of the Streptococcus pyogenes Cas9 (N on N, CA on CA, C on C and O on O) are within 0.13 nm and preferably 0.1 nm after alignment. Alignment is achieved after the best model has been oriented and positioned to give the maximum overlap of atomic coordinates of non-hydrogen protein atoms of the proteins.
- the polypeptides according to the present invention may be constructed into any other CRISPR-Cas nuclease which has a significant sequence or structural homology with the Streptococcus pyogenes Cas9.
- the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ⁇ ( ⁇ 510-655 ⁇ 775-909), AREC1 -C ⁇ ( ⁇ 662-710 ⁇ 775-909), AREC2 ⁇ ( ⁇ 180-308 ⁇ 775-909), AREC2-d ⁇ ( ⁇ 199-283 ⁇ 775- 909), ⁇ ARuvCIII-b ( ⁇ 775-909 ⁇ 1002-1074), AREC3 ⁇ ( ⁇ 498-712 ⁇ 775-909), AREC3 ⁇ ARuvCIII-b ( ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), AREC2 AREC3 ⁇ ARuvCIII-b ( ⁇ 180- 308 ⁇ 498-712 ⁇ 775-909 ⁇ 1002-1074), and AREC2 ⁇ ARuvCIII-b ( ⁇ 180-308 ⁇ 775-909 ⁇ 1002-1074).
- the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 .
- the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -C ⁇ G12R, AREC1 -C ⁇ T13K, AREC1 -C ⁇ T13R, AREC1 -c ⁇ N14K, AREC1 -c ⁇ N497K, AREC1 -c ⁇ T657K, AREC1 - c ⁇ T657R, AREC1 -C ⁇ N767K, AREC1 -C ⁇ T770K, AREC1 -C ⁇ T770R, AREC1 -C ⁇ Q920K, AREC1 -C ⁇ Q920R, AREC1 -C ⁇ S1109R, AREC1 -C ⁇ D1135K, AREC1 -C ⁇ D1135R, AREC1 -C ⁇ S1338R, AREC1 -C ⁇ T657R T13K, AREC1 -C ⁇ T657R N497
- the polypeptide according to the afore-mentioned aspects can be used as a site-directed modifying polypeptide, i.e. a CRISPR- Cas protein, and functions as an essential component of a CRISPR-Cas system in site-directed modification of a target DNA. Since smaller Cas proteins are easier to package in delivery vehicles, higher delivery efficiencies can be expected.
- CRISPR-Cas system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR-Cas system), a guide sequence (also referred to as a "spacer” in the context of an endogenous CRISPR-Cas system), or other sequences and transcripts from a CRISPR locus.
- a tracr trans-activating CRISPR
- tracr-mate sequence encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR-Cas system
- guide sequence also referred to as a "
- one or more elements of a CRISPR-Cas system is derived from a type I, type II, or type III CRISPR-Cas system.
- one or more elements of a CRISPR- Cas system are derived from an organism comprising an endogenous CRISPR-Cas system, such as Streptococcus pyogenes.
- a CRISPR-Cas system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR-Cas system).
- target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex.
- a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
- a target sequence is located in the nucleus or cytoplasm of a cell.
- the CRISPR-Cas system is a type II CRISPR-Cas system and the Cas enzyme is Cas9, which binds to a target genomic locus and catalyzes DNA cleavage.
- the Cas enzyme is Cas9, which binds to a target genomic locus and catalyzes DNA cleavage.
- Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences, which hybridize to guide sequences of length 17 to 24 nucleotides inclusive.
- the target locus contains a protospacer-adjacent motif (PAM), whose sequence varies according to the bacteria species where the Cas9 originates from.
- PAM protospacer-adjacent motif
- the PAM sequence is NGG/NRG, while for the Cas9 from Staphylococcus aureus, the PAM sequence is NNGRRT.
- the PAM of Cas9 follows the 17-24 nucleotides of the target sequence.
- CRISPR activity through Cas9 for site-specific DNA recognition or cleavage is defined in part by the guide sequence, the tracr sequence, and the PAM sequence. More aspects of the CRISPR-Cas system are described in Karginov and Hannon, The CRISPR-Cas system: small RNA-guided defense in bacteria and archae, Mole Cell 2010, Jan. 15; 37(1 ): 7.
- site-directed modifying polypeptide refers to a polypeptide that binds RNA and is targeted to a specific DNA sequence.
- a site-directed modifying polypeptide as described herein is targeted to a specific DNA sequence by the RNA molecule to which it is bound.
- the RNA molecule comprises a sequence that is complementary to a target sequence within the target DNA, thus targeting the bound polypeptide to a specific location within the target DNA (the target sequence).
- cleavage refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond.
- DNA cleavage can result in the production of either blunt ends or staggered ends.
- a complex comprising a DNA- targeting RNA and a site-directed modifying polypeptide is used for targeted double-stranded DNA cleavage.
- nuclease refers to an enzyme possessing catalytic activity for DNA cleavage.
- DNA- targeting RNA or “DNA-targeting RNA polynucleotide” (also referred to herein as a “guide RNA” or “gRNA”).
- a subject DNA-targeting RNA comprises two segments, a “DNA-targeting segment” and a “protein-binding segment.”
- segment it is meant a segment/section/region of a molecule, e.g., a contiguous stretch of nucleotides in an RNA.
- a segment can also mean a region/section of a complex such that a segment may comprise regions of more than one molecule.
- the protein-binding segment of a DNA-targeting RNA is one RNA molecule and the protein-binding segment therefore comprises a region of that RNA molecule.
- the protein-binding segment of a DNA-targeting RNA comprises two separate molecules that are hybridized along a region of complementarity.
- a protein-binding segment of a DNA-targeting RNA that comprises two separate molecules can comprise (i) base pairs 40-75 of a first RNA molecule that is 100 base pairs in length; and (ii) base pairs 10-25 of a second RNA molecule that is 50 base pairs in length.
- segment unless otherwise specifically defined in a particular context, is not limited to a specific number of total base pairs, is not limited to any particular number of base pairs from a given RNA molecule, is not limited to a particular number of separate molecules within a complex, and may include regions of RNA molecules that are of any total length and may or may not include regions with complementarity to other molecules.
- the DNA-targeting segment (or "DNA-targeting sequence”) comprises a nucleotide sequence that is complementary to a specific sequence within a target DNA (the complementary strand of the target DNA).
- the protein-binding segment (or "protein-binding sequence”) interacts with a site-directed modifying polypeptide.
- site-directed modifying polypeptide is a Cas9 or Cas9 related polypeptide, e.g. the polypeptide described herein
- site-specific cleavage of or recruitment of an effector domain to the target DNA occurs at locations determined by both (i) base-pairing complementarity between the DNA-targeting RNA and the target DNA; and (ii) a short motif (referred to as the protospacer adjacent motif (PAM)) in the target DNA.
- PAM protospacer adjacent motif
- the protein-binding segment of a subject DNA-targeting RNA comprises two complementary stretches of nucleotides that hybridize to one another to form a double stranded RNA duplex (dsRNA duplex).
- a subject nucleic acid e.g., a DNA-targeting RNA, a nucleic acid comprising a nucleotide sequence encoding a DNA-targeting RNA; a nucleic acid encoding a site-directed polypeptide; etc.
- a modification or sequence that provides for an additional desirable feature (e.g., modified or regulated stability; subcellular targeting; tracking, e.g., a fluorescent label; a binding site for a protein or protein complex; etc.).
- Non-limiting examples include: a 5' cap (e.g., a 7-methylguanylate cap (m7G)); a 3' polyadenylated tail (i.e., a 3' poly(A) tail); a riboswitch sequence (e.g., to allow for regulated stability and/or regulated accessibility by proteins and/or protein complexes); a stability control sequence; a sequence that forms a dsRNA duplex (i.e., a hairpin)); a modification or sequence that targets the RNA to a subcellular location (e.g., nucleus, mitochondria, chloroplasts, and the like); a modification or sequence that provides for tracking (e.g., direct conjugation to a fluorescent molecule, conjugation to a moiety that facilitates fluorescent detection, a sequence that allows for fluorescent detection, etc.); a modification or sequence that provides a binding site for proteins (e.g., proteins that act on DNA, including transcriptional activators, transcriptional repressors, DNA
- a DNA-targeting RNA comprises an additional segment at either the 5' or 3' end that provides for any of the features described above.
- a suitable third segment can comprise a 5' cap (e.g., a 7-methylguanylate cap (m7G)); a 3' polyadenylated tail (i.e., a 3' poly(A) tail); a riboswitch sequence (e.g., to allow for regulated stability and/or regulated accessibility by proteins and protein complexes); a stability control sequence; a sequence that forms a dsRNA duplex (i.e., a hairpin)); a sequence that targets the RNA to a subcellular location (e.g., nucleus, mitochondria, chloroplasts, and the like); a modification or sequence that provides for tracking (e.g., direct conjugation to a fluorescent molecule, conjugation to a moiety that facilitates fluorescent detection, a sequence that allows for fluorescent detection, etc.); a modification or sequence
- a subject DNA-targeting RNA and a subject site-directed modifying polypeptide form a complex (i.e., bind via non-covalent interactions).
- the DNA- targeting RNA provides target specificity to the complex by comprising a nucleotide sequence that is complementary to a sequence of a target DNA.
- the site-directed modifying polypeptide of the complex provides the site-specific activity.
- the site-directed modifying polypeptide is guided to a target DNA sequence (e.g. a target sequence in a chromosomal nucleic acid; a target sequence in an extrachromosomal nucleic acid, e.g.
- a subject DNA-targeting RNA comprises two separate RNA molecules (RNA polynucleotides: an "activator-RNA” and a “targeter-RNA”, see below) and is referred to herein as a “double-molecule DNA-targeting RNA” or a "two-molecule DNA-targeting RNA.”
- the subject DNA-targeting RNA is a single RNA molecule (single RNA polynucleotide) and is referred to herein as a "single-molecule DNA-targeting RNA,” a “single- guide RNA,” or an "sgRNA.”
- the term "DNA-targeting RNA” or “gRNA” is inclusive, referring both to double-molecule DNA-targeting RNAs and to single-molecule DNA-targeting RNAs (i.e., sgRNAs).
- An exemplary two-molecule DNA-targeting RNA comprises a crRNA-like (“CRISPR RNA” or “targeter-RNA” or “crRNA” or “crRNA repeat”) molecule and a corresponding tracrRNA-like (“trans-acting CRISPR RNA” or “activator-RNA” or “tracrRNA”) molecule.
- a crRNA-like molecule comprises both the DNA-targeting segment (single stranded) of the DNA- targeting RNA and a stretch ("duplex-forming segment") of nucleotides that forms one-half of the dsRNA duplex of the protein-binding segment of the DNA-targeting RNA.
- a corresponding tracrRNA-like molecule comprises a stretch of nucleotides (duplex-forming segment) that forms the other half of the dsRNA duplex of the protein-binding segment of the DNA-targeting RNA.
- a stretch of nucleotides of a crRNA-like molecule are complementary to and hybridize with a stretch of nucleotides of a tracrRNA-like molecule to form the dsRNA duplex of the protein-binding domain of the DNA-targeting RNA.
- each crRNA-like molecule can be said to have a corresponding tracrRNA-like molecule.
- the crRNA- like molecule additionally provides the single stranded DNA-targeting segment.
- a crRNA- like and a tracrRNA-like molecule hybridize to form a DNA-targeting RNA.
- the exact sequence of a given crRNA or tracrRNA molecule is characteristic of the species in which the RNA molecules are found.
- a subject double-molecule DNA-targeting RNA can comprise any corresponding crRNA and tracrRNA pair.
- a subject double-molecule DNA- targeting RNA can comprise any corresponding crRNA and tracrRNA pair.
- activator-RNA is used herein to mean a tracrRNA-like molecule of a double-molecule DNA-targeting RNA.
- targeter-RNA is used herein to mean a crRNA-like molecule of a double-molecule DNA-targeting RNA.
- duplex-forming segment is used herein to mean the stretch of nucleotides of an activator-RNA or a targeter-RNA that contributes to the formation of the dsRNA duplex by hybridizing to a stretch of nucleotides of a corresponding activator-RNA or targeter-RNA molecule.
- an activator-RNA comprises a duplex- forming segment that is complementary to the duplex-forming segment of the corresponding targeter-RNA.
- an activator-RNA comprises a duplex-forming segment while a targeter- RNA comprises both a duplex-forming segment and the DNA-targeting segment of the DNA- targeting RNA. Therefore, a subject double-molecule DNA-targeting RNA can be comprised of any corresponding activator-RNA and targeter-RNA pair.
- the polypeptide of the invention may be prepared recombinantly or produced by in vitro transcription/translation.
- the polypeptide may also be prepared synthetically, preferably using a commercially available peptide synthesizer. Methods of synthetic peptide synthesis include, but are not limited to liquid-phase peptide synthesis and solid-phase peptide synthesis. Methods to produce peptides synthetically and according protocols are well-known in the art (Nilsson, B L et al. (2005) Annu Rev BiophysBiomolStruct, 34, 91 ).
- the CRISPR-Cas nuclease activity of the polypeptide can be determined by a variety of assays known in the art, for example by Surveyor cleavage assay or by deep sequencing the targeted genomic loci.
- the CRISPR-Cas DNA-binding activity of the polypeptide can be determined by a variety of assays known in the art, depending on what effector domain is fused to the polypeptide. If a transcriptional regulatory domain is fused to the polypeptide, a fluorescence reporter assay or a qRT-PCR experiment to measure the expression of endogenous genes can be performed, as described in the examples of the present application. It should be noted that proteins comprising the polypeptide described herein are also encompassed in the present application.
- the invention relates to a nucleic acid molecule comprising or consisting of a nucleic acid encoding a polypeptide described herein.
- the nucleic acid molecule is a recombinant expression vector.
- nucleic acid molecule or “nucleic acid” as used herein refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Nucleic acid molecules may have any three-dimensional structure, and may perform any function, known or unknown.
- a nucleic acid molecule may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- a "vector” is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
- a vector is capable of replication when associated with the proper control elements.
- the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g.
- vectors refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.
- viral vector wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses).
- Viral vectors also include polynucleotides carried by a virus for transfection into a host cell.
- vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- Other vectors e.g., non-episomal mammalian vectors
- certain vectors can direct the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors.”
- Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. Further discussion of vectors is provided herein.
- Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
- "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
- the vector further comprises regulatory elements for controlling expression of the polypeptide.
- regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- regulatory elements are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).
- Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
- a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage- dependent manner, which may or may not also be tissue or cell-type specific.
- a vector comprises one or more pol III promoter (e.g. 1 , 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1 , 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g.
- pol III promoters include, but are not limited to, U6 and H1 promoters.
- pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41 :521 -530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the ⁇ -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1 a promoter.
- RSV Rous sarcoma virus
- CMV cytomegalovirus
- PGK phosphoglycerol kinase
- enhancer elements such as WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1 ), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit ⁇ -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31 , 1981 ). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc.
- a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
- regulatory sequences mention is made of U.S. patent application Ser. No. 10/491 ,026, the contents of which are incorporated by reference herein in their entirety.
- promoters mention is made of PCT publication WO 201 1/028929 and U.S. application Ser. No. 12/51 1 ,940, the contents of which are incorporated by reference herein in their entirety.
- Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells.
- CRISPR transcripts e.g. nucleic acid transcripts, proteins, or enzymes
- CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
- Vectors may be introduced and propagated in a prokaryote or prokaryotic cell.
- a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system).
- a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism.
- Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein.
- Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (Hi) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
- a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
- enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
- Example fusion expression vectors include pGEX (Pharmacia Biotech Inc, Smith and Johnson, 1988.
- a vector is a yeast expression vector.
- yeast Saccharomyces cerevisae examples include pYepSed (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 1 13-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
- a vector drives protein expression in insect cells using baculovirus expression vectors.
- Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31 -39).
- a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195).
- the expression vector's control functions are typically provided by one or more regulatory elements.
- commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art.
- the recombinant mammalian expression vector can direct expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
- tissue-specific regulatory elements are known in the art.
- suitable tissue-specific promoters include the albumin promoter (liver- specific; Pinkert, et al., 1987. Genes Dev. 1 : 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
- a regulatory element is operably linked to one or more elements of a CRISPR-Cas system so as to drive expression of the one or more elements of the CRISPR-Cas system.
- CRISPRs constitute a family of DNA loci that are usually specific to a particular bacterial species.
- the CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacteriol., 169:5429- 5433 [1987]; and Nakata et al., J. Bacteriol., 171 :3553-3556 [1989]), and associated genes.
- SSRs interspersed short sequence repeats
- the CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol., 36:244-246 [2000]).
- SRSRs short regularly spaced repeats
- the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra).
- the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J.
- CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomon
- polypeptides and nucleic acid molecules described above are preferably non-naturally occurring.
- the present invention provides the polypeptides and nucleic acid molecules preferably in recombinant, synthetic, isolated, and/or purified form.
- a composition comprising the polypeptide and/or the nucleic acid molecule described above.
- composition preferably also comprises other essential components of a CRISPR-Cas system, e.g. a guide RNA.
- the invention relates to a method of site-specific engineering of a target DNA, the method comprising contacting the target DNA with a CRISPR-Cas system comprising the polypeptide, nucleic acid molecule or composition described herein, and recruiting an effector domain to the target site.
- the polypeptide described herein comprises: (a) an RNA-binding portion that interacts with the DNA-targeting RNA of a CRISPR-Cas system; and (b) DNA-binding portion that interacts with the target DNA.
- It may also comprise an activity portion that exhibits nuclease activity that creates a single-stranded nick or double stranded break in the target DNA of the CRISPR-Cas system, wherein the site of the double stranded break is determined by the DNA-targeting RNA, wherein preferably the contacting occurs under conditions that are permissive for nonhomologous end joining (NHEJ) or homology-directed repair (HDR), preferably HDR, and the target DNA is cleaved and rejoined to produce a modified DNA sequence.
- NHEJ nonhomologous end joining
- HDR homology-directed repair
- the target DNA is extrachromosomal (e.g. an episomal sequence, a minicircle sequence, a mitochondrial sequence, a chloroplast sequence, etc.) or is part of a chromosome in vitro, in an isolated or cultured cell, or in a cell in an organism.
- extrachromosomal e.g. an episomal sequence, a minicircle sequence, a mitochondrial sequence, a chloroplast sequence, etc.
- the cell is selected from the group consisting of: an archaeal cell, a bacterial cell, a eukaryotic cell, a eukaryotic single-cell organism, a somatic cell, a germ cell, a stem cell, a plant cell, an algal cell, an animal cell, an invertebrate cell, a vertebrate cell, a fish cell, a frog cell, a bird cell, a mammalian cell, a pig cell, a cow cell, a goat cell, a sheep cell, a rodent cell, a rat cell, a mouse cell, a non-human primate cell, and a human cell.
- an archaeal cell a bacterial cell, a eukaryotic cell, a eukaryotic single-cell organism, a somatic cell, a germ cell, a stem cell, a plant cell, an algal cell, an animal cell, an invertebrate cell, a vertebrate cell, a fish cell,
- the organism is selected from the group consisting of: an archaea, a bacterium, a eukaryotic single-cell organism, an algae, a plant, an animal, an invertebrate, a fly, a worm, a cnidarian, a vertebrate, a fish, a frog, a bird, a mammal, an ungulate, a rodent, a rat, a mouse, and a non-human primate.
- the invention relates to use of the polypeptide, nucleic acid molecule or composition described herein in site-directed nucleic acid modification, preferably as a component in a CRISPR-Cas system.
- the inventors aimed to truncate different Cas enzymes, including Cas9 from Streptococcus pyogenes, rationally guided by the solved crystal structures of these proteins (Nishimasu, H. et al. Ce// 156, 935-949 (2014); Nishimasu, H. et al. Ce// 162, 1 1 13-1 126 (2015); Yamano, T. et al. Cell 165, 949-962 (2016)). For example, disrupting protein secondary structures (a-helices and ⁇ -sheets) was avoided.
- the inventors deleted different parts of a catalytically dead Cas9 gene from Streptococcus pyogenes (dSpCas9) fused to a tripartite activator, VP64-p65-Rta (VPR) (Chavez, A. et al. Nat Methods 12, 326-328, doi:10.1038/nmeth.3312 (2015)), and then tested the ability of each truncated dSpCas9-VPR fusion to activate the expression of a zsGreen reporter that was under the control of a minimal promoter with multiple binding sites for the enzyme.
- VPR VP64-p65-Rta
- deletions that were located towards the back portion of the REC1 domain were tested instead and it was found that ⁇ 510-655 (AREC1 -a) and ⁇ 662-710 (AREC1 -c) did not affect the transcriptional activation function of dSpCas9-VPR significantly.
- ⁇ 510-655 (AREC1 -a) and ⁇ 662-710 (AREC1 -c) did not affect the transcriptional activation function of dSpCas9-VPR significantly.
- a Cas9 mutant lacking the REC2 domain retained only 50% of the DNA cleavage activity of the wildtype enzyme
- removal of the REC2 domain from dSpCas9-VPR reduced reporter gene activation by only around 20%.
- deletions of smaller fragments of the REC2 domain were more deleterious than removal of the entire domain. It was also found that removal of any segment of the PI domain abolished the activity of dSpCas9-VPR completely.
- the performance of the dCas9 scaffolds may be improved by enhancing the binding between each scaffold and the underlying DNA.
- the DNA backbone is negatively charged, the inventors sought to introduce positively charged amino acids (lysine or arginine) into the dCas9 protein. From existing crystal structures of SpCas9, the inventors selected a handful of residues that are poorly conserved and thus may not be important in the CRISPR-Cas9 system, that can accommodate a mutation to either lysine or arginine based on computational simulations, and that are sufficiently close to the targeted DNA for further testing (Figure 10). The inventors introduced the mutations individually into the ⁇ AREC1 -c construct and performed the reporter assay.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to a polypeptide comprising at least one at least one deletion selected from the group consisting of ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002-1074), AREC1-a (Δ510-655), AREC1-b (Δ525-587), AREC1-c (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212-244), AREC2-b (Δ244-276), AREC2-c (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235-286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO: 1 encoding for S. pyogenes Cas9, and wherein the polypeptide has CRISPR-Cas DNA-binding activity. The polypeptide may further comprises a missense mutations selected from G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1109R, D1135K, D1135R, S1338R and combinations thereof. Also claimed are nucleic acid molecules encoding for said polypeptides, compositions and method of site-directed engineering of a target DNA thereof.
Description
TRUNCATED CRISPR-CAS PROTEINS FOR DNA TARGETING
CROSS-REFERENCE TO RELATED APPLICATION
This application makes reference to and claims the benefit of priority of the Singapore Patent Application No. 10201608681 P filed on 17 October 2016, the content of which is incorporated herein by reference for all purposes, including an incorporation of any element or part of the description, claims or drawings not contained herein and referred to in Rule 20.5(a) of the PCT, pursuant to Rule 4.18 of the PCT. FIELD OF THE INVENTION
The present invention generally relates to engineered and optimized CRISPR-Cas proteins and their applications in the site-specific modification of a target DNA. BACKGROUND OF THE INVENTION
The ability to engineer the genome of any living organism has many biomedical and biotechnological applications, such as the correction of disease-causing mutations, construction of accurate cellular models for disease studies, or generation of agricultural crops with desirable traits. Various technologies have been developed over the past 10-20 years, including meganucleases, zinc finger nucleases, or transcription activator-like effector nucleases (TALENs). However, these technologies are either difficult to program or difficult to assemble, thereby limiting their widespread adoption. Recently, the CRISPR (clustered regularly interspaced short palindromic repeats)-Cas system has emerged as a powerful new genome engineering technology. Originally an adaptive immune system in bacteria, it has been successfully deployed for genome modification in animals and plants, including human. A key reason why CRISPR-Cas has gained so much popularity in such a short time is that the element that targets the Cas endonuclease to the correct location in the genome is simply a short piece of guide RNA, which is straightforward to design and cheap to synthesize.
The Cas enzyme performs two important and distinct functions. First, it is able to bind to specific loci in the genome with the aid of the guide RNA and a short sequence in the targeted DNA, called the protospacer adjacent motif (PAM). Cas proteins from different bacteria will recognize different PAMs in general. Various protein domains are involved in interacting with the DNA, including the REC1 , REC2, and PI domains. Second, the Cas enzyme can cleave both strands
of the DNA upon binding, thereby generating a double-stranded break. The Cas protein contains two nuclease domains, the HNH and RuvC domains, each of which cut opposite strands of the DNA. The overall domain architecture of the Cas9 enzyme from Streptococcus pyogenes is shown in Figure 1 . Since the two functions of the Cas enzyme may be separated, it is possible to utilize the CRISPR-Cas system only for the purpose of DNA targeting and not for DNA cleavage. To disable the cleavage function, the common practice is to mutate a catalytic residue in each of the two nuclease domains (D10A and H840A in SpCas9). Various laboratories have successfully fused different effector domains to the catalytically dead Cas enzyme (dCas) for a range of applications, including gene regulation, imaging, and base conversion.
Despite the tremendous potential of CRISPR-Cas for genome engineering, the system suffers from several shortcomings that restricts its use for basic biomedical research and therapeutic applications. In particular, the large size of the Cas protein affects the delivery of the CRISPR- Cas system both in vitro and even more so in vivo. For the purpose of gene therapy in vivo, adeno-associated virus (AAV) vectors are extensively used because the virus can transduce many different cell types, appears to elicit little immune response, and reliably and permanently inserts its gene into a safe genomic locus on human chromosome 19. However, the packaging limit of AAV vectors is around 4.5 kb, excluding the inverted terminal repeats, and this is close to the size of the commonly used SpCas9, which is around 4.2 kb. As a result, there is little room for customization and addition of other genetic elements. Notably, it is currently not possible to package dSpCas9 with a fused effector domain into an AAV. Hence, there is an urgent need to explore alternative strategies to utilize the CRISPR-Cas system for in vivo genome engineering.
SUMMARY OF THE INVENTION
In a first aspect, the invention relates to a polypeptide having at least 50% sequence identity to Streptococcus pyogenes Cas9 having the amino acid sequence set forth in SEQ ID NO:1 over its entire length, wherein said polypeptide comprises at least one deletion selected from the group consisting of ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002-1074), AREC1 -a (Δ510-655), AREC1 - b (Δ525-587), AREC1 -C (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212-244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235- 286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , and wherein the polypeptide has CRISPR-Cas DNA-binding activity.
In various embodiments, the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ΔΗΝΗ (Δ510-655 Δ775-909), AREC1 -c ΔΗΝΗ (Δ662-710 Δ775-909), AREC2 ΔΗΝΗ (Δ180-308 Δ775-909), AREC2-d ΔΗΝΗ (Δ199-283 Δ775- 909), ΔΗΝΗ ARuvCIII-b (Δ775-909 Δ1002-1074), AREC3 ΔΗΝΗ (Δ498-712 Δ775-909), AREC3 ΔΗΝΗ ARuvCIII-b (Δ498-712 Δ775-909 Δ1002-1074), AREC2 AREC3 ΔΗΝΗ ARuvCIII-b (Δ180- 308 Δ498-712 Δ775-909 Δ1002-1074), and AREC2 ΔΗΝΗ ARuvCIII-b (Δ180-308 Δ775-909 Δ1002-1074).
In various embodiments, the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof.
In various embodiments, the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -c ΔΗΝΗ G12R, AREC1 -c ΔΗΝΗ T13K, AREC1 -C ΔΗΝΗ T13R, AREC1 -C ΔΗΝΗ N14K, AREC1 -C ΔΗΝΗ N497K, AREC1 -C ΔΗΝΗ T657K, AREC1 - c ΔΗΝΗ T657R, AREC1 -C ΔΗΝΗ N767K, AREC1 -C ΔΗΝΗ T770K, AREC1 -C ΔΗΝΗ T770R, AREC1 -C ΔΗΝΗ Q920K, AREC1 -C ΔΗΝΗ Q920R, AREC1 -C ΔΗΝΗ S1109R, AREC1 -C ΔΗΝΗ D1135K, AREC1 -C ΔΗΝΗ D1135R, AREC1 -C ΔΗΝΗ S1338R, AREC1 -C ΔΗΝΗ T657R T13K, AREC1 -C ΔΗΝΗ T657R N497K, AREC1 -C ΔΗΝΗ T657R T770K, AREC1 -C ΔΗΝΗ T657R Q920K, AREC1 -C ΔΗΝΗ T657R S1109R, AREC1 -C ΔΗΝΗ T657R D1135K, AREC2 ΔΗΝΗ ARuvCIII-b T13K, AREC2 ΔΗΝΗ ARuvCIII-b T657K, AREC2 ΔΗΝΗ ARuvCIII-b T657R, AREC2 ΔΗΝΗ ARuvCIII-b 770K, AREC2 ΔΗΝΗ ARuvCIII-b Q920K, AREC2 ΔΗΝΗ ARuvCIII-b S1 109R, and AREC2 ΔΗΝΗ ARuvCIII-b D1 135K.
In preferred embodiments, the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs:14-30.
In various embodiments, the polypeptide is further codon optimized for expression in a eukaryotic cell, preferably in a mammalian or human cell.
In a second aspect, the invention relates to a polypeptide having at least 50% sequence identity to Staphylococcus aureus Cas9 having the amino acid sequence set forth in SEQ ID NO:2, Neiserria meningitides Cas9 having the amino acid sequence set forth in SEQ ID NO:3, Acidaminococcus sp. Cpf1 having the amino acid sequence set forth in SEQ ID NO:4, Streptococcus thermophilus Cas9 having the amino acid sequence set forth in SEQ ID NO:5,
Sutterella wadsworthensis Cas9 having the amino acid sequence set forth in SEQ ID NO:6, Filifactor alocis Cas9 having the amino acid sequence set forth in SEQ ID NO:7, Lactobacillus johnsonii Cas9 having the amino acid sequence set forth in SEQ ID NO:8, Campylobacter lari Cas9 having the amino acid sequence set forth in SEQ ID NO:9, Parvibaculum lavamentivorans Cas9 having the amino acid sequence set forth in SEQ ID NO:10, Mycoplasma gallisepticum Cas9 having the amino acid sequence set forth in SEQ ID NO:1 1 , Treponema denticola Cas9 having the amino acid sequence set forth in SEQ ID NO:12, or Lachnospiraceae bacterium ND2006 Cpf1 having the amino acid sequence set forth in SEQ ID NO:13 over its entire length, wherein said polypeptide comprises at least one deletion of said amino acid sequence, wherein said at least one deletion corresponds to at least one deletion of SEQ ID NO:1 selected from the group consisting of ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002-1074), AREC1 -a (Δ510-655), AREC1 - b (Δ525-587), AREC1 -C (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212-244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235- 286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , wherein the polypeptide has CRISPR-Cas DNA- binding activity.
In various embodiments, the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ΔΗΝΗ (Δ510-655 Δ775-909), AREC1 -C ΔΗΝΗ (Δ662-710 Δ775-909), AREC2 ΔΗΝΗ (Δ180-308 Δ775-909), AREC2-d ΔΗΝΗ (Δ199-283 Δ775- 909), ΔΗΝΗ ARuvCIII-b (Δ775-909 Δ1002-1074), AREC3 ΔΗΝΗ (Δ498-712 Δ775-909), AREC3 ΔΗΝΗ ARuvCIII-b (Δ498-712 Δ775-909 Δ1002-1074), AREC2 AREC3 ΔΗΝΗ ARuvCIII-b (Δ180- 308 Δ498-712 Δ775-909 Δ1002-1074), and AREC2 ΔΗΝΗ ARuvCIII-b (Δ180-308 Δ775-909 Δ1002-1074). In various embodiments, the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 . In various embodiments, the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -c ΔΗΝΗ G12R, AREC1 -c ΔΗΝΗ T13K, AREC1 -C ΔΗΝΗ T13R, AREC1 -c ΔΗΝΗ N14K, AREC1 -c ΔΗΝΗ N497K, AREC1 -c ΔΗΝΗ T657K, AREC1 - c ΔΗΝΗ T657R, AREC1 -C ΔΗΝΗ N767K, AREC1 -C ΔΗΝΗ T770K, AREC1 -C ΔΗΝΗ T770R, AREC1 -C ΔΗΝΗ Q920K, AREC1 -C ΔΗΝΗ Q920R, AREC1 -C ΔΗΝΗ S1109R, AREC1 -C ΔΗΝΗ D1 135K, AREC1 -C ΔΗΝΗ D1135R, AREC1 -C ΔΗΝΗ S1338R, AREC1 -C ΔΗΝΗ T657R T13K, AREC1 -C ΔΗΝΗ T657R N497K, AREC1 -C ΔΗΝΗ T657R T770K, AREC1 -C ΔΗΝΗ T657R
Q920K, AREC1 -C ΔΗΝΗ T657R S1109R, AREC1 -C ΔΗΝΗ T657R D1135K, AREC2 ΔΗΝΗ ARuvCIII-b T13K, AREC2 ΔΗΝΗ ARuvCIII-b T657K, AREC2 ΔΗΝΗ ARuvCIII-b T657R, AREC2 ΔΗΝΗ ARuvCIII-b 770K, AREC2 ΔΗΝΗ ARuvCIII-b Q920K, AREC2 ΔΗΝΗ ARuvCIII-b S1 109R, and AREC2 ΔΗΝΗ ARuvCIII-b D1 135K. In various embodiments, the polypeptide is further codon optimized for expression in a eukaryotic cell, preferably in a mammalian or human cell, by any techniques known in the art.
In a third aspect, the invention relates to a nucleic acid molecule comprising or consisting of a nucleic acid encoding a polypeptide described herein.
In various embodiments, the nucleic acid molecule is a recombinant expression vector.
In various embodiments, the vector further comprises at least one regulatory element for controlling expression of the polypeptide.
In a fourth aspect, the invention relates to a composition comprising the polypeptide or nucleic acid molecule described herein.
In a fifth aspect, the invention relates to a method of site-specific engineering of a target DNA, the method comprising contacting the target DNA with a CRISPR-Cas system comprising the polypeptide, nucleic acid molecule or composition described herein, wherein the CRISPR-Cas DNA-binding activity of the polypeptide recruits an effector domain to the target DNA. The effector domain includes but is not limited to transcriptional regulatory domains, histone- modifying domains, chromatin remodelers, fluorescent proteins, and deaminases.
In various embodiments, the target DNA is extrachromosomal or is part of a chromosome in vitro, in vivo, or in a cell.
In various embodiments, the CRISPR-Cas nuclease activity of the polypeptide introduces a single-stranded nick or double stranded break in the target DNA.
In a sixth aspect, the invention relates to use of the polypeptide, nucleic acid molecule or composition described herein in site-directed nucleic acid modification, preferably as a component in a CRISPR-Cas system.
BRIEF DESCRIPTION OF THE DRAWINGS
The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings. Figure 1 shows the schematic illustration of the different domains of Streptococcus pyogenes Cas9 (SpCas9).
Figure 2 shows the schematic illustration of ARuvCIII, ARuvCIII-a, and ARuvCIII-b. Figure 3 shows the schematic illustration of AREC1 -a, AREC1 -b, AREC1 -c, and AREC3.
Figure 4 shows the schematic illustration of AREC2, AREC2-a, AREC2-b, AREC2-C, AREC2-d, AREC2-e, AREC-f, and AREC2-g. Figure 5 shows the schematic illustration of ΔΡΙ-a, ΔΡΙ-b, ΔΡΙ-c, ΔΡΙ-d, ΔΡΙ-e, and ΔΡΙ-f.
Figure 6 shows the results of reporter assays of 41 different truncated constructs, with deletions in various parts of the REC or NUC lobe, (a) A minimal promoter containing two binding sites for a dSpCas9-VPR activator was used and the cells were analysed 24 hours after transfection. (b) A minimal promoter containing two binding sites was used and the cells were analysed 48 hours after transfection. (c) A minimal promoter containing three binding sites was used and the cells were analysed 24 hours after transfection.
Figure 7 shows a boxplot that summarizes the results of reporter assays of different truncated constructs. 2x indicates that a fluorescence reporter with two binding sites for the dCas9-VPR enzyme was used, while 3x indicates that a fluorescence reporter with three binding sites was used. 24hr and 48hr indicates the time after transfection when the assays were performed.
Figure 8 shows the results of quantitative real-time PCR (qRT-PCR) experiments to measure the expression levels of (a) ACTC, (b) ASCL1 , (c) MIAT, and (d) TTN in HEK293 cells, when the cells were transfected with different truncated constructs and a relevant guide RNA targeting the endogenous gene-of-interest. In these experiments, the cells were harvested 48 hours after transfection. Figure 9 shows the results of experiments evaluating the effect of deleting the REC3 domain, either by itself or in combination with other domains, (a) Reporter assays of various REC3 truncations in comparison with the original full-length protein (WT) and three other truncations
(ΔΗΝΗ, ARuvCIII-b ΔΗΝΗ, and AREC1 -c) that we had found to perform similarly to wildtype. (b) Expression levels of either MIAT or TTN in HEK293 cells measured by qRT-PCR, when the cells were transfected with different REC3 truncated constructs and a corresponding gRNA targeting the gene-of-interest. Figure 10 shows a ribbon diagram of dSpCas9 bound to a gRNA and a target DNA. The residues that are within 5A of the DNA are represented as sticks.
Figure 1 1 shows the reporter assays of constructs, each of which has 1 mutation introduced into deletions of HNH and REC1 -c ("2ple").
Figure 12 shows the reporter assays of constructs, each of which has 2 different mutations introduced into deletions of HNH and REC1 -C ("2ple").
Figure 13 shows the reporter assays of constructs, each of which has 1 mutation introduced into HNH, REC2, and RuvCIII-b ("3ple").
DETAILED DESCRIPTION OF THE INVENTION
The following detailed description refers to, by way of illustration, specific details and embodiments in which the invention may be practiced. These embodiments are described in sufficient detail to enable those skilled in the art to practice the invention. Other embodiments may be utilized and structural, and logical changes may be made without departing from the scope of the invention. The various embodiments are not necessarily mutually exclusive, as some embodiments can be combined with one or more other embodiments to form new embodiments.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. The singular terms "a," "an," and "the" include plural referents unless context clearly indicates otherwise. Similarly, the word "or" is intended to include "and" unless the context clearly indicates otherwise. The term "comprises" means "includes." In case of conflict, the present specification, including explanations of terms, will control.
In a first aspect, the invention relates to a polypeptide having at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5%
sequence identity to Streptococcus pyogenes Cas9 having the amino acid sequence set forth in SEQ ID NO:1 over its entire length, wherein said polypeptide comprises at least one deletion selected from the group consisting of ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002-1074), AREC1 -a (Δ510-655), AREC1 -b (Δ525-587), AREC1 -C (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212- 244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235-286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , and wherein the polypeptide has CRISPR-Cas DNA-binding activity.
The term "polypeptide" is used interchangeably herein with "peptide" and "protein", and refers to polymers of at least two amino acids connected by peptide bonds. The polymer may comprise amino acid analogues or modified amino acids, it may be linear or branched, and it may be interrupted by non-amino acids. The term also encompasses an amino acid polymer that has been modified naturally or artificially; for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation to a labeling moiety. However, in preferred embodiments, this term relates to polymers of naturally occurring amino acids, as defined below, which may optionally be modified as defined above, but does not comprise non-amino acid moieties in the polymer backbone.
The term "amino acid" as used herein refers to natural and/or unnatural or synthetic amino acids, including both the D and L optical isomers, amino acid analogs (for example norleucine is an analog of leucine) and derivatives known in the art. The term "naturally occurring amino acid", as used herein, relates to the 20 naturally occurring L-amino acids, namely Gly (G), Ala (A), Val (V), Leu (L), lie (I), Phe (F), Cys (C), Met (M), Pro (P), Thr (T), Ser (S), Glu (E), Gin (Q), Asp (D), Asn (N), His (H), Lys (K), Arg (R), Tyr (Y), and Trp (W). Generally, in the context of the present application, the peptides and polypeptides are shown in the N- to C-terminal orientation.
The term "sequence identity" as used herein refers to the relatedness between two amino acid sequences or between two nucleotide sequences. For purposes of the present invention, the sequence identity between two amino acid sequences is determined using the Needleman- Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice er a/., 2000, Trends Genet. 16: 276-277), preferably version 5.0.0 or later. The parameters used are gap open penalty of 10, gap extension penalty of 0.5, and the EBLOSUM62 (EMBOSS version of BLOSUM62) substitution matrix. The output of Needle labeled "longest identity" (obtained using the -nobrief option) is used as the percent identity and is calculated as follows:(ldentical Residues x 100)/(Length of Alignment - Total Number of Gaps
in Alignment).
The term "deletion" as used herein refers to a removal of a portion of one or more amino acid residues from the amino acid sequence of the reference polypeptide. In the context of the present application, the polypeptide is truncated compared to the reference amino acid sequence in that it comprises one or more deletions described herein. A polypeptide having a deletion denoted as Aa-b is one whose amino acid residues of positions a- b inclusive are deleted, while a first fragment of amino acid residues 1 to (a-1 ) and a second fragment of amino acid residues (b+1 ) to the C-terminus are joined together by a peptide bond via an optional linker. The polypeptide has a length of at least 500 aa, preferably up to 600, 700, 800, 900, 1000, 1 100, 1200, 1300, or 1360 aa.
In the context of the present application, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, or 14 of the deletions ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002-1074), AREC1 -a (Δ510-655), AREC1 -b (Δ525- 587), AREC1 -C (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212-244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235-286), AREC2-g (Δ217-266), and AREC3 (Δ498-712) are present in the polypeptide described herein, meaning that any one or more of the deletions described herein may be present in the polypeptide individually or in different combinations.
In various embodiments, the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ΔΗΝΗ (Δ510-655 Δ775-909), AREC1 -C ΔΗΝΗ (Δ662-710 Δ775-909), AREC2 ΔΗΝΗ (Δ180-308 Δ775-909), AREC2-d ΔΗΝΗ (Δ199-283 Δ775- 909), ΔΗΝΗ ARuvCIII-b (Δ775-909 Δ1002-1074), AREC3 ΔΗΝΗ (Δ498-712 Δ775-909), AREC3 ΔΗΝΗ ARuvCIII-b (Δ498-712 Δ775-909 Δ1002-1074), AREC2 AREC3 ΔΗΝΗ ARuvCIII-b (Δ180- 308 Δ498-712 Δ775-909 Δ1002-1074), and AREC2 ΔΗΝΗ ARuvCIII-b (Δ180-308 Δ775-909 Δ1002-1074).
In various embodiments, the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof. These mutations are intended to introduce positively charged amino acids (lysine or arginine) to enhance the binding between the polypeptide and the target DNA. They were selected based on their location in poorly conserved regions of Streptococcus pyogenes Cas9, which are unlikely to be important residues for the nuclease, as well as their proximity to the target DNA as revealed by computational simulations.
In various embodiments, the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1-c ΔΗΝΗ G12R, AREC1-c ΔΗΝΗ T13K, AREC1-c ΔΗΝΗ T13R, AREC1-C ΔΗΝΗ N14K, AREC1-C ΔΗΝΗ N497K, AREC1-C ΔΗΝΗ T657K, AREC1- c ΔΗΝΗ T657R, AREC1-C ΔΗΝΗ N767K, AREC1-C ΔΗΝΗ T770K, AREC1-C ΔΗΝΗ T770R, AREC1-C ΔΗΝΗ Q920K, AREC1-C ΔΗΝΗ Q920R, AREC1-C ΔΗΝΗ S1109R, AREC1-C ΔΗΝΗ D1135K, AREC1-C ΔΗΝΗ D1135R, AREC1-C ΔΗΝΗ S1338R, AREC1-C ΔΗΝΗ T657R T13K, AREC1-C ΔΗΝΗ T657R N497K, AREC1-C ΔΗΝΗ T657R T770K, AREC1-C ΔΗΝΗ T657R Q920K, AREC1-C ΔΗΝΗ T657R S1109R, AREC1-C ΔΗΝΗ T657R D1135K, AREC2 ΔΗΝΗ ARuvCIII-b T13K, AREC2 ΔΗΝΗ ARuvCIII-b T657K, AREC2 ΔΗΝΗ ARuvCIII-b T657R, AREC2 ΔΗΝΗ ARuvCIII-b 770K, AREC2 ΔΗΝΗ ARuvCIII-b Q920K, AREC2 ΔΗΝΗ ARuvCIII-b S1109R, and AREC2 ΔΗΝΗ ARuvCIII-b D1135K.
In preferred embodiments, the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs:14-30.
Table 1. Preferred polypeptides (catalytically dead) in accordance with the first aspect of the invention.
It is to be understood that the various polypeptides having at least one of the aforementioned deletions and/or mutations, even if their amino acid sequences are not explicitly described herein for the sake of conciseness, are contemplated to be within the scope of the present invention.
In a second aspect, the invention relates to a polypeptide having at least 50%, 51 %, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% sequence identity to Staphylococcus aureus Cas9 having the amino acid sequence set forth in SEQ ID NO:2, Neiserria meningitides Cas9 having the amino acid sequence set forth in SEQ ID NO:3, Acidaminococcus sp. Cpf1 having the amino acid sequence set forth in SEQ ID NO:4, Streptococcus thermophilus Cas9 having the amino acid sequence set forth in SEQ ID NO:5,
Sutterella wadsworthensis Cas9 having the amino acid sequence set forth in SEQ ID NO:6, Filifactor alocis Cas9 having the amino acid sequence set forth in SEQ ID NO:7, Lactobacillus johnsonii Cas9 having the amino acid sequence set forth in SEQ ID NO:8, Campylobacter lari Cas9 having the amino acid sequence set forth in SEQ ID NO:9, Parvibaculum lavamentivorans Cas9 having the amino acid sequence set forth in SEQ ID NO:10, Mycoplasma gallisepticum Cas9 having the amino acid sequence set forth in SEQ ID NO:1 1 , Treponema denticola Cas9 having the amino acid sequence set forth in SEQ ID NO:12, or Lachnospiraceae bacterium ND2006 Cpf1 having the amino acid sequence set forth in SEQ ID NO:13 over its entire length, wherein said polypeptide comprises at least one truncation of said amino acid sequence, wherein said at least one truncation corresponds to at least one truncation of SEQ ID NO:1 selected from the group consisting of ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002-1074), AREC1 -a (Δ510-655), AREC1 -b (Δ525-587), AREC1 -C (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212- 244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235-286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , wherein the polypeptide has CRISPR-Cas DNA-binding activity.
Table 2. Cas proteins of different organisms
Acida U2UMQ MTQFEGFTNLYQVSKTLRFELIPQGKTLKHIQEQGFIEEDKARNDHYKELKPIIDRIYKT minoc 6 YADQCLQLVQLDWENLSAAIDSYRKEKTEETRNALIEEQATYRNAIHDYFIGRTDNLTDA occus INKRHAEIYKGLFKAELFNGKVLKQLGTVTTTEHENALLRSFDKFTTYFSGFYENRKNVF sp. SAEDISTAIPHRIVQDNFPKFKENCHIFTRLITAVPSLREHFENVKKAIGIFVSTSIEEV
Cpf1 FSFPFYNQLLTQTQIDLYNQLLGGISREAGTEKIKGLNEVLNLAIQKNDETAHIIASLPH
RFIPLFKQILSDRNTLSFILEEFKSDEEVIQSFCKYKTLLRNENVLETAEALFNELNSID
LTHIFISHKKLETISSALCDHWDTLRNALYERRISELTGKITKSAKEKVQRSLKHEDINL
QEIISAAGKELSEAFKQKTSEILSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYHL
LDWFAVDESNEVDPEFSARLTGIKLEMEPSLSFYNKARNYATKKPYSVEKFKLNFQMPTL
ASGWDVNKEKNNGAILFVKNGLYYLGIMPKQKGRYKALSFEPTEKTSEGFDKMYYDYFP
D
AAKMIPKCSTQLKAVTAHFQTHTTPILLSNNFIEPLEITKEIYDLNNPEKEPKKFQTAYA
KKTGDQKGYREALCKWIDFTRDFLSKYTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLYH
ISFQRIAEKEIMDAVETGKLYLFQIYNKDFAKGHHGKPNLHTLYWTGLFSPENLAKTSIK
LNGQAELFYRPKSRMKRMAHRLGEKMLNKKLKDQKTPIPDTLYQELYDYVNHRLSHDLS
D
EARALLPNVITKEVSHEIIKDRRFTSDKFFFHVPITLNYQAANSPSKFNQRVNAYLKEHP
ETPIIGIDRGERNLIYITVIDSTGKILEQRSLNTIQQFDYQKKLDNREKERVAARQAWSV
VGTIKDLKQGYLSQVIHEIVDLMIHYQAVWLENLNFGFKSKRTGIAEKAVYQQFEKMLI
DKLNCLVLKDYPAEKVGGVLNPYQLTDQFTSFAKMGTQSGFLFYVPAPYTSKIDPLTGFV
DPFVWKTIKNHESRKHFLEGFDFLHYDVKTGDFILHFKMNRNLSFQRGLPGFMPAWDIVF
EKNETQFDAKGTPFIAGKRIVPVIENHRFTGRYRDLYPANELIALLEEKGIVFRDGSNIL
PKLLENDDSHAIDTMVALIRSVLQMRNSNAATGEDYINSPVRDLNGVCFDSRFQNPEWP
M
DADANGAYHIALKGQLLLNHLKESKDLKLQNGISNQDWLAYIQELRN
Strept G3ECR MLFNKCIIISINLDFSNKEKCMTKPYSIGLDIGTNSVGWAVITDNYKVPSKKMKVLGNTS ococc 1 KKYIKKNLLGVLLFDSGITAEGRRLKRTARRRYTRRRNRILYLQEIFSTEMATLDDAFFQ us RLDDSFLVPDDKRDSKYPIFGNLVEEKVYHDEFPTIYHLRKYLADSTKKADLRLVYLALA thermo HMIKYRGHFLIEGEFNSKNNDIQKNFQDFLDTYNAIFESDLSLENSKQLEEIVKDKISKL philus EKKDRILKLFPGEKNSGIFSEFLKLIVGNQADFRKCFNLDEKASLHFSKESYDEDLETLL
RNISLKTYNEVFKDDTKNGYAGYIDGKTNQEDFYVYLKNLLAEFEGADYFLEKIDREDFL
RKQRTFDNGSIPYQIHLQEMRAILDKQAKFYPFLAKNKERIEKILTFRIPYYVGPLARGN
SDFAWSIRKRNEKITPWNFEDVIDKESSAEAFINRMTSFDLYLPEEKVLPKHSLLYETFN
VYNELTKVRFIAESMRDYQFLDSKQKKDIVRLYFKDKRKVTDKDIIEYLHAIYGYDGIEL
KGIEKQFNSSLSTYHDLLNIINDKEFLDDSSNEAIIEEIIHTLTIFEDREMIKQRLSKFE
NIFDKSVLKKLSRRHYTGWGKLSAKLINGIRDEKSGNTILDYLIDDGISNRNFMQLIHDD
ALSFKKKIQKAQIIGDEDKGNIKEWKSLPGSPAIKKGILQSIKIVDELVKVMGGRKPES
IWEMARENQYTNQGKSNSQQRLKRLEKSLKELGSKILKENIPAKLSKIDNNALQNDRLY
LYYLQNGKDMYTGDDLDIDRLSNYDIDHIIPQAFLKDNSIDNKVLVSSASNRGKSDDFPS
LEWKKRKTFWYQLLKSKLISQRKFDNLTKAERGGLLPEDKAGFIQRQLVETRQITKHVA
RLLDEKFNNKKDENNRAVRTVKIITLKSTLVSQFRKDFELYKVREINDFHHAHDAYLNAV
IASALLKKYPKLEPEFVYGDYPKYNSFRERKSATEKVYFYSNIMNIFKKSISLADGRVIE
RPLIEVNEETGESVWNKESDLATVRRVLSYPQVNWKKVEEQNHGLDRGKPKGLFNANL
S
SKPKPNSNENLVGAKEYLDPKKYGGYAGISNSFAVLVKGTIEKGAKKKITNVLEFQGISI LDRINYRKDKLNFLLEKGYKDIELIIELPKYSLFELSDGSRRMLASILSTNNKRGEIHKG
It should be noted that all the amino acid modifications described herein were derived In the context of the amino acid sequence of Streptococcus pyogenes Cas9 (SEQ ID NO:1 ) through extensive experimentation. However, one skilled in the art would readily appreciate that these modifications are transferrable to other CRISPR-Cas nucleases, which share significant homology with the Streptococcus pyogenes Cas9.
To determine whether these modifications could be transferred to another nuclease, the equivalent or corresponding counterpart residues between the two amino acid sequences are determined, typically based on the sequence or structural homology between the sequences. To establish homology, the amino acid sequence of the Streptococcus pyogenes Cas9 is directly compared to the sequence of a second nuclease. After aligning the sequences, using one or more of the homology alignment programs well known in the art, such as CLUSTALW (for example using conserved residues between species), allowing for necessary insertions and deletions in order to maintain alignment (i. e. avoiding the elimination of conserved residues through arbitrary deletion and insertion), the residues equivalent or corresponding to particular amino acid residues in the primary sequence of the Streptococcus pyogenes Cas9 are defined. Alignment of conserved residues preferably should conserve at least 20%, preferably at least 30%, preferably at least 40%, preferably at least 50%, preferably at least 60%, preferably at least 70%, preferably at least 80%, preferably at least 90%, preferably at least 95%, more preferably at least 96%, even more preferably at least 98%, even more preferably at least 99% and most preferably 100% of residues. Equivalent or corresponding counterpart residues may also be defined by determining structural homology between the nucleases, that is at the level of tertiary structure for the nucleases or certain domains thereof whose structures have been determined. In this case, equivalent or corresponding residues are defined as those, for which the atomic coordinates of two or more of the mainchain atoms of a particular amino acid residue of the Streptococcus pyogenes Cas9 (N on N, CA on CA, C on C and O on O) are within 0.13 nm and preferably 0.1 nm after alignment. Alignment is achieved after the best model has been oriented and positioned to give the maximum overlap of atomic coordinates of non-hydrogen protein atoms of the proteins. Regardless of how equivalent or corresponding residues are determined, and regardless of the identity of the Streptococcus pyogenes Cas9 in which the modifications are introduced, what is meant to be conveyed is that the polypeptides according to
the present invention may be constructed into any other CRISPR-Cas nuclease which has a significant sequence or structural homology with the Streptococcus pyogenes Cas9.
In various embodiments, the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ΔΗΝΗ (Δ510-655 Δ775-909), AREC1 -C ΔΗΝΗ (Δ662-710 Δ775-909), AREC2 ΔΗΝΗ (Δ180-308 Δ775-909), AREC2-d ΔΗΝΗ (Δ199-283 Δ775- 909), ΔΗΝΗ ARuvCIII-b (Δ775-909 Δ1002-1074), AREC3 ΔΗΝΗ (Δ498-712 Δ775-909), AREC3 ΔΗΝΗ ARuvCIII-b (Δ498-712 Δ775-909 Δ1002-1074), AREC2 AREC3 ΔΗΝΗ ARuvCIII-b (Δ180- 308 Δ498-712 Δ775-909 Δ1002-1074), and AREC2 ΔΗΝΗ ARuvCIII-b (Δ180-308 Δ775-909 Δ1002-1074).
In various embodiments, the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 .
In various embodiments, the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -C ΔΗΝΗ G12R, AREC1 -C ΔΗΝΗ T13K, AREC1 -C ΔΗΝΗ T13R, AREC1 -c ΔΗΝΗ N14K, AREC1 -c ΔΗΝΗ N497K, AREC1 -c ΔΗΝΗ T657K, AREC1 - c ΔΗΝΗ T657R, AREC1 -C ΔΗΝΗ N767K, AREC1 -C ΔΗΝΗ T770K, AREC1 -C ΔΗΝΗ T770R, AREC1 -C ΔΗΝΗ Q920K, AREC1 -C ΔΗΝΗ Q920R, AREC1 -C ΔΗΝΗ S1109R, AREC1 -C ΔΗΝΗ D1135K, AREC1 -C ΔΗΝΗ D1135R, AREC1 -C ΔΗΝΗ S1338R, AREC1 -C ΔΗΝΗ T657R T13K, AREC1 -C ΔΗΝΗ T657R N497K, AREC1 -C ΔΗΝΗ T657R T770K, AREC1 -C ΔΗΝΗ T657R Q920K, AREC1 -C ΔΗΝΗ T657R S1109R, AREC1 -C ΔΗΝΗ T657R D1135K, AREC2 ΔΗΝΗ ARuvCIII-b T13K, AREC2 ΔΗΝΗ ARuvCIII-b T657K, AREC2 ΔΗΝΗ ARuvCIII-b T657R, AREC2 ΔΗΝΗ ARuvCIII-b 770K, AREC2 ΔΗΝΗ ARuvCIII-b Q920K, AREC2 ΔΗΝΗ ARuvCIII-b S1 109R, and AREC2 ΔΗΝΗ ARuvCIII-b D1 135K.
Without wishing to be bound to any theory, it is believed that the polypeptide according to the afore-mentioned aspects can be used as a site-directed modifying polypeptide, i.e. a CRISPR- Cas protein, and functions as an essential component of a CRISPR-Cas system in site-directed modification of a target DNA. Since smaller Cas proteins are easier to package in delivery vehicles, higher delivery efficiencies can be expected.
In general, "CRISPR-Cas system" refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated ("Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or
an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat" and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR-Cas system), a guide sequence (also referred to as a "spacer" in the context of an endogenous CRISPR-Cas system), or other sequences and transcripts from a CRISPR locus. In some embodiments, one or more elements of a CRISPR-Cas system is derived from a type I, type II, or type III CRISPR-Cas system. In some embodiments, one or more elements of a CRISPR- Cas system are derived from an organism comprising an endogenous CRISPR-Cas system, such as Streptococcus pyogenes. In general, a CRISPR-Cas system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR-Cas system). In the context of formation of a CRISPR complex, "target sequence" refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.
In preferred embodiments of the invention, the CRISPR-Cas system is a type II CRISPR-Cas system and the Cas enzyme is Cas9, which binds to a target genomic locus and catalyzes DNA cleavage. Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences, which hybridize to guide sequences of length 17 to 24 nucleotides inclusive. The target locus contains a protospacer-adjacent motif (PAM), whose sequence varies according to the bacteria species where the Cas9 originates from. For the Cas9 from Streptococcus pyogenes, the PAM sequence is NGG/NRG, while for the Cas9 from Staphylococcus aureus, the PAM sequence is NNGRRT. The PAM of Cas9 follows the 17-24 nucleotides of the target sequence. CRISPR activity through Cas9 for site-specific DNA recognition or cleavage is defined in part by the guide sequence, the tracr sequence, and the PAM sequence. More aspects of the CRISPR-Cas system are described in Karginov and Hannon, The CRISPR-Cas system: small RNA-guided defense in bacteria and archae, Mole Cell 2010, Jan. 15; 37(1 ): 7. The term "site-directed modifying polypeptide" as used herein refers to a polypeptide that binds RNA and is targeted to a specific DNA sequence. A site-directed modifying polypeptide as described herein is targeted to a specific DNA sequence by the RNA molecule to which it is bound. The RNA molecule comprises a sequence that is complementary to a target sequence within the target DNA, thus targeting the bound polypeptide to a specific location within the target DNA (the target sequence).
The term "cleavage" as used herein refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events. DNA cleavage can result in the production of either blunt ends or staggered ends. In certain embodiments, a complex comprising a DNA- targeting RNA and a site-directed modifying polypeptide is used for targeted double-stranded DNA cleavage.
The term "nuclease" as used herein refers to an enzyme possessing catalytic activity for DNA cleavage.
The RNA molecule that binds to the site-directed modifying polypeptide and targets the polypeptide to a specific location within the target DNA is referred to herein as the "DNA- targeting RNA" or "DNA-targeting RNA polynucleotide" (also referred to herein as a "guide RNA" or "gRNA"). A subject DNA-targeting RNA comprises two segments, a "DNA-targeting segment" and a "protein-binding segment." By "segment" it is meant a segment/section/region of a molecule, e.g., a contiguous stretch of nucleotides in an RNA. A segment can also mean a region/section of a complex such that a segment may comprise regions of more than one molecule. For example, in some cases the protein-binding segment of a DNA-targeting RNA is one RNA molecule and the protein-binding segment therefore comprises a region of that RNA molecule. In other cases, the protein-binding segment of a DNA-targeting RNA comprises two separate molecules that are hybridized along a region of complementarity. As an illustrative, non-limiting example, a protein-binding segment of a DNA-targeting RNA that comprises two separate molecules can comprise (i) base pairs 40-75 of a first RNA molecule that is 100 base pairs in length; and (ii) base pairs 10-25 of a second RNA molecule that is 50 base pairs in length. The definition of "segment," unless otherwise specifically defined in a particular context, is not limited to a specific number of total base pairs, is not limited to any particular number of base pairs from a given RNA molecule, is not limited to a particular number of separate molecules within a complex, and may include regions of RNA molecules that are of any total length and may or may not include regions with complementarity to other molecules.
The DNA-targeting segment (or "DNA-targeting sequence") comprises a nucleotide sequence that is complementary to a specific sequence within a target DNA (the complementary strand of the target DNA). The protein-binding segment (or "protein-binding sequence") interacts with a site-directed modifying polypeptide. When the site-directed modifying polypeptide is a Cas9 or Cas9 related polypeptide, e.g. the polypeptide described herein, site-specific cleavage of or recruitment of an effector domain to the target DNA occurs at locations determined by both (i)
base-pairing complementarity between the DNA-targeting RNA and the target DNA; and (ii) a short motif (referred to as the protospacer adjacent motif (PAM)) in the target DNA.
The protein-binding segment of a subject DNA-targeting RNA comprises two complementary stretches of nucleotides that hybridize to one another to form a double stranded RNA duplex (dsRNA duplex).
In some embodiments, a subject nucleic acid (e.g., a DNA-targeting RNA, a nucleic acid comprising a nucleotide sequence encoding a DNA-targeting RNA; a nucleic acid encoding a site-directed polypeptide; etc.) comprises a modification or sequence that provides for an additional desirable feature (e.g., modified or regulated stability; subcellular targeting; tracking, e.g., a fluorescent label; a binding site for a protein or protein complex; etc.). Non-limiting examples include: a 5' cap (e.g., a 7-methylguanylate cap (m7G)); a 3' polyadenylated tail (i.e., a 3' poly(A) tail); a riboswitch sequence (e.g., to allow for regulated stability and/or regulated accessibility by proteins and/or protein complexes); a stability control sequence; a sequence that forms a dsRNA duplex (i.e., a hairpin)); a modification or sequence that targets the RNA to a subcellular location (e.g., nucleus, mitochondria, chloroplasts, and the like); a modification or sequence that provides for tracking (e.g., direct conjugation to a fluorescent molecule, conjugation to a moiety that facilitates fluorescent detection, a sequence that allows for fluorescent detection, etc.); a modification or sequence that provides a binding site for proteins (e.g., proteins that act on DNA, including transcriptional activators, transcriptional repressors, DNA methyltransferases, DNA demethylases, histone acetyltransferases, histone deacetylases, and the like); and combinations thereof.
In some embodiments, a DNA-targeting RNA comprises an additional segment at either the 5' or 3' end that provides for any of the features described above. For example, a suitable third segment can comprise a 5' cap (e.g., a 7-methylguanylate cap (m7G)); a 3' polyadenylated tail (i.e., a 3' poly(A) tail); a riboswitch sequence (e.g., to allow for regulated stability and/or regulated accessibility by proteins and protein complexes); a stability control sequence; a sequence that forms a dsRNA duplex (i.e., a hairpin)); a sequence that targets the RNA to a subcellular location (e.g., nucleus, mitochondria, chloroplasts, and the like); a modification or sequence that provides for tracking (e.g., direct conjugation to a fluorescent molecule, conjugation to a moiety that facilitates fluorescent detection, a sequence that allows for fluorescent detection, etc.); a modification or sequence that provides a binding site for proteins (e.g., proteins that act on DNA, including transcriptional activators, transcriptional repressors, DNA methyltransferases, DNA demethylases, histone acetyltransferases, histone deacetylases, and the like); and combinations thereof.
A subject DNA-targeting RNA and a subject site-directed modifying polypeptide (i.e., site- directed polypeptide) form a complex (i.e., bind via non-covalent interactions). The DNA- targeting RNA provides target specificity to the complex by comprising a nucleotide sequence that is complementary to a sequence of a target DNA. The site-directed modifying polypeptide of the complex provides the site-specific activity. In other words, the site-directed modifying polypeptide is guided to a target DNA sequence (e.g. a target sequence in a chromosomal nucleic acid; a target sequence in an extrachromosomal nucleic acid, e.g. an episomal nucleic acid, a minicircle, etc.; a target sequence in a mitochondrial nucleic acid; a target sequence in a chloroplast nucleic acid; a target sequence in a plasmid; etc.) by virtue of its association with the protein-binding segment of the DNA-targeting RNA.
In some embodiments, a subject DNA-targeting RNA comprises two separate RNA molecules (RNA polynucleotides: an "activator-RNA" and a "targeter-RNA", see below) and is referred to herein as a "double-molecule DNA-targeting RNA" or a "two-molecule DNA-targeting RNA." In other embodiments, the subject DNA-targeting RNA is a single RNA molecule (single RNA polynucleotide) and is referred to herein as a "single-molecule DNA-targeting RNA," a "single- guide RNA," or an "sgRNA." The term "DNA-targeting RNA" or "gRNA" is inclusive, referring both to double-molecule DNA-targeting RNAs and to single-molecule DNA-targeting RNAs (i.e., sgRNAs). An exemplary two-molecule DNA-targeting RNA comprises a crRNA-like ("CRISPR RNA" or "targeter-RNA" or "crRNA" or "crRNA repeat") molecule and a corresponding tracrRNA-like ("trans-acting CRISPR RNA" or "activator-RNA" or "tracrRNA") molecule. A crRNA-like molecule (targeter-RNA) comprises both the DNA-targeting segment (single stranded) of the DNA- targeting RNA and a stretch ("duplex-forming segment") of nucleotides that forms one-half of the dsRNA duplex of the protein-binding segment of the DNA-targeting RNA. A corresponding tracrRNA-like molecule (activator-RNA) comprises a stretch of nucleotides (duplex-forming segment) that forms the other half of the dsRNA duplex of the protein-binding segment of the DNA-targeting RNA. In other words, a stretch of nucleotides of a crRNA-like molecule are complementary to and hybridize with a stretch of nucleotides of a tracrRNA-like molecule to form the dsRNA duplex of the protein-binding domain of the DNA-targeting RNA. As such, each crRNA-like molecule can be said to have a corresponding tracrRNA-like molecule. The crRNA- like molecule additionally provides the single stranded DNA-targeting segment. Thus, a crRNA- like and a tracrRNA-like molecule (as a corresponding pair) hybridize to form a DNA-targeting RNA. The exact sequence of a given crRNA or tracrRNA molecule is characteristic of the species in which the RNA molecules are found. A subject double-molecule DNA-targeting RNA can comprise any corresponding crRNA and tracrRNA pair. A subject double-molecule DNA- targeting RNA can comprise any corresponding crRNA and tracrRNA pair.
The term "activator-RNA" is used herein to mean a tracrRNA-like molecule of a double-molecule DNA-targeting RNA. The term "targeter-RNA" is used herein to mean a crRNA-like molecule of a double-molecule DNA-targeting RNA. The term "duplex-forming segment" is used herein to mean the stretch of nucleotides of an activator-RNA or a targeter-RNA that contributes to the formation of the dsRNA duplex by hybridizing to a stretch of nucleotides of a corresponding activator-RNA or targeter-RNA molecule. In other words, an activator-RNA comprises a duplex- forming segment that is complementary to the duplex-forming segment of the corresponding targeter-RNA. As such, an activator-RNA comprises a duplex-forming segment while a targeter- RNA comprises both a duplex-forming segment and the DNA-targeting segment of the DNA- targeting RNA. Therefore, a subject double-molecule DNA-targeting RNA can be comprised of any corresponding activator-RNA and targeter-RNA pair.
The polypeptide of the invention may be prepared recombinantly or produced by in vitro transcription/translation. The polypeptide may also be prepared synthetically, preferably using a commercially available peptide synthesizer. Methods of synthetic peptide synthesis include, but are not limited to liquid-phase peptide synthesis and solid-phase peptide synthesis. Methods to produce peptides synthetically and according protocols are well-known in the art (Nilsson, B L et al. (2005) Annu Rev BiophysBiomolStruct, 34, 91 ). The CRISPR-Cas nuclease activity of the polypeptide can be determined by a variety of assays known in the art, for example by Surveyor cleavage assay or by deep sequencing the targeted genomic loci.
The CRISPR-Cas DNA-binding activity of the polypeptide can be determined by a variety of assays known in the art, depending on what effector domain is fused to the polypeptide. If a transcriptional regulatory domain is fused to the polypeptide, a fluorescence reporter assay or a qRT-PCR experiment to measure the expression of endogenous genes can be performed, as described in the examples of the present application. It should be noted that proteins comprising the polypeptide described herein are also encompassed in the present application.
In a third aspect, the invention relates to a nucleic acid molecule comprising or consisting of a nucleic acid encoding a polypeptide described herein.
In various embodiments, the nucleic acid molecule is a recombinant expression vector.
The term "nucleic acid molecule" or "nucleic acid" as used herein refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Nucleic acid molecules may have any three-dimensional structure, and may perform any function, known or unknown. The term also encompasses nucleic-acid-like structures with synthetic backbones, see, e.g., Eckstein, 1991 ; Baserga et al., 1992; Milligan, 1993; WO 97/0321 1 ; WO 96/39154; Mata, 1997; Strauss-Soukup, 1997; and Samstag, 1996. A nucleic acid molecule may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
As used herein, a "vector" is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements. In general, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a "plasmid," which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors can direct the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors." Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. Further discussion of vectors is provided herein.
Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression
vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). With regards to recombination and cloning methods, mention is made of U.S. patent application Ser. No. 10/815,730, published Sep. 2, 2004 as US 2004-0171 156 A1 , the contents of which are herein incorporated by reference in their entirety. In various embodiments, the vector further comprises regulatory elements for controlling expression of the polypeptide.
The term "regulatory element" is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage- dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g. 1 , 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1 , 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g. 1 , 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and H1 promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41 :521 -530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the β-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1 a promoter. Also encompassed by the term "regulatory element" are enhancer elements, such as WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1 ), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit β-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31 , 1981 ). It will be appreciated by those skilled in the art that the design of the expression vector can
depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc. A vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein. With regards to regulatory sequences, mention is made of U.S. patent application Ser. No. 10/491 ,026, the contents of which are incorporated by reference herein in their entirety. With regards to promoters, mention is made of PCT publication WO 201 1/028929 and U.S. application Ser. No. 12/51 1 ,940, the contents of which are incorporated by reference herein in their entirety.
Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells. For example, CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
Vectors may be introduced and propagated in a prokaryote or prokaryotic cell. In some embodiments, a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system). In some embodiments, a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism. Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein. Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (Hi) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Example fusion expression vectors include pGEX (Pharmacia Biotech Inc, Smith and Johnson, 1988. Gene 67: 31 -40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301 -315) and pET 1 1 d (Studier et al., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89). In some embodiments, a vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerevisae include pYepSed (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 1 13-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
In some embodiments, a vector drives protein expression in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31 -39).
In some embodiments, a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are typically provided by one or more regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
In some embodiments, the recombinant mammalian expression vector can direct expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver- specific; Pinkert, et al., 1987. Genes Dev. 1 : 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Baneiji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741 -748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and
European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the a-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546). With regards to these prokaryotic and eukaryotic vectors, mention is made of U.S. Pat. No. 6,750,059, the contents of which are incorporated by reference herein in their entirety. Other embodiments of the invention may relate to the use of viral vectors, with regards to which mention is made of U.S. patent application Ser. No. 13/092,085, the contents of which are incorporated by reference herein in their entirety. Tissue-specific regulatory elements are known in the art and in this regard, mention is made of U.S. Pat. No. 7,776,321 , the contents of which are incorporated by reference herein in their entirety.
In some embodiments, a regulatory element is operably linked to one or more elements of a CRISPR-Cas system so as to drive expression of the one or more elements of the CRISPR-Cas system. In general, CRISPRs constitute a family of DNA loci that are usually specific to a particular bacterial species. The CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacteriol., 169:5429- 5433 [1987]; and Nakata et al., J. Bacteriol., 171 :3553-3556 [1989]), and associated genes. Similar interspersed SSRs have been identified in Haloferax mediterranei, Streptococcus pyogenes, Anabaena, and Mycobacterium tuberculosis (See, Groenen et al., Mol. Microbiol., 10:1057-1065 [1993]; Hoe et al., Emerg. Infect. Dis., 5:254-263 [1999]; Masepohl et al., Biochim. Biophys. Acta 1307:26-30 [1996]; and Mojica et al., Mol. Microbiol., 17:85-93 [1995]). The CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol., 36:244-246 [2000]). In general, the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra). Although the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J. Bacteriol., 182:2393-2401 [2000]). CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomonas, Desulfovibrio, Geobacter, Myxococcus, Campylobacter, Wolinella, Acinetobacter, Erwinia, Escherichia, Legionella, Methylococcus, Pasteurella, Photobacterium, Salmonella, Xanthomonas, Yersinia, Treponema, and Thermotoga.
The polypeptides and nucleic acid molecules described above are preferably non-naturally occurring. The present invention provides the polypeptides and nucleic acid molecules preferably in recombinant, synthetic, isolated, and/or purified form. In a fourth aspect, to a composition comprising the polypeptide and/or the nucleic acid molecule described above.
The composition preferably also comprises other essential components of a CRISPR-Cas system, e.g. a guide RNA.
In a fifth aspect, the invention relates to a method of site-specific engineering of a target DNA, the method comprising contacting the target DNA with a CRISPR-Cas system comprising the polypeptide, nucleic acid molecule or composition described herein, and recruiting an effector domain to the target site.
Without wishing to be bound to any theory, the polypeptide described herein comprises: (a) an RNA-binding portion that interacts with the DNA-targeting RNA of a CRISPR-Cas system; and (b) DNA-binding portion that interacts with the target DNA. It may also comprise an activity portion that exhibits nuclease activity that creates a single-stranded nick or double stranded break in the target DNA of the CRISPR-Cas system, wherein the site of the double stranded break is determined by the DNA-targeting RNA, wherein preferably the contacting occurs under conditions that are permissive for nonhomologous end joining (NHEJ) or homology-directed repair (HDR), preferably HDR, and the target DNA is cleaved and rejoined to produce a modified DNA sequence.
It is within the knowledge of the skilled person to utilize the polypeptide, the recombinant expression vector, or the composition of the invention effectively in the site-directed engineering of a target DNA, including genome editing or base editing, in the light of the afore-described aspects and the common general knowledge regarding CRISPR-Cas systems.
In various embodiments, the target DNA is extrachromosomal (e.g. an episomal sequence, a minicircle sequence, a mitochondrial sequence, a chloroplast sequence, etc.) or is part of a chromosome in vitro, in an isolated or cultured cell, or in a cell in an organism. In various embodiments, the cell is selected from the group consisting of: an archaeal cell, a bacterial cell, a eukaryotic cell, a eukaryotic single-cell organism, a somatic cell, a germ cell, a stem cell, a plant cell, an algal cell, an animal cell, an invertebrate cell, a vertebrate cell, a fish
cell, a frog cell, a bird cell, a mammalian cell, a pig cell, a cow cell, a goat cell, a sheep cell, a rodent cell, a rat cell, a mouse cell, a non-human primate cell, and a human cell. In various embodiments, the organism is selected from the group consisting of: an archaea, a bacterium, a eukaryotic single-cell organism, an algae, a plant, an animal, an invertebrate, a fly, a worm, a cnidarian, a vertebrate, a fish, a frog, a bird, a mammal, an ungulate, a rodent, a rat, a mouse, and a non-human primate.
Also encompassed in the present application are cells and non-human organisms genetically engineered by the method described herein. In a sixth aspect, the invention relates to use of the polypeptide, nucleic acid molecule or composition described herein in site-directed nucleic acid modification, preferably as a component in a CRISPR-Cas system.
The present invention is further illustrated by the following examples. However, it should be understood, that the invention is not limited to the exemplified embodiments.
EXAMPLES Materials and methods
Examplel: CRISPR-Cas Nucleases with Missense Mutations and Deletions
Overall, the inventors aimed to truncate different Cas enzymes, including Cas9 from Streptococcus pyogenes, rationally guided by the solved crystal structures of these proteins (Nishimasu, H. et al. Ce// 156, 935-949 (2014); Nishimasu, H. et al. Ce// 162, 1 1 13-1 126 (2015); Yamano, T. et al. Cell 165, 949-962 (2016)). For example, disrupting protein secondary structures (a-helices and β-sheets) was avoided.
As a proof-of-concept, the inventors deleted different parts of a catalytically dead Cas9 gene from Streptococcus pyogenes (dSpCas9) fused to a tripartite activator, VP64-p65-Rta (VPR) (Chavez, A. et al. Nat Methods 12, 326-328, doi:10.1038/nmeth.3312 (2015)), and then tested the ability of each truncated dSpCas9-VPR fusion to activate the expression of a zsGreen reporter that was under the control of a minimal promoter with multiple binding sites for the enzyme. Using published crystal structures of SpCas9 as a guide, the inventors focused primarily on eliminating regions of the protein that appear to be globular and are not in contact with either the DNA or the gRNA. Furthermore, the start and end residues of each target region must be spatially close together so that the deleted portion of the protein could be replaced with a short linker. The regions of the dSpCas9 protein that were deleted are summarized in Figures 1 -5.
The results of the reporter assays for all the truncated constructs (except those involving REC3) are shown in Figure 6. Within the nuclease lobe (Figure 6), it was found that removal of the entire HNH nuclease domain did not affect the ability of dSpCas9-VPR to activate gene expression significantly. However, removal of the RuvCI, RuvCII, or RuvCIII domain resulted in complete abolishment of reporter gene activation. Subsequently, smaller fragments of the RuvCIII domain were deleted and it was found that removal of one of the fragments, RuvCIII-b, did not hamper the regulatory activity of dSpCas9-VPR significantly.
For the REC lobe, it was examined whether any segments of the REC1 , REC2, or PI domains, which are involved in DNA recognition, may be removed without causing the dSpCas9 scaffold to lose its function completely (Figure 6). Previous mutational analysis of the REC1 domain found that Δ97-150 and Δ312-409, which are regions of Cas9 that interact with a repeat:anti- repeat duplex of the gRNA, abolished DNA cleavage of the enzyme. Hence, deletions that were located towards the back portion of the REC1 domain were tested instead and it was found that
Δ510-655 (AREC1 -a) and Δ662-710 (AREC1 -c) did not affect the transcriptional activation function of dSpCas9-VPR significantly. Additionally, while a previous study showed that a Cas9 mutant lacking the REC2 domain retained only 50% of the DNA cleavage activity of the wildtype enzyme, it was found that removal of the REC2 domain from dSpCas9-VPR reduced reporter gene activation by only around 20%. Surprisingly, deletions of smaller fragments of the REC2 domain were more deleterious than removal of the entire domain. It was also found that removal of any segment of the PI domain abolished the activity of dSpCas9-VPR completely.
The inventors further asked whether different deletions could be combined to yield smaller but functional dSpCas9-VPR enzymes (Figure 6). While pairing of ΔΗΝΗ with AREC2 gave the same extent of reporter gene activation as AREC2 alone, combining ΔΗΝΗ with either AREC1 -a or AREC1 -C significantly reduced the activity of dSpCas9-VPR, although each of the individual deletions did not have an obvious effect. Nevertheless, it was found that five of the combinatorial deletions tested still resulted in smaller dSpCas9-VPR constructs that gave at least 30% of the activity of the full-length enzyme. Of these, the smallest scaffold contains three separate deletions, namely ΔΗΝΗ, AREC2, and ARuvCIII-b.
In the reporter experiments, the inventors tested two or three binding sites for the enzyme as well as different time durations post-transfection before performing the assays. Overall, it was observed that a longer time duration led to a more significant improvement in the extent of gene activation than an additional binding site (Figure 7). Some of the truncated enzymes appeared to be non-functional when assayed at 24 hours post-transfection, but were still able to activate zsGreen expression at 48 hours after transfection (Figure 6). The slower kinetics may be a result of poorer binding between the enzyme and the DNA when different parts of the dSpCas9 scaffold have been removed. Taken together, the data indicated the possibility to shrink the size of dSpCas9 and possibly other Cas9 proteins for DNA recognition.
Next, the inventors evaluated the performance of all the truncated constructs (except those involving REC3) in a native cellular context. It was tested whether the various constructs can activate four different endogenous genes (ACTC, ASCL1 , MIAT, and TTN) in HEK293T cells. From quantitative real-time PCR (qRT-PCR) experiments (Figure 8), it was found that ΔΗΝΗ, ARuvCIII-b, ΔΗΝΗ ARuvCIII-b, and AREC1 -C performed as well as the original full-length enzyme at all four endogenous genomic loci. Unexpectedly, it was also observed that several truncated constructs, despite being able to switch on the reporter gene robustly, did not perform well in the native cellular context, either failing to activate some of the genes completely or up- regulating gene expression at levels much lower than the full-length dCas9-VPR protein. This may be because there are multiple binding sites for the enzyme in the promoter driving the
reporter gene and that the sequence for this artificial binding site is known to be able to recruit the CRISPR-Cas9 system very efficiently.
Most recently, an important non-catalytic domain within the Cas9 REC lobe (termed REC3) was reported to recognize target complementarity and govern the cleavage specificity of the enzyme. Importantly, in the absence of REC3, it was found that the binding affinity of Cas9 for the target DNA was still close to wildtype, although cleavage rate decreased by 1000-fold. Hence, the inventors tested whether deletion of REC3, either by itself or in combination with other truncations, will affect the ability of the Cas9 protein to function as a robust scaffold. The inventors fused the VPR tripartite activator to different REC3 deletion constructs and performed reporter assays and qRT-PCR experiments (Figure 9). Overall, it was found that removal of REC3 alone marginally affected the ability of dSpCas9-VPR to activate either the fluorescence reporter or two endogenous genes, MIAT and TTN. Removal of both REC3 and HNH further degraded the performance of the scaffold, but the dSpCas9-VPR enzyme was still able to activate the reporter and the two endogenous genes reasonably well. This indicates that the AREC3 ΔΗΝΗ construct is a suitable candidate for further engineering and optimization.
It was hypothesized that the performance of the dCas9 scaffolds may be improved by enhancing the binding between each scaffold and the underlying DNA. Since the DNA backbone is negatively charged, the inventors sought to introduce positively charged amino acids (lysine or arginine) into the dCas9 protein. From existing crystal structures of SpCas9, the inventors selected a handful of residues that are poorly conserved and thus may not be important in the CRISPR-Cas9 system, that can accommodate a mutation to either lysine or arginine based on computational simulations, and that are sufficiently close to the targeted DNA for further testing (Figure 10). The inventors introduced the mutations individually into the ΔΗΝΗ AREC1 -c construct and performed the reporter assay. Notably, it was observed that most of the selected mutations could enhance the performance of ΔΗΝΗ AREC1 -c (Figure 1 1 ). The inventors also introduced a subset of the mutations into the ΔΗΝΗ AREC2 ARuvCIII-b construct and performed the reporter assay. It was observed that most of the tested mutations could enhance the performance of ΔΗΝΗ AREC2 ARuvCIII-b (Figure 13). The next steps are to comprehensively evaluate the mutations in combinations (Figure 12) and to further test whether they could help to improve the ability of a truncated dCas9-VPR protein to activate gene expression in an endogenous cellular context.
The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation
removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein. Other embodiments are within the following claims.
One skilled in the art would readily appreciate that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. Further, it will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention. The compositions, methods, procedures, treatments, molecules and specific compounds described herein are presently representative of preferred embodiments are exemplary and are not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention are defined by the scope of the claims. The listing or discussion of a previously published document in this specification should not necessarily be taken as an acknowledgement that the document is part of the state of the art or is common general knowledge.
The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms "comprising", "including," containing", etc. shall be read expansively and without limitation. The word "comprise" or variations such as "comprises" or "comprising" will accordingly be understood to imply the inclusion of a stated integer or groups of integers but not the exclusion of any other integer or group of integers. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by exemplary embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
The content of all documents and patent documents cited herein is incorporated by reference in their entirety.
Claims
1 . Polypeptide having at least 50% sequence identity to Streptococcus pyogenes Cas9 having the amino acid sequence set forth in SEQ ID NO:1 over its entire length, wherein said polypeptide comprises at least one deletion selected from the group consisting of ΔΗΝΗ (Δ775- 909), ARuvCIII-b (Δ1002-1074), AREC1 -a (Δ510-655), AREC1 -b (Δ525-587), AREC1 -C (Δ662- 710), AREC2 (Δ180-308), AREC2-a (Δ212-244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235-286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , and wherein the polypeptide has CRISPR-Cas DNA-binding activity.
2. The polypeptide of claim 1 , wherein the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ΔΗΝΗ (Δ510-655 Δ775-909), AREC1 - c ΔΗΝΗ (Δ662-710 Δ775-909), AREC2 ΔΗΝΗ (Δ180-308 Δ775-909), AREC2-d ΔΗΝΗ (Δ199- 283 Δ775-909), ΔΗΝΗ ARuvCIII-b (Δ775-909 Δ1002-1074), AREC3 ΔΗΝΗ (Δ498-712 Δ775- 909), AREC3 ΔΗΝΗ ARuvCIII-b (Δ498-712 Δ775-909 Δ1002-1074), AREC2 AREC3 ΔΗΝΗ ARuvCIII-b (Δ180-308 Δ498-712 Δ775-909 Δ1002-1074), and AREC2 ΔΗΝΗ ARuvCIII-b (Δ180- 308 Δ775-909 Δ1002-1074).
3. The polypeptide of claim 1 or 2, wherein the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof.
4. The polypeptide of any one of claims 1 -3, wherein the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -c ΔΗΝΗ G12R, AREC1 -C ΔΗΝΗ T13K, AREC1 -C ΔΗΝΗ T13R, AREC1 -c ΔΗΝΗ N14K, AREC1 -c ΔΗΝΗ N497K, AREC1 -C ΔΗΝΗ T657K, AREC1 -C ΔΗΝΗ T657R, AREC1 -C ΔΗΝΗ N767K, AREC1 -C ΔΗΝΗ T770K, AREC1 -C ΔΗΝΗ T770R, AREC1 -C ΔΗΝΗ Q920K, AREC1 -C ΔΗΝΗ Q920R, AREC1 -C ΔΗΝΗ S1109R, AREC1 -C ΔΗΝΗ D1135K, AREC1 -C ΔΗΝΗ D1135R, AREC1 -C ΔΗΝΗ S1338R, AREC1 -C ΔΗΝΗ T657R T13K, AREC1 -C ΔΗΝΗ T657R N497K, AREC1 -C ΔΗΝΗ T657R T770K, AREC1 -C ΔΗΝΗ T657R Q920K, AREC1 -C ΔΗΝΗ T657R S1 109R, AREC1 -C ΔΗΝΗ T657R D1135K, AREC2 ΔΗΝΗ ARuvCIII-b T13K, AREC2 ΔΗΝΗ ARuvCIII-b T657K, AREC2 ΔΗΝΗ ARuvCIII-b T657R, AREC2 ΔΗΝΗ ARuvCIII-b 770K, AREC2 ΔΗΝΗ ARuvCIII-b Q920K, AREC2 ΔΗΝΗ ARuvCIII-b S1109R, and AREC2 ΔΗΝΗ ARuvCIII-b D1135K.
5. The polypeptide of any one of claims 1 -4, wherein the polypeptide has the amino acid sequence set forth in any one of SEQ ID NOs:14-30.
6. The polypeptide of any one of claims 1 -5, wherein the polypeptide is further codon optimized for expression in a eukaryotic cell, preferably in a mammalian or human cell.
7. Polypeptide having at least 50% sequence identity to Staphylococcus aureus Cas9 having the amino acid sequence set forth in SEQ ID NO:2, Neiserria meningitides Cas9 having the amino acid sequence set forth in SEQ ID NO:3, Acidaminococcus sp. Cpf1 having the amino acid sequence set forth in SEQ ID NO:4, Streptococcus thermophilus Cas9 having the amino acid sequence set forth in SEQ ID NO:5, Sutterella wadsworthensis Cas9 having the amino acid sequence set forth in SEQ ID NO:6, Filifactor alocis Cas9 having the amino acid sequence set forth in SEQ ID NO:7, Lactobacillus johnsonii Cas9 having the amino acid sequence set forth in SEQ ID NO:8, Campylobacter lari Cas9 having the amino acid sequence set forth in SEQ ID NO:9, Parvibaculum lavamentivorans Cas9 having the amino acid sequence set forth in SEQ ID NO:10, Mycoplasma gallisepticum Cas9 having the amino acid sequence set forth in SEQ ID NO:1 1 , Treponema denticola Cas9 having the amino acid sequence set forth in SEQ ID NO:12, or Lachnospiraceae bacterium ND2006 Cpf1 having the amino acid sequence set forth in SEQ ID NO:13 over its entire length, wherein said polypeptide comprises at least one deletion of said amino acid sequence, wherein said at least one deletion corresponds to at least one deletion of SEQ ID NO:1 selected from the group consisting of ΔΗΝΗ (Δ775-909), ARuvCIII-b (Δ1002- 1074), AREC1 -a (Δ510-655), AREC1 -b (Δ525-587), AREC1 -C (Δ662-710), AREC2 (Δ180-308), AREC2-a (Δ212-244), AREC2-b (Δ244-276), AREC2-C (Δ276-308), AREC2-d (Δ199-283), AREC2-e (Δ198-257), AREC2-f (Δ235-286), AREC2-g (Δ217-266), AREC3 (Δ498-712) and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 , wherein the polypeptide has CRISPR-Cas DNA-binding activity.
8. The polypeptide of claim 7, wherein the polypeptide comprises at least one combination of deletions selected from the group consisting of AREC1 -a ΔΗΝΗ (Δ510-655 Δ775-909), AREC1 - c ΔΗΝΗ (Δ662-710 Δ775-909), AREC2 ΔΗΝΗ (Δ180-308 Δ775-909), AREC2-d ΔΗΝΗ (Δ199- 283 Δ775-909), ΔΗΝΗ ARuvCIII-b (Δ775-909 Δ1002-1074), AREC3 ΔΗΝΗ (Δ498-712 Δ775- 909), AREC3 ΔΗΝΗ ARuvCIII-b (Δ498-712 Δ775-909 Δ1002-1074), AREC2 AREC3 ΔΗΝΗ ARuvCIII-b (Δ180-308 Δ498-712 Δ775-909 Δ1002-1074), and AREC2 ΔΗΝΗ ARuvCIII-b (Δ180- 308 Δ775-909 Δ1002-1074).
9. The polypeptide of claim 7 or 8, wherein the polypeptide further comprises at least one missense mutation selected from the group consisting of G12R, T13K, T13R, N14K, N497K, T657K, T657R, N767K, T770K, T770R, Q920K, Q920R, S1 109R, D1 135K, D1 135R, S1338R and combinations thereof, wherein the position numbering is in accordance with SEQ ID NO:1 .
10. The polypeptide of any one of claims 7-9, wherein the polypeptide comprises at least one combination of modifications selected from the group consisting of AREC1 -c ΔΗΝΗ G12R, AREC1 -C ΔΗΝΗ T13K, AREC1 -c ΔΗΝΗ T13R, AREC1 -c ΔΗΝΗ N14K, AREC1 -c ΔΗΝΗ N497K, AREC1 -C ΔΗΝΗ T657K, AREC1 -C ΔΗΝΗ T657R, AREC1 -C ΔΗΝΗ N767K, AREC1 -C ΔΗΝΗ T770K, AREC1 -C ΔΗΝΗ T770R, AREC1 -C ΔΗΝΗ Q920K, AREC1 -C ΔΗΝΗ Q920R, AREC1 -C ΔΗΝΗ S1109R, AREC1 -C ΔΗΝΗ D1135K, AREC1 -C ΔΗΝΗ D1135R, AREC1 -C ΔΗΝΗ S1338R, AREC1 -C ΔΗΝΗ T657R T13K, AREC1 -C ΔΗΝΗ T657R N497K, AREC1 -C ΔΗΝΗ T657R T770K, AREC1 -C ΔΗΝΗ T657R Q920K, AREC1 -C ΔΗΝΗ T657R S1 109R, AREC1 -C ΔΗΝΗ T657R D1135K, AREC2 ΔΗΝΗ ARuvCIII-b T13K, AREC2 ΔΗΝΗ ARuvCIII-b T657K, AREC2 ΔΗΝΗ ARuvCIII-b T657R, AREC2 ΔΗΝΗ ARuvCIII-b 770K, AREC2 ΔΗΝΗ ARuvCIII-b Q920K, AREC2 AHNH ARuvCIII-b S1109R, and AREC2 ΔΗΝΗ ARuvCIII-b D1135K.
1 1 . The polypeptide of any one of claims 7-10, wherein the polypeptide is further codon optimized for expression in a eukaryotic cell, preferably in a mammalian or human cell.
12. Nucleic acid molecule comprising or consisting of a nucleic acid encoding a polypeptide of any one of claims 1 -1 1 .
13. The nucleic acid molecule of claim 12, wherein the nucleic acid molecule is a recombinant expression vector.
14. The nucleic acid molecule of claim 13, wherein the vector further comprises at least one regulatory element for controlling expression of the polypeptide.
15. Composition comprising the polypeptide of any one of claims 1 -1 1 or the nucleic acid molecule of any one of claim 12-14.
16. Method of site-specific engineering of a target DNA, the method comprising contacting the target DNA with a CRISPR-Cas system comprising the polypeptide of any one of claims 1 -1 1 , the nucleic acid molecule of any one of claims 12-14, or the composition of claim 15, wherein the CRISPR-Cas DNA-binding activity of the polypeptide recruits an effector domain to the target DNA.
17. The method of claim 16, wherein the target DNA is extrachromosomal or is part of a chromosome in vitro, in vivo, or in a cell.
18. The method of claim 16 or 17, wherein any CRISPR-Cas nuclease activity of the polypeptide introduces a single-stranded nick or a double stranded break in the target DNA.
19. Use of the polypeptide of any one of claims 1 -1 1 , the nucleic acid molecule of any one of claims 12-14, or the composition of claim 15 in site-directed nucleic acid modification, preferably as a component in a CRISPR-Cas system.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/342,319 US11840694B2 (en) | 2016-10-17 | 2017-10-17 | Truncated CRISPR-Cas proteins for DNA targeting |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SG10201608681P | 2016-10-17 | ||
| SG10201608681P | 2016-10-17 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018074979A1 true WO2018074979A1 (en) | 2018-04-26 |
Family
ID=62019274
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/SG2017/050523 Ceased WO2018074979A1 (en) | 2016-10-17 | 2017-10-17 | Truncated crispr-cas proteins for dna targeting |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US11840694B2 (en) |
| SG (1) | SG10201913505WA (en) |
| WO (1) | WO2018074979A1 (en) |
Cited By (54)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| CN110241099A (en) * | 2019-06-05 | 2019-09-17 | 复旦大学 | Truncated variants of CRISPR nuclease SpCas9 of Streptococcus pyogenes and applications thereof |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| WO2019235627A1 (en) | 2018-06-08 | 2019-12-12 | 株式会社モダリス | MODIFIED Cas9 PROTEIN AND USE THEREOF |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| WO2020085441A1 (en) | 2018-10-24 | 2020-04-30 | 株式会社モダリス | Modified cas9 protein, and use thereof |
| US10682410B2 (en) | 2013-09-06 | 2020-06-16 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US20200208129A1 (en) * | 2017-09-08 | 2020-07-02 | University Of North Texas Health Science Center | Engineered cas9 variants |
| US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| WO2020236967A1 (en) * | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| WO2021171048A1 (en) * | 2020-02-25 | 2021-09-02 | Biospirál-2006 Fejlesztő És Tanácsadó Kft. | Variant cas9 |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11946039B2 (en) | 2020-03-31 | 2024-04-02 | Metagenomi, Inc. | Class II, type II CRISPR systems |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12152257B2 (en) | 2018-06-04 | 2024-11-26 | University Of Copenhagen | Mutant CPF1 endonucleases |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12410449B2 (en) | 2021-11-24 | 2025-09-09 | Metagenomi, Inc. | Endonuclease systems |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12435323B2 (en) | 2021-08-27 | 2025-10-07 | Metagenomi, Inc. | Enzymes with RUVC domains |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109790527A (en) | 2016-07-26 | 2019-05-21 | 通用医疗公司 | Variants of CRISPR1 (Cpf1) of Prevotella and Francisella |
| US11591589B2 (en) | 2017-04-21 | 2023-02-28 | The General Hospital Corporation | Variants of Cpf1 (Cas12a) with altered PAM specificity |
| CA3073448A1 (en) | 2017-08-23 | 2019-02-28 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| WO2020051562A2 (en) | 2018-09-07 | 2020-03-12 | Beam Therapeutics Inc. | Compositions and methods for improving base editing |
| AU2020215730A1 (en) * | 2019-01-31 | 2021-07-29 | Beam Therapeutics Inc. | Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors |
| WO2021146641A1 (en) * | 2020-01-17 | 2021-07-22 | The Broad Institute, Inc. | Small type ii-d cas proteins and methods of use thereof |
| WO2021151073A2 (en) | 2020-01-24 | 2021-07-29 | The General Hospital Corporation | Unconstrained genome targeting with near-pamless engineered crispr-cas9 variants |
| WO2021151085A2 (en) * | 2020-01-24 | 2021-07-29 | The General Hospital Corporation | Crispr-cas enzymes with enhanced on-target activity |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014191521A2 (en) * | 2013-05-29 | 2014-12-04 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
| WO2015077318A1 (en) * | 2013-11-19 | 2015-05-28 | President And Fellows Of Harvard College | Mutant cas9 proteins |
| WO2016196655A1 (en) * | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE122007000007I2 (en) | 1986-04-09 | 2010-12-30 | Genzyme Corp | Genetically transformed animals secreting a desired protein in milk |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| AU698739B2 (en) | 1995-06-06 | 1998-11-05 | Isis Pharmaceuticals, Inc. | Oligonucleotides having phosphorothioate linkages of high chiral purity |
| US5985662A (en) | 1995-07-13 | 1999-11-16 | Isis Pharmaceuticals Inc. | Antisense inhibition of hepatitis B virus replication |
| EP1025217B1 (en) | 1997-10-24 | 2006-10-04 | Invitrogen Corporation | Recombinational cloning using nucleic acids having recombination sites |
| US6750059B1 (en) | 1998-07-16 | 2004-06-15 | Whatman, Inc. | Archiving of vectors |
| US7776321B2 (en) | 2001-09-26 | 2010-08-17 | Mayo Foundation For Medical Education And Research | Mutable vaccines |
| US20110027239A1 (en) | 2009-07-29 | 2011-02-03 | Tissue Genesis, Inc. | Adipose-derived stromal cells (asc) as delivery tool for treatment of cancer |
| US8927807B2 (en) | 2009-09-03 | 2015-01-06 | The Regents Of The University Of California | Nitrate-responsive promoter |
| US20120003201A1 (en) | 2010-04-21 | 2012-01-05 | Nicholas Susanne B | Vault agents for chronic kidney disease |
| EP3089989B1 (en) * | 2013-12-31 | 2020-06-24 | The Regents of The University of California | Cas9 crystals and methods of use thereof |
| TWI906646B (en) * | 2015-06-18 | 2025-12-01 | 美商博得學院股份有限公司 | Crispr enzyme mutations reducing off-target effects |
| US11674128B2 (en) * | 2016-12-12 | 2023-06-13 | Tsinghua University | Engineering of a minimal SaCas9 CRISPR/Cas system for gene editing and transcriptional regulation optimized by enhanced guide RNA |
-
2017
- 2017-10-17 SG SG10201913505WA patent/SG10201913505WA/en unknown
- 2017-10-17 US US16/342,319 patent/US11840694B2/en active Active
- 2017-10-17 WO PCT/SG2017/050523 patent/WO2018074979A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014191521A2 (en) * | 2013-05-29 | 2014-12-04 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
| WO2015077318A1 (en) * | 2013-11-19 | 2015-05-28 | President And Fellows Of Harvard College | Mutant cas9 proteins |
| WO2016196655A1 (en) * | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
Non-Patent Citations (7)
| Title |
|---|
| "Truncation of the dCas9 protein", TEAM FREIBURG, 10 November 2013 (2013-11-10), XP002719358, Retrieved from the Internet <URL:https://web.archive.org/web/20130101000000*/http://2013.igem.org/Team:Freiburg/Project/truncation> [retrieved on 20171218] * |
| GUILINGER, J.P . ET AL.: "Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification", NAT BIOTECHNOL, vol. 32, no. 6, 1 June 2014 (2014-06-01), pages 577 - 582, XP055157221, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4263420> [retrieved on 20171218] * |
| HIRANO, S.: "Structural Basis for the Altered PAM Specificities of Engineered CRISPR-Cas9", MOL CELL, vol. 61, no. 6, 17 March 2016 (2016-03-17), pages 886 - 894, XP029464130, [retrieved on 20171218] * |
| KLEINSTIVER, B.P. ET AL.: "High-fidelity CRISPR-Cas9 variants with undetectable genome-wide off-targets", NATURE, vol. 529, no. 7587, 28 January 2016 (2016-01-28), pages 490 - 495, XP055303393, [retrieved on 20171218] * |
| NISHIMASU, H. ET AL.: "Crystal Structure of Cas9 in Complex with Guide RNA and Target DNA", CELL, vol. 156, no. 5, 13 February 2014 (2014-02-13), pages 935 - 949, XP055423859, [retrieved on 20171218] * |
| QL, L.S. ET AL.: "Repurposing CRISPR as an RNA-Guided Platform for Sequence Specific Control of Gene Expression", CELL, vol. 152, no. 5, 28 February 2013 (2013-02-28), pages 1173 - 1183, XP055346792, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3664290> [retrieved on 20171218] * |
| RAN, F.A. ET AL.: "In vivo genome editing using Staphylococcus aureus Cas9", NATURE, vol. 520, no. 7546, 9 April 2015 (2015-04-09), pages 186 - 191, XP055485643, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pubmed/25830891> [retrieved on 20171218] * |
Cited By (90)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US12584118B2 (en) | 2013-09-06 | 2026-03-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10682410B2 (en) | 2013-09-06 | 2020-06-16 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US12215365B2 (en) | 2013-12-12 | 2025-02-04 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US12049651B2 (en) | 2016-04-13 | 2024-07-30 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US12297466B2 (en) | 2017-06-09 | 2025-05-13 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US20200208129A1 (en) * | 2017-09-08 | 2020-07-02 | University Of North Texas Health Science Center | Engineered cas9 variants |
| US11713452B2 (en) * | 2017-09-08 | 2023-08-01 | University Of North Texas Health Science Center | Engineered CAS9 variants |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12152257B2 (en) | 2018-06-04 | 2024-11-26 | University Of Copenhagen | Mutant CPF1 endonucleases |
| KR20210025046A (en) | 2018-06-08 | 2021-03-08 | 가부시키가이샤 모달리스 | Modified Cas9 protein and uses thereof |
| WO2019235627A1 (en) | 2018-06-08 | 2019-12-12 | 株式会社モダリス | MODIFIED Cas9 PROTEIN AND USE THEREOF |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| WO2020085441A1 (en) | 2018-10-24 | 2020-04-30 | 株式会社モダリス | Modified cas9 protein, and use thereof |
| KR20210082185A (en) | 2018-10-24 | 2021-07-02 | 가부시키가이샤 모달리스 | Modified Cas9 protein and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| WO2020236967A1 (en) * | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
| CN110241099A (en) * | 2019-06-05 | 2019-09-17 | 复旦大学 | Truncated variants of CRISPR nuclease SpCas9 of Streptococcus pyogenes and applications thereof |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| WO2021171048A1 (en) * | 2020-02-25 | 2021-09-02 | Biospirál-2006 Fejlesztő És Tanácsadó Kft. | Variant cas9 |
| US11946039B2 (en) | 2020-03-31 | 2024-04-02 | Metagenomi, Inc. | Class II, type II CRISPR systems |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12435323B2 (en) | 2021-08-27 | 2025-10-07 | Metagenomi, Inc. | Enzymes with RUVC domains |
| US12410449B2 (en) | 2021-11-24 | 2025-09-09 | Metagenomi, Inc. | Endonuclease systems |
Also Published As
| Publication number | Publication date |
|---|---|
| SG10201913505WA (en) | 2020-02-27 |
| US11840694B2 (en) | 2023-12-12 |
| US20190382775A1 (en) | 2019-12-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11840694B2 (en) | Truncated CRISPR-Cas proteins for DNA targeting | |
| JP7788744B2 (en) | Methods and compositions relating to sequences that guide CAS9 targeting | |
| KR102929494B1 (en) | Novel CRISPR/Cas12f enzymes and systems | |
| JP7460178B2 (en) | CRISPR-Cas12j enzyme and system | |
| US10457922B1 (en) | Engineered cascade components and cascade complexes | |
| JP7423520B2 (en) | Compositions and methods for improving the efficacy of Cas9-based knock-in policies | |
| CN113015798B (en) | CRISPR-Cas12a enzymes and systems | |
| CN111373041B (en) | CRISPR/CAS systems and methods for genome editing and regulating transcription | |
| US10669557B2 (en) | Targeted deletion of cellular DNA sequences | |
| KR102630014B1 (en) | Methods for increasing efficiency of nuclease-induced homology-directed repair | |
| WO2022253185A1 (en) | Cas12 protein, gene editing system containing cas12 protein, and application | |
| CN107109422B (en) | Genome editing using split Cas9 expressed from two vectors | |
| KR20250021632A (en) | Crispr/cpf1 systems and methods | |
| KR20240055073A (en) | Class II, type V CRISPR systems | |
| KR20180069898A (en) | Nucleobase editing agents and uses thereof | |
| CN112654702B (en) | Improved nuclease compositions and methods | |
| KR20160050069A (en) | Cas9 variants and uses thereof | |
| CN112029787A (en) | Nuclease-mediated DNA Assembly | |
| KR20230142500A (en) | Context-dependent, double-stranded DNA-specific deaminase and uses thereof | |
| WO2020168234A1 (en) | Enzymes with ruvc domains | |
| EP4165177A1 (en) | Enzymes with ruvc domains | |
| JP2024536135A (en) | Use of inhibitors to increase the efficiency of CRISPR/Cas insertion | |
| US20190218533A1 (en) | Genome-Scale Engineering of Cells with Single Nucleotide Precision | |
| KR102151064B1 (en) | Gene editing composition comprising sgRNAs with matched 5' nucleotide and gene editing method using the same | |
| JP2024501892A (en) | Novel nucleic acid-guided nuclease |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17862561 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17862561 Country of ref document: EP Kind code of ref document: A1 |















