WO2018071455A1 - Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers - Google Patents

Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers Download PDF

Info

Publication number
WO2018071455A1
WO2018071455A1 PCT/US2017/055994 US2017055994W WO2018071455A1 WO 2018071455 A1 WO2018071455 A1 WO 2018071455A1 US 2017055994 W US2017055994 W US 2017055994W WO 2018071455 A1 WO2018071455 A1 WO 2018071455A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
mmol
compound
cancer
moiety
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/055994
Other languages
French (fr)
Inventor
Jagath R. Junutula
Sean W. Smith
Dmitry Borkin
Sylvia Degrado
Sanjeevani Ghone
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cellerant Therapeutics Inc
Original Assignee
Cellerant Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cellerant Therapeutics Inc filed Critical Cellerant Therapeutics Inc
Priority to EP17860656.2A priority Critical patent/EP3522932A4/en
Priority to KR1020197013402A priority patent/KR20190075084A/en
Priority to CN201780076266.6A priority patent/CN110049780A/en
Priority to JP2019519254A priority patent/JP2019530707A/en
Priority to AU2017343565A priority patent/AU2017343565A1/en
Priority to AU2017343784A priority patent/AU2017343784A1/en
Priority to PCT/US2017/056808 priority patent/WO2018071910A2/en
Priority to US16/342,176 priority patent/US11359025B2/en
Priority to CA3084459A priority patent/CA3084459A1/en
Priority to JP2019520368A priority patent/JP7032394B2/en
Priority to CN201780075197.7A priority patent/CN110036028B/en
Priority to EP17860212.4A priority patent/EP3526247A4/en
Priority to US15/904,265 priority patent/US10350218B2/en
Publication of WO2018071455A1 publication Critical patent/WO2018071455A1/en
Anticipated expiration legal-status Critical
Priority to US16/455,269 priority patent/US20200061079A1/en
Priority to JP2022026299A priority patent/JP7235904B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A61K31/55131,4-Benzodiazepines, e.g. diazepam or clozapine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/075Ethers or acetals
    • A61K31/08Ethers or acetals acyclic, e.g. paraformaldehyde
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/16Amides, e.g. hydroxamic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/4427Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
    • A61K31/4439Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/05Dipeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/595Polyamides, e.g. nylon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D471/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
    • C07D471/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
    • C07D471/04Ortho-condensed systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation

Definitions

  • Benzodiazapines have been used as therapeutics.
  • Benzodiazepine derivatives include pyrrolobenzodiazepines.
  • Pyrrolobenzodiazepine dimers function as DNA cross- linking agents, e.g., by binding in the minor groove of DNA molecules. Certain of these have been suggested as antiproliferative agents in the treatment of cancer.
  • Duocarmycins also have been used as therapeutics. Duocarmycins bind to the minor groove of DNA. They alkylate the adenine at the N3 position.
  • the general structure of Duocarmycin has two key components - a DNA alkylation unit, such as l-(chioiOmethyl)- 2,3-dihydro-lH-ben.z0[e]mdole (CBI), and an indo!e-2 carbonyl unit that non-covalently binds DNA.
  • the present invention provides isoquinolidinobenzodiazepine-l(chloromethyl)- 2,3-dihydro-lH-benzo[e jmdole (' " IQB-CBI") compounds and methods of use thereof.
  • IQB-CBI isoquinolidinobenzodiazepine-l(chloromethyl)- 2,3-dihydro-lH-benzo[e jmdole
  • R a is independently H, or OH
  • R b is H, L-Rx or -L-Sc;
  • -L-Rx is a linker L attached to a reactive moiety Rx
  • -L-Sc is a linker L attached to a substance S c ;
  • L when on its own or when in combination with Rxor Sc, is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, branched, cyclic, unsaturated, heterocyclic, aromatic or heteroaromatic moieties;
  • Rx is a reactive moiety;
  • Sc is a target binding agent selected from a protein, a portion of a protein, a peptide or a nucleic acid;
  • R 2 is selected from H, OH, Ci-Cio alkyl, C2-C10 alkenyl or C2-C10 alkynyl;
  • R 3 , R J , R 4 , R 4 , R 6 , and R6' are each independently selected from. H, OH, Ci- C10 alkyl, C2-C10 alkenyl or C2-C10 alkynyl, or, if Y is N, is not present;
  • each of R 5 or R 5' is independently NH2 , CO2H, H, OH, C1-C10 alkyl, C2-C10 alkenyl, C2-C10 alkynyl, -L-Rx or -L-Sc, or, if Y is N, is not present;
  • ® R 7 is I I:
  • G'-Rb' is selected from OH, O-L, O-L-Rx, O-L-Sc, NH 2 , NH-L, NH-L-Rx, or NH-L-Sc;
  • the IQB-CBI compound has the S,S configuration and, preferably, is stereoismetrically pure.
  • an antibody-drug conjugate having a structure of Formula II:
  • W-RM IS a linking moiety formed by W and Rx, wherein W is a moiety attached a natural or unnatural amino acid residue of the antibody/antibody fragment and Rx is a succinimidyi, maleimidyl, cyclooctynyl, aminooxy, bisulfony], sulfonyl, or isothiocyanate moiety, such that W-RM is a disulfide, a thiolated succinimidyi, an amino substituted succinimidyi, a (cyclooctyl)-l, 4 triazolyl, oxime substituted N- glycan, oxime, a substituted bis-sulfopropyl, a sulfonamidyl, an amide, or a thiocarbamate moiety;
  • L is a linker
  • IQB-CBT is a compound having a structure of Formula I:
  • R a is independently 1 1, or OH
  • R b is H, or -L-;
  • L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, branched, cyclic, heterocyclic, aromatic or heteroaromatic moieties;
  • R 2 is selected from H, OH, Ci-Cio alkyl, Ci-Cio alkenyl or C2-C10 alkynyl;
  • R 3 , R 3 , R 4 , R 4' , R 6 , and R 6' are each independently selected from H, OH, Ci- C10 alkyl, C2-C10 alkenyl or C2 ⁇ Cio alkynyl, or, if Y is N, is not present;
  • each of R 5 or R 5 is independently NH2 , CO2H, H, OH, Ci-Cio alkyl, C2-C10 alkenyl, C2-C10 alkynyl, -L-, -L-Rx or -L-Sc, or, if Y is N, is not present;
  • R is H
  • G'-Rb' is selected from OH, O-L, O-L-Rx, O-L-Sc, NH2, NH-L, NH-L-Rx, or NH-L-Sc;
  • each Y is, independently, N or C
  • XI is a spacer group selected from the following formulae:
  • At least one of R b , R5, R5' and G'-R b ' comprises -L-
  • the antibody-drug conjugate of Formula II has the following structure:
  • W-RM is a linking moiety formed by W and Rx, wherein W is a moiety attached a natural or unnatural amino acid residue of the antibody/antibody fragment and Rx is a succinimidyl, maleimidyl, cylooctynyl, aminooxy, bisulfonyl, sulfonyl, or
  • W-RM is a disulfide, a thiolated succinimidyl, an amino substituted succinimidyl, a (cyclooctyl)-l, 4 triazolyl, oxime substituted N- glycan, oxime, a substituted bis-sulfopropyl, a sulfonamidyl, an amide, or a
  • Linker L is a Linker L, wherein the Linker L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, amino acid, heterocyclic, aromatic or
  • IQB-CBI is a compound having a structure of Formula I:
  • K" is independently H, or OH
  • R B is H or is a bond to the Linker L;
  • R- is selected from H, OH, Ci-Cio alkyl, C2-C10 alkenyl or C2-C10 alkynyl;
  • R J , R 3 , R 4 , R 4' , R 6 and R 6 are each independently selected from H, OH, Ci- Cio alkyl, C2-C10 alkenyl or Ci-Cio alkynyi, or, if Y is N, is not present; each of R 5 or R 5' ss independently NH2 , CO2H, H, OH, C1-C10 alkyl, C2-C10 alkenyl, C2-C10 alkynyi, is a bond to the Linker L, or, if Y is N, is not present:
  • R 7 is H
  • G'-Rb' is selected from OH, O-L, NH2, or NH-L, wherein L is the Linker L; each Y is, independently, N or C;
  • I is a spacer selected from the group consisting of the following:
  • the IQB-CBI compound of Formula I has S,S stereochemistry as follows:
  • the IQB-CBI portion of the antibod -drug conjugate of Formula II also has S.S stereochemistry.
  • FIG, 1 shows the synthesis of IQB-acids 11 a-e.
  • FIG. 2 shows the synthesis of aminoCBI moiety and final assembly of an IQB- aminoCBI dirner.
  • FIG. 3 shows the synthesis of a hvdroxyCBl moiety and final assembly of D811, D813, D815, and D817.
  • FIG. 4 shows structures of IQB-amino- and hydroxy-CBI dimer compounds.
  • FIG. 5 shows the synthesis of an IQB-acid 11 in which the spacer group XI is selected from the XI spacers disclosed, for example, in Table I.
  • FIG. 6 shows the synthesis of a CBI moiety and assembly of IQB-CBI dimer variant in wliichthe XI spacer is selected from the X I spacers disclosed, for example, in Table I.
  • FIG. 7 shows synthesis of the linkers L.
  • FIG. 8 shows synthesis of Carbonate D816.
  • FIG. 9 shows synthesis of Carbamate D818.
  • FIG. 10 shows synthesis of ether derivatives (D820 and D820b.
  • FIG. 11 shows synthesis of a linker L.
  • FIG. 12 shows synthesis of a CBI moiety.
  • FIG. 13 shows synthesis of IQB moiety and final assembly (Part 1).
  • FIG. 14 shows synthesis of IQB moiety and final assembly (Part 2),
  • FIG. 15 shows results of a binding assay for IL1RAP-IQB-CBI dimer (D816- 20)-ADCs.
  • FIG. 16 shows results of a binding assay for IL1 RAP-IQB-CBI dirner (D822, D824, D826,D828)-ADCs.
  • FIG. 17 shows target-dependent cell killing by an anti-ILlRAP-D816 ADC
  • FIG. 18 shows target-dependent ceil killing by an anti-ILlRAP- D818 ADC.
  • FIG. 19 shows target-dependent cell killing by an anti-ILl RAP-D820 ADC
  • FIG. 2,0 shows target-dependent cell killing by an anti ⁇ ILlRAP-D822 ADC
  • FIG. 21 shows target-dependent cell killing by an anti-ILlRAP-D824 ADC.
  • FIG. 22 shows target-dependent cell killing by an anti-ILl RAP-D826 ADC
  • FIG. 23 shows target-dependent ceil killing by an anti-lLIRAP-D828 ADC.
  • IQB-CBI isoquino3idinobenzodiazepine-l ⁇ chloromethyl ⁇ -2,3- dibydro-lH-benzoje] do1e
  • the antibody-drug conjugates of Fomiula ⁇ have the following structure:
  • alkyl means a saturated, branched or straight-chain or cyclic, monovalent hydrocarbon radical having the stated number of carbon atoms (i.e., Cl- C6 means one to six carbon atoms) that is derived by the removal of one hydrogen atom from a single carbon atom of a parent alkane.
  • Typical alkyl groups include, but are not limited to, methyl; ethyl; propyls such as propan-l-yl, propan-2-yl, cyclopropan-l-yl; butyls such as butan-l-yl, butan-2-yl, 2-methyl-propan-l-yl, 2-methyl-propan-2-yl, cyclobutan-l-yl; and the like.
  • alkyl means a saturated, branched or straight-chain, monovalent hydrocarbon radical having the stated number of carbon atoms (i.e., C1-C6 means one to six carbon atoms) that is derived by the removal of one hydrogen atom from a single carbon atom of a parent alkane.
  • Typical alkyl groups include, but are not limited to, methyl; ethyl; propyls such as propan-l-yl, propan-2-yl; butyls such as butan-l-yi, butan-2- yl, 2-methyl-propan-l-yl, 2-methyl-propan-2-yl; and the like.
  • alkenyl means an unsaturated branched, straight-chain or cyclic alkyl having at least one carbon-carbon double bond derived by the removal of one hydrogen atom from a single carbon atom of a parent alkene.
  • the group may be in either the cis or trans conformation about the double bond(s).
  • Typical alkenyl groups include, but are not limited to, ethenyl; propenyls such as prop-l-en-l-yl, prop-l-en-2-yi, prop-2-en-l-yl, prop-2-en-2-yl, cycioprop-l-en-l -yl; cycioprop-2-en ⁇ l -yl; butenyls such as but-l-en-l-yl, but-I -en-2-yl, 2-methyl-prop-l -en-l -yl, but-2-en-l-yl, but-2-en-2-yl, buta-l,3-dien-l-yl, buta-l,3-dien-2-yl, cyclobut-l-en-l-yl, cyclobut-l-en-3-yl, cyclobuta-l,3-dien-l-yl, etc.; and the like.
  • lower alkenyl means (C2-C8) alkenyl .
  • alkenyF' means an unsaturated branched, straight-chain alkyi having at least one carbon- carbon double bond derived by the removal of one hydrogen atom from, a single carbon atom of a parent alkene . The group may be in either the ds or trans conformation about the double bond(s).
  • Typical alkenyl groups include, but are not limited to, ethenyl; propenyis such as prop-l-en- l-yi, prop-l-en-2-yi, prop-2-en- l-yi, prop-2-en-2-yi: butenyls such as but-l-en-1- yi, but- l-en-2-yl, 2-methyl-prop-l-en- l-yl, but ⁇ 2-en ⁇ l-yl, but-2 ⁇ en-2 ⁇ yl, buta-1, 3-dien-l-yl, buta- 1 , 3-dien-2-yl, etc.; and the like.
  • "lower alkenyl” means (C2-C8) alkenyl.
  • 'aikynyl' 1 means an unsaturated branched, straight-chain or cyclic alkyl having at least one carbon-carbon triple bond derived by the removal of one hydrogen atom from a single carbon atom of a parent aikyne.
  • Typical aikynyl groups include, but are not limited to, ethynyl; propynyls such as prop-i-yn- l-yl, prop-2-yn-l-yl, etc.:
  • butynyis such as but-l-yn- l -yl, but-l-yn-3-yl, but-3-yn-l-yl, etc.; and the like.
  • "lower aikynyl” means (C2-C8) aikynyl.
  • '"aikynyl means an unsaturated branched, straight-chain alkyl having at least one carbon-carbon triple bond derived by the removal of one hy drogen atom from a single carbon atom of a parent aikyne.
  • Typical aikynyl groups include, but are not limited to, ethynyl; propynyls such as prop- l-yn- l-yl, prop-2-yn-l-yl, etc.; butynyis such as but-l-yn-l-yl, but-l-yn-3-yl, but-3-yn-l-yl, etc.; and the like.
  • "lower aikynyl” means (C2-C8) aikynyl.
  • Cyclic alkyl, alkenyl and aikynyl groups are also defined by the term "cycloalkyl” which means a saturated or partially unsaturated, monocyclic, fused bicyclic or bridged polycyciic ring assembly containing from 3 to 12 ring atoms, or the number of atoms indicated. Cycloalkyl can include any number of carbons, such as C3-6, C4-6, C5-6, C3-8, C4-8, CJ-8, Cb-s, C3-9, C3-10, C.3-n, and C3-12.
  • Saturated monocyclic cycloalkyl rings include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cyclooctyl.
  • Saturated bicyclic and polycyciic cycloalkyl rings include, for example, norboniane, [2.2.2] bicyclooctane, decahydronaphthalene and adamantane. Cycloalkyl groups can also be partially unsaturated, having one or more double or triple bonds in the ring.
  • Representative cycloalkyl groups that are partially unsaturated include, but are not limited to, cyclobutene, cyclopentene, cyclohexene, cyciohexadiene (1 ,3- and 1,4-isomers), cycloheptene, cycloheptadiene, cyclooctene, cyclooctadiene ( 1,3-, 1,4- and 1,5-isomers), norbornene, and norboraadiene.
  • exemplary groups include, but are not limited to cvclopropyi, cyclobutyl, cyclopentyl, cyclohexyl, cyclohepty] and cyclooctyl.
  • exemplary groups include, but are not limited to cvclopropyi, cyclobutyl, cyclopentyl, and cyclohexyl. Cycloalkyl groups can be substituted or unsubstituted.
  • alkylene means a divalent alkyl moiety.
  • aikoxy means an alkyl group having an oxygen atom that connects the alkyl group to the point of attachment: alkyl-O-.
  • alkyl group aikoxy groups can have any suitable number of carbon atoms, such as Ci-6.
  • Aikoxy groups include, for example, methoxy, ethoxy, propoxy, iso-propoxy, butoxy, 2-butoxy, iso-butoxy, sec-butoxy, tert-butoxy, pentoxy, hexoxy, etc.
  • the aikoxy groups can be further substituted with a variety of substituents described herein. Aikoxy groups can be substituted or unsubstituted.
  • halide means fluoro, chloro, bromo, or iodo.
  • the amide hydrogen may be replaced by other substituents.
  • oxo means a moiety having a formula ⁇ which is attached to a carbon.
  • 'carboxyl means a moiety having a formula -C(0)OH or - C(0)0-.
  • heteroalkyl means an alkyl group of any suitable length and having from 1 to 3 heteroatoms such as N, O, and S. Additional heteroatoms can also be useful, including, but not limited to, B, Al, Si, and P.
  • the heteroatoms can also be oxidized, such as, but not limited to, ⁇ S(0) ⁇ and ⁇ S(0)2 ⁇ .
  • heteroalkyl can include ethers, thioethers and alkyl-amines.
  • the heteroatom portion of the heteroalkyl can replace a hydrogen of the alkyl group to form a hydroxy, thio or amino group.
  • the heteroatom portion can be the connecting atom, or be inserted between two carbon atoms.
  • heterocyclic or “heterocyclyl” means a moiety that is a saturated or partially unsaturated, non-aromatic mono or multicyclic aikyl cyclic moiety- having heteroatom substitution replacing ring carbons.
  • Heterocyclic rings of the present invention can contain 3 to 20 ring atoms, where from 1 to 5 or more of the ring atoms are a heteroatom such as N, O or S. Additional heteroatoms can also be useful, including, but not limited to, B, A3, Si and P.
  • heteroatoms can also be oxidized, such as, but not limited to, ⁇ S(Q) ⁇ and -8(0)2-,
  • Heterocyclic groups can include any number of ring atoms, such as, 3 to 6, 4 to 6, 5 to 6, 3 to 8, 4 to 8, 5 to 8, 6 to 8, 3 to 9, 3 to 10, 3 to 1 1 , or 3 to 12 ring members. Any suitable number of heteroatoms can be included in the heterocyclic groups, such as I, 2, 3, 4, or 5, or 1 to 2, 1 to 3, 1 to 4, 1 to 5, 2 to 3, 2 to 4, 2 to 5, 3 to 4, or 3 to 5.
  • Heterocyclic groups can have from 3 to 8 ring members and from 1 to 4 heteroatoms, or from
  • Typical heterocyclic groups include, but are not limited to, tetrahydrofuranyl (e.g., tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, etc.), piperidinyl (e.g., piperidin-l-yl, piperidin-2-yl, etc.), morpholinyl (e.g., morpholin-3-yl, morpholin-4-yl, etc.), piperazinyl (e.g., piperazin-l-yi, piperazin-2-yl, etc.), and the like.
  • tetrahydrofuranyl e.g., tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, etc.
  • piperidinyl e.g., piperidin-l-yl, piperidin-2-yl, etc.
  • morpholinyl e.g., morpholin-3-yl, morph
  • Typical aryl groups include, but are not limited to, groups derived from aceanthrylene, acenaphthylene, acephenanthrylene, anthracene, azulene, benzene, chrysene, coronene, fluoranthene, fluorene, hexacene, hexaphene, hexylene, as- indacene, s-indacene, indane, indene, naphthalene, octacene, octaphene, octal one.
  • ovaSene pentacene, pentalene, pentaphene, perylene, phenalene, phenanthrene, picene, pleiadene, pyrene, pyranthrene, rubicene, triphenylene, trinaphthalene, and the like, as well as the various hydro isomers thereof.
  • Specific exemplary aryls include phenyl and naphthyi.
  • heteroaryl means a monocyclic or fused bicyclic or tricyclic aromatic ring assembly containing 5 to 16 ring atoms, where from 1 to 5 of the ring atoms are a heteroatom such as N, O or S. Additional heteroatoms can also be useful, including, but not limited to, B, Al, Si and P. The heteroatoms can also be oxidized, such as, but not limited to, ⁇ S(0) ⁇ and ⁇ S(0)2 ⁇ . Heteroaryl groups can include any number of ring atoms, such as, 5 to 6, 5 to 8, 6 to 8, 5 to 9, 5 to 10, 5 to 11, or 5 to 12 ring members.
  • heteroaryl groups can have from 5 to 8 ring members and from I to 4 heteroatoms, or from 5 to 8 ring members and from 1 to 3 heteroatoms, or from 5 to 6 ring members and from 1 to 4 heteroatoms, or from 5 to 6 ring members and from 1 to 3 heteroatoms.
  • the heteroaryl group can include groups such as pyrrole, pyridine, imidazole, pyrazole, triazole, tetrazole, pyrazine, pyrimidme, pyridazine, triazine (1 ,2,3-, 1,2,4- and 1,3,5-isomers), thiophene, furan, thiazole, isothiazole, oxazole, and isoxazole.
  • heteroaryl groups can also be fused to aromatic ring systems, such as a phenyl ring, to form members including, but not limited to, benzopyrroles such as indole and isoindole, benzopyridmes such as quinoline and isoquinoline, benzopyrazine (quinoxaline), benzopyrimidine (quinazoline), benzopyridazines such as phthalazine and cinnoline, benzothiophene, and benzofuran.
  • Other heteroaryl groups include heteroaryl rings linked by a bond, such as bipyridine. Heteroaryl groups can be substituted or unsubstituted.
  • Ci-Cu means the range of number of carbon atoms included in the group described.
  • a C1-C12 alkyi has from one carbon to 12 carbon atoms, and may be any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 carbons.
  • a Ci alky! is methyl
  • a Ci alkyl is ethyl and so on.
  • References to Ci-Cio means one to ten carbons
  • Ci- Ce means one to sixe carbons
  • C1-C3 means one to three carbons, and etc.
  • substituted means a moiety having a hydrogen radical removed, and another non-hydrogen substituent replacing it. More than one substituent maybe incorporated in any moiety, as long as the rule of chemical valency is observed.
  • Substituents suitable for use in alkyl, alkenyl, aikynyl, aromatic or heterocyclic groups include, but are not limited to, the following substituents: -OH, I IK . -NR2, - CO2H, -CO2R, -C(0)NH 2 , -C(0)NHR, -C(0)NR 2 , halide, oxo, and R, where R is a Ci-Ce alkyl.
  • a squiggly bond denotes a stereocenter of the compounds of the present inveion. It will be understood by those of skill in the art that that bond will determine the chirai configuration of the molecule (R or S and eventually dextro- or laevorotary effects). Hashed and wedged bonds are used to denote specific chirai configurations.
  • the IQB-CBI compounds of the present invention, as well as the antibody- drug conjugates that incorporate such IQB-CBT compounds, can have, for example, the following stereochemistries: S,S: R,R: S,R and R,S.
  • the S,S stereochemistry is preferred, and it is further preferred that the IQB-CBI compound of Formula I is stereoisomerically or enantiomerically pure (at least 80% enantiomerically pure, at least 85% enantiomerically pure, at least 90% enantiomerically pure, at least 95% enantiomerically pure, at least 97% enantiomerically pure, at least 100% enantiomerically pure).
  • nucleic acid refers to a linear polymer of nucleosides (including deoxyribonucleosides, ribonucleosides, or analogs thereof) joined by inter-nucleosidic linkages.
  • Nucleic add may encompass the term “polynucleotide” as well as “oligonucleotide”.
  • the linear polymer may be represented by a sequence of letters, such as "ATGCCTG,” where it will be understood that the nucleotides are in 5' to 3' order from left to right, and that "A” denotes deoxyadenosine, “C” denotes deoxycytidime, “G” denotes deoxyguanosine, and “T” denotes deoxythyrnidine, unless otherwise noted.
  • Another natural nucleotide is "U”, denoting uridine.
  • the letters A, C, G, T and U can be used to refer to the bases themselves, to nucleosides, or to nucleotides comprising the bases, as is standard in the art.
  • nucleic acids In naturally occurring nucleic acids, the inter-nucleoside linkage is typically a phosphodiester bond, and the subunits are referred to as "nucleotides.” Nucleic acids may also include other inter-nucleoside linkages, such as phosphorothioate linkages, and the like. Such analogs of nucleotides that do not include a phosphate group are considered to fall within the scope of the term "nucleotide” as used herein, and nucleic acids comprising one or more inter-nucleoside linkages that are not phosphodiester linkages are still referred to as "polynucleotides", “oligonucleotides”, etc.
  • amino acid refers to both the twenty “canonical” or “natural” amino adds, as well “non-canonical” amino acids, also referred to as “unnatural” amino acids, such as modified or synthetic amino acids, as well as amino acid analogs and ammo acid mimetics that function similarly to naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code.
  • Modified ammo acids include, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
  • Linker L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxyi, carboxamide, carboxamidy], urethanyl, branched, cyclic, unsaturated, amino acid, heterocyclic, aromatic or heteroaromatic moieties.
  • Linker L may be unbranched or branched, flexible or rigid, short or long and may incorporate any combination of moieties as deemed useful.
  • at least a portion of the linker L may have a polyalkylene oxide polymeric region, which may enhance solubility of the compound of Formula I or II.
  • the linker L may have a repeating unit of ethy lene glycol, and may have a numbe of repeating ethylene glycol units of about 1 to about 25, or any number
  • L may include about 3 to about 20, about 4 to about 15, about 5 to about 12 or about 6 to about 10 ethylene glycol units.
  • at least a portion of Linker L may include one or more ammo acid moieties which may provide enhanced solubility for the compound of Formula I or II or may provide amino acid sequences to enhance target binding, enhance compatibility with a target binding agent, or enhance target binding recognition.
  • the linker L may include one or more amino acid moieties that provide a suitable substrate motif for a protease.
  • the cytotoxic drug compound of Formula I or II may be released from a target bound conjugate to provide localized cytotoxic effects.
  • substrate motifs are known in the art and may be incorporated into the linker L as desired to provide selective release from the target bound conjugate. This selectivity can be based on known presence of a desired protease within the localized delivery region of the conjugate drag.
  • Other polymeric types of moieties may be incorporated in the linker L, such as polyacids, polysaccharides, or polyamines. Other moieties such as substituted aromatic or
  • the linker L can include a variety of groups or moieties.
  • the linker L can include a spacer (-YL-), an ammo acid sequence (XAA), and a polyethyleneglycol (PEG or -CH2CH2O-) moiety.
  • a representative linker can have the following structure:
  • the Amino Acid unit when present, links the PEG unit, if present, or reactive moiety to the Spacer unit if the Spacer unit is present.
  • XAA is a dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, heptapeptide, octapeptide, nonapeptide, decapepiide, undecapeptide or dodecapeptide unit.
  • Each amino acid of the XAA group can be arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, glutamine, cysteine, selenocysetein, glycine, proline, alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, tryptophan, or citrulline (Cit).
  • the XAA unit of the compounds of the invention can be emzymatieally cleaved by one or more enzymes, including a tumor- associated protease, to liberate the IQB-CBI unit.
  • Preferred XAA units include, but are not limited to, Ala-Val, Val-Ala, and Val-Cit.
  • the spacer -YL- when present, links an Amino Acid unit to the IQB unit when an Amino Acid unit is present.
  • Spacer units are of two general types: self-immoiaiive and non-self-immolative.
  • a non self-immoiative Spacer unit is one in which part or all of the Spacer unit remains bound to the IQB unit after cleavage, particularly enzymatic, of an Amino Acid unit from the Antibody-Drug Conjugate (ADC).
  • ADC Antibody-Drug Conjugate
  • Examples of a non self- immolative Spacer unit include, but are not limited to a (glycine-glycine) Spacer unit and a glycine Spacer unit.
  • a compound of the invention containing a glycine-glycine Spacer unit or a glycine Spacer unit undergoes enzymatic cleavage via a tumor-cell associated- protease, a cancer-cell -associated protease or a lymphocyte -associated protease, a glycine- glycine-Drug moiety or a glycine-Drug rnoieiy is cleaved from L-Aa-Ww-.
  • an independent hydrolysis reaction takes place within the target cell, cleaving the glycine-Drug unit bond and liberating the Drug.
  • -YL- is a p-aminobenzyl alcohol (PAB) unit:
  • a non self-immolative Spacer unit ( ⁇ YL ⁇ ) is -Gly-Gly-.
  • a non self-immolative the Spacer unit (-YL-) is -Giy-.
  • the invention provides a compound in which the Spacer unit is absent, or a pharmaceutically acceptable salt or solvate thereof.
  • a compound of the invention containing a self-immolative Spacer unit can release IQB or the CBI unit without the need for a separate hydrolysis step.
  • -YL- is a PAB group that is linked to -XAA - via the amino nitrogen atom of the PAB group, and connected directly to either the IQB or the CBI unit via a carbonate, carbamate or ether group.
  • -L-Rx has the structure:
  • T is a self-immolating group, such as those described above as well as a p- aminobenzyl oxycarbonyl group or a p-aminobenzyl alcohol (PAB) unit; t is 0 or 1;
  • a a and each A b are independently selected from the group consisting of alanine, ⁇ - alanine, ⁇ -aminobutyric acid, arginine, asparagine, aspartic acid, y- carboxyglutamic acid, citmlline, cysteine, glutamic acid, giutarnine, glycine, histidine, isoleucine, leucine, lysine, methionine, norleucine, norvaline, ornithine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; p is 1, 2, 3, or 4;
  • q is 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, or 12:
  • n 1, 2, 3, 4, or 5;
  • s 0 or 1 ;
  • Rx is
  • the wavy line indicates the position, i.e., point, of attachment.
  • self-immolative spacers include, but are not limited to, aromatic compounds that are electronically similar to the PAB group such as 2- aminoimidazol -5 -methanol derivatives (see Hay et a! ., Bioorg. Med. Chem. Lett , 1999, 9, 2237) and ortho or para-aminobenzylacetals.
  • Spacers can be used that undergo cyclization upon amide bond hydrolysis, such as substituted and unsubstituted 4-aminobutyric acid amides (Rodrigues et al., Chemistry Biology, 1995, 2, 223), appropriately substituted bicyclo[2.2.1] and bicyclo[2.2.2] ring systems (Storm, et al., J.
  • Preferred Spacer units can be:
  • the linker L can include ethylene glycol repeating units, and an amino acid sequence.
  • Sinker L includes the formula:
  • XAA is an amino acid sequence
  • the linker L can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50 or more ethylene glycol units (inclusive of ail ranges within the 1 to 40 ethylene glycol units, including the lower and upper limits).
  • the linker L can include 1 to 25 ethylene glycol units, preferably 2 to 20 ethylene glycol units, more preferably 2 to 15, even more preferably 5 to 15 ethylene glycol uints.
  • the linker L can include 8 ethylene glycol units.
  • ethylene glycol groups polyethylene glycol, PEG
  • H2N-dPEG®8-C(0)OH having a discrete (“d") polyethylene glycol having 8 ethylene glycol repeating units.
  • Otlier discrete PEG units are commercially available and known to one of skill in the art, such as by Advanced ChemTech.
  • H2N-dPEG®8-C(0)OH has the following formula:
  • FfcN-dPEG®8-C(0)OH when incorporated into the linker L of the present invention, it can be written as -H -dPEGs-C(O)- or -HN-dPEGs-CEbCFfc-CXO)-.
  • the linker L includes the formula:
  • PEG has 1-50 ethylene glycol units
  • XAA is an amino acid sequence
  • the linker L includes the formula: -HN-PEG-CH 2 CH2-C(0)-XAA- wherein PEG has 1 -50 ethylene glycol units, and XAA is an amino acid sequence.
  • the amino acid portion of the linker L can include any suitable number of amino acid moieties, as described above.
  • the amino acid sequence XAA can include from 1 to 100 amino acid moieties, or from 1 to 10 amino acid moieties, or from 1 to 5 amino acid moieties.
  • the linker L can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more ammo acid moieties.
  • the linker L includes 2 amino acid moieties.
  • the linker L includes the amino acid sequence Val-Ala.
  • the linker L includes the formula:
  • PEGs has 8 ethylene glycol units.
  • the linker L includes the formula:
  • the linker L can also include a variety of other connecting groups that connect the ethylene glycol portion to the ammo acid sequence, or connect the ethylene glycol or amino acid sequence to the reactive moiety Rx, substance Sc, or the compound of Formula ! andll.
  • the amino acid sequence can be connected to the compound of Formula I andll via a 4-amino benzyl carboxylate group.
  • the ethylene glycol portion can be directly linked to the reactive moiety R x or the substance Sc.
  • the linker L has the formula:
  • the linker L can also include a variety of other connecting groups that connect the ethylene glycol portion to the amino acid sequence, or connect the ethylene glycol or amino acid sequence to the reactive moiety Rx, substance Sc, or the compound of Formula 1 and II.
  • the amino acid sequence can be connected to the compound of Formula I and II via a 4-amino benzyl carboxylate group.
  • the ethylene glycol portion can be directly linked to the reactive moiety R x or the substance Sc.
  • the linker L has the formula:
  • Rx is a reactive moiety.
  • Rx may be any suitable reactive moiety as long as it is capable of reacting with a correspondingly reactive moiety present on the substance Sc, which may be a target binding agent as described herein.
  • Sc is a protein or a portion of a protein, and has accessible conjugatable moieties such as:
  • Reactive moieties R x that can react with thiols or disulfides include maleimide, iodoacetamide, azide, thiazole and pyrridopyridazine. Disulfides may also be labeled by use of a bisulfone reactive moiety. Additionally malemide reactive moieties can react with engineered selenocysteme moieties.
  • Reactive moieties x that may be used to couple the IQB or the CBI units of the IQB-CBI compounds to a target binding agent Sc include isothiocyanate, succinimidyl ester, sulfonyl lialide, carboxylic acids ( n the presence of carbodiimide coupling reagents), sulfosuccinimidyl ester, 4-sulfotetrafluorophenyl ester, tetrafluorophenyl ester, and sulfodichlorophenol ester. This list is in no way limiting and other reactive moieties Rx that are capable of reacting with an amine of a target binding agent Sc may be used.
  • Aldehydes/ketones These moieties may be introduced into a target binding agent Sc and subsequently reacted with a compound of Formula I and II having a -L-Rx where the reactive moiety Rx is hydrazine, semihydrazide, carbohydrazide, or
  • Rx include azides, phosphmes, or alkynes which can be used in Staudinger reactions, Pictet- Spengler reactions and/or Click-type chemistry (Copper containing or not) for selectively labeling of proteins including antibodies and their fragments.
  • Rx may be maleimide, bis-sulfone, iodoacetamide, azide, isothiocyanate, succinimidyl ester, sulfonyl halide, carboxylic acids, semihydrazide, carbohydrazide, hydroxylamine, phosphine, or alkyne.
  • -L-Rx is a linker L attached to a reactive moiety Rx.
  • -L-R x may be used in a compound of Formula I or 11 to form a reagent bearing IQB-CB1 compounds that can attach to a substance Sc. which may be a target binding agent as described herein. Any combination of linker L and reactive moiety Rx described herein may be used in the compounds of Formula I or II. See FIG. 7 for some exemplary -L-Rx.
  • U.S. Patent No. 7,595,292 (Brocchini et al.) refers to linkers that form thioesters with the suifurs in a disulfide bond of an antibody.
  • U.S. Patent No. 7,985,783 (Carico et ai.) refers to the introduction of aldehyde residues into antibodies, which are used to couple compounds to the antibody.
  • Sc is a target binding agent selected from a protein, a portion of a protein, a peptide, or a nucleic acid.
  • a target-binding agent that is a protein may include an antibody, an antibody fragment, or an antibody single-chain fragment variable ("scFV").
  • the target-binding agent may bind to a tumor-associated antigen, a cancer-stem- cell associated antigen or a viral antigen.
  • the target-binding agent Sc may bind to a target selected from an acute myeloid leukemia (AML M4) ceil, an acute promyelocyte leukemia cell, an acute lymphoblastic leukemia cell, an acute lymphocytic leukemia cell, a chronic lymphocytic leukemia cell, a chronic myeloid leukemia cell, a chronic T-cell lymphocytic leukemia, a myeiodysplastic syndromic cell, a multiple myeloma cell, a prostate carcinoma cell, a renal cell adenocarcinoma cell, a pancreatic adenocarcinoma cell, a lung carcinoma cell or a gastric adenocarcinoma cell, a gastric adenocarcinoma cell, a breast cancer cell, a colon cancer cell, a melanoma cell, a thyroid cancer cell, an ovarian cancer cell, a bladder cancer cell, a liver cancer cell
  • the target-binding agent Sc may bind a target selected from CLL-L IL1RAP, T1M-3, CD 19, CD20, CD22, RQR1, mesothelin, CD33, CD123/EL3Ra, GPR 14, c-Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA-125, Muc-1 , AFP, Glycolipid F77, EGFRvIII, GD-2, NY-ESO-1 TCR, tyrosinase, TRPI/gp75, g l00/pmel-17, Me lan- A/MART- 1 , Her2/neu, WT1, EphA3, telomerase, HPV E6, HPV E7, EBNA1, BAGE, GAGE and MAGE A3 TCRSLITRK6, ENPP3, Nectm-4, CD27, SLC44A4, CAIX, Cripto, CD3G, MUC16, GPNMB, BC
  • the target-binding agent S c may be a bi-specific antibody /antibody fragment.
  • the bi-specific antibody/antibody fragment binds to one or two targets selected from CLL-1, 1LIRAP, T1M-3, CD 19, CD20, CD22, ROR1, mesothelin, CD33, CD123/IL3Ra, GPR114, c-Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA- 125, Muc-1, AFP, Glycolipid F77, EGFRvIII, GD-2, NY- ESO-1 TCR, tyrosinase, TRPI/gp75, gpl00/pmel-17, Melan-A MART-1, Her2/neu, WT1, EphA3, telomerase, HPV E6, HPV E7, EBNA1, BAGE, GAGE and MAGE A3
  • TCRSLITRK6 ENPP3, Nectin-4, CD27, SLC44A4, CAIX, Cripto, CD30, MUC16,
  • GPNMB BCMA, Trop-2, Tissue Factor (TF), CanAg, EGFR, av-integrin, CD37, Folate Receptor, CDI38, CEACAM5, CD56, CD70, CD74, GCC, 5T4, CD79b, Steapl, Napi2b, Lewis Y Antigen, LIV, c-RET, DLL3, EFNA 4, Endosialin/CD248, Ly6e (RIG-e), CD79a, CD274 (PD-L1), CD38, DLL4, CD319 (SLAM7).
  • TF Tissue Factor
  • Target binding moieties can be attached to an IQB-CBI compound of this disclosure using a variety of known cross-linking agents.
  • Methods for covalent or non- covalent attachment of moieties to polypeptides are well known in the art. Such methods may include, but are not limited to, use of chemical cross-linkers, photoactivated cross-linkers and/or bifunctional cross-linking reagents. Exemplary methods for cross-linking molecules are disclosed in U.S. Patent No. 5,603,872 and U.S. Patent No. 5,401 ,511.
  • Non-limiting examples of cross-linking reagents include glutaraldehyde, bifunctional oxirane, ethylene glycol diglycidyl ether, carbodiirnides such as l-ethyl-3-(3-dimethylaminopropyl) carbodiimide or dicyclohexylcarbodiimide, bisimidates, dinitrobenzene, N- hydroxysuccinimide ester of suberic acid, disuccinimidyl tartarate, dimethyl-3,3'-dithio- bispropionimidate, azidoglyoxal, N-succinimidyl-3-(2-pyridyldithio)propionate and 4- (bromoadminoethyl)-2-nitrophenylazide.
  • carbodiirnides such as l-ethyl-3-(3-dimethylaminopropyl) carbodiimide or dicyclohexylcarbodiimi
  • the target binding moiety comprises an antibody.
  • antibody refers to a polypeptide comprising a framework region from an
  • an exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy” chain (about 50-70 kD).
  • An "isotype" is a class of antibodies defined by the heavy chain constant region. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the isotype classes, IgG, IgM, IgA, IgD and IgE, respectively. Antibodies can exist as intact immunoglobulins or as any of a number of well -characterized fragments that include specific antigen-binding activity, e.g., F(ab)'2, or an Fab' monomer.
  • a “monoclonal antibody” refers to a clonal preparation of antibodies with a single binding specificity and affinity for a given epitope on an antigen .
  • a “polyclonal antibody” refers to a preparation of antibodies that are raised against a single antigen, but with different binding specificities and affinities.
  • a “chimeric antibody” is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region, CDR, or portion thereof) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule w hich confers new properties to the chimeric antibody (e.g., an enzyme, toxin, hormone, growth factor, drug, etc.); or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity (e.g., CDR and framework regions from different species).
  • the constant region, or a portion thereof is altered, replaced or exchanged so that the antigen binding site (variable region, CDR, or portion thereof) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule w hich confers new properties to the chimeric antibody (e.
  • a “humanized antibody” refers to an immunoglobulin molecule antibodies in which the antigen binding loops, / ' . e. , CDRs, obtained from the VH and VL regions of a non- human antibody are grafted to a human framework sequence. Humanization, i.e., substitution of non-human CDR sequences for the corresponding sequences of a human antibody, can be performed following the methods described in, e.g., U.S. Patent Nos. 5,545,806; 5,569,825; 5,633,425; 5,661,016; Riechmann et al. Nature 332:323-327 (1988); Marks et al,
  • Transgenic mice or other organisms such as other mammals, may also be used to express humanized or human antibodies, as disclosed in U.S. Patent No. 6,673,986.
  • cysteine substituted antibody refers to an antibody comprising at least one non-naturally occurring constant region immunoglobulin amino acid residue that has been substituted with cysteine.
  • a non-naturally occurring substitution is one that is not isotypic.
  • the substituted residues are heavy chain constant regions.
  • Non-limiting examples of cysteine substituted antibodies include the substitutions S 156C and S239C,
  • antigen refers to a molecule, compound, or complex that is recognized by an antibody, i.e. can be specifically bound by the antibody.
  • the antibody binds to an "epitope" on the antigen.
  • the terms “specific for,” “specifically binds,” and like terms refer to a molecule (e.g., antibody or antibody fragment) that binds to a target with at least 2-fold greater affinity than non-target compounds, e.g., at least any of 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 25-fold, 50-fold, or 100-fold greater affinity.
  • an antibody that specifically binds a primary antibody will typically bind the primary antibody with at least a 2-fold greater affinity than a non-primary antibody target (e.g., an antibody from a different species or of a different isotype, or a non-antibody target).
  • an antibody target typically indicates that an antibody binds a majority of the antibody targets in a pure population (assuming appropriate molar ratios).
  • an antibody that binds a given antibody target typically binds to at least 2/3 of the antibody targets in a solution (e.g., at least any of 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%).
  • a solution e.g., at least any of 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%.
  • Antibodies or fragments thereof may have functional groups which may be attractive targets for conjugation by compounds of Formula I or 11 having a -L-Rx, as described above.
  • a compound incorporating -L-Rx where maleimide is the reactive moiety may react with thiols of cysteine residues or disulfides formed from two cysteine side chains, where accessible on the antibody or fragment thereof.
  • iodoacetamidyl reactive moieties attached to a linker of the compound of Formula I or 11 can also form a conjugate with a thiol of cysteine residues or disulfides formed intramolecularly.
  • Disulfides can be specifically targeted by use of a compound of Formula ⁇ or II having -L-Rx where the reactive moiety is a bis-sulfone, which can attach to both side chains at once.
  • Lysine side chains of antibodies or fragments thereof can be conjugated with a compound of Formula I or II having a -L-Rx where the reactive moiety is selected but not limited to isothiocyanate, succinimidyl ester, suifonyl haiide, carboxylic acid,
  • sulfosuccinimidyl ester 4-sulfotetrafluorophenyl ester, tetrafiuorophenyl ester, and sulfodichlorophenol ester.
  • the attachment reaction to the lysine side chain amino moiety is performed in the presence of a coupling reagent such as carbodiimide, which activates the carboxylic acid in situ.
  • Glutamine side chains may be targeted by an IQB-CBI having -L-Rx where the reactive moiety is an aminoalkyl moiety.
  • the amino moiety can be a substrate for modified transglutaminase to provide a glutaminyl conjugated IQB-CBI.
  • Aldehydes or ketones may be produced on a target binding agent such as an antibody or a fragment thereof, by oxidative treatments, often of the glycan portion of the antibody. Periodate or other oxidizing agents can be used to produce these carbonyl containing sites which may be targeted by a IQB-CBI compound of Formula I having a -L- Rx, where the reactive moiety is hydrazine, semihydrazide, carbohydrazide, or
  • Engineered functional moieties on the target binding agent may also be conjugated by the compounds of Formula of 1 or II having a -L-Rx. Seienocysteine may be incorporated ribosomaHy in engineered antibody fragments, which may afford a highly discriminating conjugation reaction with either an IQB or CBI unit having a maleimide reactive moiety.
  • Azido or cyclooctyne moieties may be engineered into a target binding agent which can then permit the opposite reactive moiety, cyclooctynyl or azidyl reactive groups of an IQB having a -L-Rx, using copper-free click chemistry.
  • Introduction of unnatural amino acids via ribosomal incorporation can introduce a para-acetyl phenylalanine into a target binding agent.
  • the acetyl group can be conjugated with an IQB or a CBI having a -L-Rx where the reactive moiety is an aminooxy reactive group, providing an oxime conjugation product of the target binding agent.
  • Another unnatural amino acid introduced via this process can provide an azidyl- derivative of lysine which can be reacted with an IQB or a CBI having a -L-Rx where the reactive moiety is a cyclooctyne, and copper-free click chemistry is used.
  • an antibody-drug conjugate may have a structure of
  • Dosage forms containing compounds of the present invention as the active ingredient may be advantageously used to treat or prevent proliferative diseases.
  • the dosage forms may be administered or applied singly, or in combination with other agents.
  • the formulations may also deliver a compound of the present invention to a subject in combination with another pharmaceutically active agent, including another compounds.
  • the formulations, for human medical use, of the present disclosure comprise an active ingredient in association with a pharmaceutically acceptable carrier therefor and optionally other therapeutic ingredient(s).
  • the carrier(s) must be "acceptable” in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient thereof.
  • the terms ''effective amount,” “effective dose,” “therapeutically effective amount,” etc. refer to that amount of the therapeutic agent sufficient to ameliorate a disorder, as described herein.
  • a therapeutically effective amount will show an increase or decrease of therapeutic effect of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%.
  • Therapeutic efficacy can also be expressed as "-fold" increase or decrease.
  • a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
  • Dosage forms can be prepared for mucosal (e.g., nasal, sublingual, vaginal, buccal, or rectal), parenteral (e.g., subcutaneous, intravenous, intramuscular, or intraarterial injection, either bolus or infusion), oral, or transdermal administration to a subject.
  • parenteral e.g., subcutaneous, intravenous, intramuscular, or intraarterial injection, either bolus or infusion
  • oral or transdermal administration to a subject.
  • dosage forms include, but are not limited to: dispersions; suppositories; ointments;
  • cataplasms proultices
  • pastes powders; dressings; creams; plasters; solutions; patches;
  • aerosols e.g., nasal sprays or inhalers
  • gels liquid dosage forms suitable for oral or mucosal administration to a subject, including suspensions (e.g., aqueous or non-aqueous liquid suspensions, oil-in-water emulsions, or a water-in-oil liquid emulsions), solutions, and elixirs; liquid dosage forms suitable for parenteral administration to a subject; and sterile solids (e.g., crystalline or amorphous solids) that can be reconstituted to provide liquid dosage forms suitable for parenteral administration to a subject.
  • suspensions e.g., aqueous or non-aqueous liquid suspensions, oil-in-water emulsions, or a water-in-oil liquid emulsions
  • solutions elixirs
  • liquid dosage forms suitable for parenteral administration to a subject e.g., sterile solids (e.g., crystalline or amorphous solid
  • Injectable (e.g., intravenous) compositions can comprise a solution of the IQB- CBI compounds or the antibody-drug conjugates of the present invention suspended in an acceptable carrier, such as an aqueous carrier.
  • an acceptable carrier such as an aqueous carrier.
  • aqueous carriers e.g., water, buffered water, 0.4% saline, 0.9% isotonic saline, 0.3% glycine, 5% dextrose, and the like, and may include glycoproteins for enhanced stability, such as albumin, lipoprotein, globulin, etc.
  • normal buffered saline (135-150 mM NaCl) will be used.
  • compositions can contain pharmaceutically acceptable auxiliary substances to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chioride, sorbitan monolaurate, triethanolamine oleate, etc.
  • auxiliary substances such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chioride, sorbitan monolaurate, triethanolamine oleate, etc.
  • wetting agents e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chioride, sorbitan monolaurate, triethanolamine oleate, etc.
  • the composition can be formulated in a kit for intravenous
  • Formulations suitable for parenteral administration include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. Injection solutions and suspensions can also be prepared from sterile powders, granules, and tablets.
  • compositions can be administered, for example, by intravenous infusion, topically, intraperitoneally, intravesical ly, or intrathecally.
  • Parenteral administration and intravenous administration are the preferred methods of administration.
  • the formulations of the IQB-CBI compounds or the antibody-drag conjugates of the present invention can be presented in unit- dose or multi-dose sealed containers, such as ampoules and vials.
  • the pharmacologically active compounds of the disclosure are useful in the manufacture of pharmaceutical compositions comprising an effective amount thereof in conjunction or admixture with the excipients or carriers suitable for either enteral or parenteral application.
  • Preferred are tablets and gelatin capsules comprising the active ingredient together with one or more of the following: (a) diluents, such as lactose, dextrose, sucrose, mannitol, sorbitol, cellulose, glycine and the like; (b) lubricants, such as silica, talcum., stearic acid, its magnesium or calcium salt, poiyethyleneglycol and the like: for tablets also; (c) binders, such as magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethyl -cellulose or polyvinylpyrrolidone and the like: and, if desired, (d) disintegrants, such as effervescent mixtures and the like: and (e)
  • Hie formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well-known in the art of pharmacy. All methods include the step of bringing the active ingredient into association with the earner which constitutes one or more accessory- ingredients. In general, the formulations are prepared by uniformly and intimately bringing the active ingredient into association with a liquid carrier or a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation.
  • Said pharmaceutical compositions may be sterilized and/or contain adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure, and/or buffers. In addition, they may also contain other therapeutically valuable substances.
  • Said compositions are prepared according to conventional mixing, granulating, or coating methods, respectively, and contain about 0.1 to 75%, preferably about 1 to 50%, of the active ingredient.
  • the concentration of the active agent in the formulation can vary a great deal, and will depend on a variety of factors, including the disease or condition to be treated, the nature and activity of the active agent, the desired effect, possible adverse reactions, the ability and speed of the active agent to reach its intended target, and other factors within the particular knowledge of the subject and physician.
  • the formulations will typically contain on the order of about 0.5 wt % to 50 wt % active agent, preferably about 0.5 wt % to 5 wt % active agent, optimally about 5 wt % to 20 wt % active agent.
  • An IQB-CBI compound or an IQB-CBI antibody -drug conjugate of the present invention can also be formulated to provide more than one active compound, e.g., additional chemotherapeutic or cytotoxic agents, cytokines, or growth inhibitory agents.
  • the active ingredients may also be prepared as sustained-release preparations (e.g., semi-permeable matrices of solid hydrophobic polymers (e.g., polyesters, hydrogels (for example, poly (2- hydroxyethyl-methacrylate), or poly (vinylalcohol)) or poiyiactides).
  • the antibodies and immunocongugates can be entrapped in a nanoparticle prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
  • hydroxymethylcellulose or gelatin microcapsules and poly- (methylmethacylate) microcapsules respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles
  • IQB-CBIs or IQB-CBI antibody-drug conjugates of this disclosure may take the form of a pharmaceutically acceptable salt, e.g., a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound.
  • Such salts include: ( 1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like: or formed with organic acids such as acetic acid, butyric acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, pyruvic acid, lactic acid, valeric acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, 3-(4-hydroxybenzoyl) benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic acid, 2-hydroxyethanesulfonic acid, benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2-naphthalenesulfonic acid, 4- to
  • Compounds of this disclosure inhibit ceil growth (proliferation), and thus are useful in pharmaceutical compositions to treat a subject, e.g., a vertebrate, e.g., a mammal, e.g., a human.
  • IQB-CBIs can be administered alone or as antibody-drug conjugates wherein they are conjugated to a ceil targeting agent such as an antibody.
  • Subject "Subject,” “patient,” “individual” and like terms are used interchangeably and refer to, except where indicated, mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species.
  • the term does not necessarily indicate that the subject has been diagnosed with a particular disease, but typically "patient” refers to an individual under medical supervision.
  • a patient can be an individual that is seeking treatment, monitoring, adjustment or modification of an existing therapeutic regimen, etc.
  • a “cancer patient” can refer to an individual that has been diagnosed with cancer, is currently following a therapeutic regimen, or is at risk of recurrence, e.g., after surgery to remove a tumor.
  • the cancer patient has been diagnosed with cancer and is a candidate for therapy. Cancer patients can include individuals that have not received treatment, are currently receiving treatment, have had surgery, and those that have discontinued treatment.
  • treatment refers to any reduction in the seventy of symptoms.
  • treatment can refer to, e.g. , reducing tumor size, number of cancer cells, growth rate, metastatic activity, reducing cell death of non-cancer cells, reduced nausea and other chemotherapy or radiotherapy side effects, etc.
  • the treatment can refer to, e.g., reducing blood levels of inflammatory cytokines, pain, swelling, recruitment of immune cells, etc.
  • the terms “treat” and “prevent” are not intended to be absolute terms. Treatment and prevention can refer to any delay in onset, amelioration of symptoms, improvement in patient survival, increase in survival time or rate, etc.
  • Treatment and prevention can be complete (undetectable levels of neoplastic cells) or partial, such that fewer neoplastic cells are found in a patient than would have occurred without the present invention.
  • the effect of treatment can be compared to an individual or pool of individuals not receiving the treatment, or to the same patient prior to treatment or at a different time during treatment.
  • the severity of disease is reduced by at least 10%, as compared, e.g. , to the individual before administration or to a control individual not undergoing treatment.
  • the severity of disease is reduced by at least 25%, 50%, 75%, 80%, or 90%, or in some cases, no longer detectable using standard diagnostic techniques.
  • compositions of this disclosure are useful in the treatment of proliferative diseases such as cancer.
  • Cancer includes precancerous, neoplastic, transformed, and cancerous ceils, and can refer to a solid tumor, or a non-solid cancer (see, e.g., Edge et al A ICC Cancer Staging Manual (7th ed. 2009); Cibas and Ducatman Cytology: Diagnostic principles and clinical correlates (3rd ed. 2009)).
  • Cancer includes both benign and malignant neoplasms (abnormal growth).
  • Transformation refers to spontaneous or induced phenotypic changes, e.g., immortalization of cells, morphological changes, aberrant cell growth, reduced contact inhibition and anchorage, and/or malignancy (see, Freshney, Culture of Animal Cells a Manual of Basic Technique (3rd ed. 1994)).
  • transformation can arise from infection with a transforming virus and incorporation of new genomic DNA, or uptake of exogenous DNA, it can also arise spontaneously or following exposure to a carcinogen.
  • cancer can refer to carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, solid and lymphoid cancers, etc.
  • examples of different types of cancer include, but are not limited to, lung cancer (e.g., non-small cell lung cancer or NSCLC), ovarian cancer, prostate cancer, colorectal cancer, liver cancer (i.e.,
  • renal cancer i.e., renal cell carcinoma
  • bladder cancer breast cancer, thyroid cancer, pleural cancer, pancreatic cancer, uterine cancer, cervical cancer, testicular cancer, anal cancer, pancreatic cancer, bile duct cancer, gastrointestinal carcinoid tumors, esophageal cancer, gall bladder cancer, appendix cancer, small intestine cancer, stomach (gastric) cancer, cancer of the central nervous sy stem, skin cancer, choriocarcinoma; head and neck cancer, blood cancer, osteogenic sarcoma, fibrosarcoma, neuroblastoma, glioma, melanoma, B-ceil lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, Small Cell lymphoma, Large Cell lymphoma, myelodisplastic syndromes (MDS), monocytic leukemia, myelogenous leukemia, acute lymphocytic
  • Cancers that can be targeted include, for example, leukemia (e.g., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL) and chronic myeloid leukemia (CML)), breast cancer, prostate cancer, colorectal cancer, brain cancer, esophageal cancer, head and neck cancer, bladder cancer, gynecological cancer, liposarcoma, and multiple myeloma.
  • ALL acute lymphoblastic leukemia
  • AML acute myeloid leukemia
  • CLL chronic lymphocytic leukemia
  • CML chronic myeloid leukemia
  • the target binding domain within the CAR of the disclosed disclosure is capable of binding any of a broad group of targets, including but not limited to, GPR114, CLL-1, IL1 RAP, TIM-3, CD19, CD20, CD22, RORI, mesotheim, CD33, CD 123/IL3Ra, c-Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA-125, Muc-1, AFP, Glycolipid F77, EGFRvIIL GD-2, NY- ESO-1 TCR, tyrosinase, TRPT/gp75, gpl 00/pmel-17, Melan- A/MART- 1 , Her2/neu, WT1, EphA3, teiomerase, HPV E6, HPV E7, EBNA1, BAGE, GAGE and MAGE A3
  • the cancer marker is CLL-1,
  • a "cancer target” or “cancer marker” is a molecule that is differentially expressed or processed in cancer, e.g., on a cancer cell or in the cancer milieu.
  • exemplary cancer targets are cell surface proteins such as ILIRAP (also, e.g., cell adhesion molecules and receptors), intracellular receptors, hormones, and molecules such as proteases that are secreted by cells into the cancer milieu.
  • Markers for specific cancers are known in the art, e.g., MUC1 expression on colon and colorectal cancers, bombesin receptors in lung cancer, and prostate specific membrane antigen (PSMA) on prostate cancer.
  • PSMA prostate specific membrane antigen
  • overexpressed or “upregulated” interchangeably refer to a protein or nucleic acid, generally a biomarker, that is transcribed or translated at a detectably greater level than control level.
  • the term includes overexpression due to transcription, post transcriptional processing, translation, post-translational processing, cellular localization (e.g., organelle, cytoplasm, nucleus, cell surface), and K A and protein stabilit '.
  • Overexpression can be detected using conventional techniques for detecting biomarkers, whether mRNA (i.e., RT-PCR, hybridization) or protein (i.e., flow cytometry, imaging, ELBA, immunohistochemical techniques). Overexpression can be at least any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a normal cell.
  • mRNA i.e., RT-PCR, hybridization
  • protein i.e., flow cytometry, imaging, ELBA, immunohistochemical techniques.
  • Overexpression can be at least any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a normal cell.
  • the cancer target can be associated with a certain type of cancer cell, e.g., leukemia, myeloma, lymphoma, AML, CML, non-small cell lung cancer cells, prostate cancer, colorectal cancer, breast cancer or ovarian cancer.
  • a cell type specific target is typically expressed at levels at least 2-fold greater in that cell type than in a reference population of cells.
  • the cell type specific marker is present at levels at least 3, 4, 5, 6, 7, 8, 9, 10 20, 50, 100, or 1000 fold higher than its average expression in a reference population.
  • the target can be detected or measured to distinguish the cell type or types of interest from other cells.
  • the cancer treated is a leukemia, lymphoma or a solid tumor,
  • the cancer treated is a cancer of myeloid origin, that is originating from myeloid cells.
  • Chronic myeloproliferative disorders are a collection of conditions characterized by increased number of mature and immature granuloc tes, erythrocytes, and platelets. Chronic myeloproliferative disorders can transition to other forms within this group, with a tendency to terminate in acute myeloid leukemia.
  • cancers of myeloid origin such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia syndrome), myelofibrosis, CMML (chronic myelomonocytic leukemia), multiple myeloma,
  • AML acute myelogenous or myeloproliferative leukemia
  • MDS myelodysplasia syndrome
  • myelofibrosis myelofibrosis
  • CMML chronic myelomonocytic leukemia
  • multiple myeloma multiple myeloma
  • the cancer treated is a my eloproliferative cancer.
  • the myeloproliferative cancer is selected from the group consisting of acute
  • the cancer treated is a cancer of my eloid cell origin.
  • the cancer of myeloid cell origin is selected from the group consisting of acute myelogenous leukemia, myelodysplasia syndrome, chronic myelogenous leukemia, chronic myelomonocytic leukemia, multiple myeloma, plasmacytoma and myelofibrosis.
  • Specific diseases within this group include cancers of myeloid origin, such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia- syndrome), myelofibrosis, C-MML (chronic myelomonocytic leukemia), multiple myeloma, plasmacytoma, and CML (chronic myelogenous or myeloproliferative leukemia).
  • Other myeloproliferative disorders include polycythemia vera, agnogenic myeloid leukemia, essential thrombocythemia, chronic myeloid leukemia, and chronic neutrophilic leukemia.
  • the myeloproliferative cancer is selected from the group consisting of AML, CML, CMML, multiple myeloma, plasmacytoma and myelofibrosis.
  • Elevated CLL-1 levels are associated with cancer, in particular, in hematopoietic CSCs (e.g., LSCs), and in myeloproliferative disorders, including leukemias such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia syndrome), myelofibrosis, CMML (chronic myelomonocytic leukemia), multiple myeloma,
  • leukemias such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia syndrome), myelofibrosis, CMML (chronic myelomonocytic leukemia), multiple myeloma,
  • a cancer stem cell is a cell found in a tumor or blood cancer that can give rise to the ceils that make up the bulk of the cancer.
  • the CSC can also be self-renewing, similar to a normal (non-cancer) stem cell. CSCs can thus mediate metastasis by migrating to a non-tumor tissue in an individual and starting a "new" tumor, CSCs make up a very small percentage of any given cancer, depending on the stage that the cancer is detected. For example, the average frequency of CSCs in a sample of AML ceils is believed to be about 1 : 10,000.
  • Hematopoietic CSCs can be identified as CD34+, similar to normal hematopoietic stem cells (HSCs).
  • Other CSC associated markers include CD44 (breast), CD 133 (glial cancers), and Notch (e.g., myelomas and neuroblastoma).
  • CLL-1 is expressed on AML blasts and LSCs, but not on normal hematopoietic stem ceils. CLL-1 is expressed on leukemic cells within both the bone marrow and blood compartments.
  • the target antigen is present across all AML French American British (FAB) classifications and cytogenetic risk categories and is expressed independent of FLT-3 status. The target is expressed in de novo and recurrent disease states. Expression of CLL-1 antigen in combination with multidrug resistance (MDR) is associated with poor disease prognosis and greater probability of relapse.
  • MDR multidrug resistance
  • CLL-1 is expressed in MDS and oilier myeloproliferative disorders (e.g., polycythemia vera, essential thrombocythemia and polynryelofibrosis) .
  • oilier myeloproliferative disorders e.g., polycythemia vera, essential thrombocythemia and polynryelofibrosis
  • C-type Lectin -Like molecule 1 also known as CLEC12A, DCAL-2, and MICL, is a type II membrane protein (ITIM domain— TM domain-stalk domain-lectin-like domain).
  • ITIM domain— TM domain-stalk domain-lectin-like domain The extracellular domain of CLL-1 is highly glycosylated, and it is expressed exclusively in cells of myeloid lineage.
  • CLL-1 The nucleotide and protein sequences of CLL-1 are known for many species.
  • the human sequences can be found at Genbank accession number AF247788.1 and Uniprot accession number Q5QGZ9.
  • the extracellular domain comprises approximately amino acids 65-265
  • the transmembrane domain comprises approximately amino acids 44-64
  • the cytoplasmic domain comprises approximately amino acids 1-43.
  • the stalk domain of human CLL-1 spans amino acids 65-139
  • the C lectin domain spans amino acids 140-249.
  • CLL-1 variants e.g., species homologs, allelic variants, etc.
  • CLL-1 variants can be optimally aligned, e.g., for identification of conserved residues and domains.
  • CLL-1 specific antibody “anti -CLL-1 antibody,” “CLL-1 antibody,” “CLL-1 ADC” and “anti -CLL-1” are used synonymously herein to refer to an antibody (or antibody conjugate, depending on context) that specifically binds to CLL-1, including variously glycosylated forms of CLL-1.
  • the CLL-1 antibodies described herein specifically bind the CLL-1 polypeptide expressed, e.g., on the surface of certain cancer cells, but not to HSCs.
  • the present anti-CLL-1 antibodies can bind CLL-1 expressing cells, bind a larger percentage of AML cells compared to other AML-targeting antibodies, inhibit AML cell proliferation, and mediate their destruction.
  • a "CLL-1 associated disorder” refers to conditions and diseases correlated with elevated or reduced cell surface expression of CLL-1 as compared to CLL-1 expression in a standard control (e.g., a normal, non-disease, non-cancer cell). Elevated CLL-1 levels are associated with cancer ceils, in particular, leukemias such as AML (acute myelogenous leukemia), MDS (myelodyspiastic syndrome), and CML (chronic myelogenous leukemia), and in
  • hematopoietic CSCs e.g., LSCs
  • an antibody that may be useful to target AML and cancer stem cells of involved lineages is an anti-CLL-1 antibody, and more specifically, a humanized anti-CLLl antibody.
  • anti-CLL-1 antibody and more specifically, a humanized anti-CLLl antibody.
  • Such antibodies are described, for example, in U.S. Patent Application Publication No. 2013/02951 18 and PCX International Publication No. WO 2017/091615 A 1 , both incorporated herein by reference.
  • the anti- CLL-1 antibody is optionally a chimeric (e.g., humanized) antibody referred to as "C6" and comprises light chain variable region:
  • an anti-ILlRAP antibody in another non-limiting example of an antibody that may be useful to target AML and cancer stem cells of involved lineages is an anti-ILlRAP antibody, and more specifically, a humanized anti-ILl RAP antibody.
  • ILl -RAP refers to human interleukin 1 receptor accessory protein.
  • a sequence of IL1-RAP can be as shown in Uniprot accession number Q9NPH3-1 (isoform 1). IL1RAP expression is elevated on cancer cells (e.g. , B cell lymphoma, AML cells, and solid tumor cells described herein); CSCs (e.g., myeloid CSCs); and cells associated with the IL I RAP associated disorders provided herein.
  • ILIRAP is not significantly expressed on normal hematopoietic stem cells (HSCs).
  • HSCs normal hematopoietic stem cells
  • IL IRAP antibodies are described, for example, in U.S . Provisional Patent Application No. 62/425,970 and U.S . Patent Application Publicatin No. 2015/0315279 both incorporated herein by reference.
  • the anti-ILl RAP antibody is referred to as "3G7".
  • 3G7 can have light chain variable and heavy chain variable sequences as follows (CDRs indicated in bold highlight):
  • the 3G7 anti-ILlRAP antibody is a humanized antibody and comprises:
  • CDRs and a cysteine substitution for attachment of the pay load linker are set forth in bold and underline.
  • the antibody can include substitutions of a cysteine residue for another residue.
  • Compositions of tins disclosure can be attached to the antibodies through the cysteine residue.
  • a serine residue at position 156 is substituted with cysteine (S156C).
  • a serine residue at position 239 is substituted with cysteine (S239C).
  • More than one IQB-CBI compound may be incorporated into antibodies so modified.
  • the number of IQB-CBI compounds attached to an antibody may be any number in the range from 1 to about 10, or any number in between, including a fractional number, in some embodiments, the number of IQB-CBI compounds attached to the antibody is in the range from 1 to about 3.
  • Such an antibody incorporating the IQB-CBIs described herein have been found to be effective in invitro and invivo applications as described below.
  • the amount of compounds that will be effective in the treatment or prevention of proliferative disorders in a subject will depend on the specific nature of the condition, and can be determined by standard clinical techniques known in the art. In addition, in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges.
  • the specific dose level for any particular individual will depend upon a variety of factors including the relative activity of the compounds, the age, body weight, general physical and mental health, genetic factors, environmental influences, sex, diet, time of administration, route of administration, rate of excretion, and the severity of the particular problem being treated.
  • a dose refers to the amount of active ingredient given to an individual at each administration .
  • the dose can refer to the concentration of the antibody or associated components.
  • the dose will v ary depending on a number of factors, including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; the route of administration; and the imaging modality of the detectable moiety (if present).
  • dose can be modified depending on the above factors or based on therapeutic progress.
  • the term “dosage form” refers to the particular format of the pharmaceutical, and depends on the route of administration.
  • a dosage form can be in a liquid, e.g. , a saline solution for injection.
  • a "control" sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample.
  • a test sample can be taken from a test condition, e.g. , in the presence of a test compound, and compared to samples from known conditions, e.g., in the absence of the test compound (negative control), or in the presence of a known compound (positive control).
  • a control can also represent an average value gathered from a number of tests or results.
  • controls can be designed for assessment of any number of parameters.
  • a control can be devised to compare therapeutic benefit based on pharmacological data ⁇ e.g., half-life) or therapeutic measures (e.g., comparison of benefit and/or side effects).
  • Controls can be designed for in vitro applications.
  • One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are widely variant in controls, variation in test samples will not be considered as significant.
  • the compounds of the disclosure will be conjugated to a target binding moiety, such as an antibody.
  • the target binding moiety can be specific to targets on cells targeted for elimination in order to treat a subject suffering from a condition caused by the presence of such cells.
  • the target can be any biomoiecule on a target cell.
  • Target cells can include cancer cells. Therefore, the target can comprise, for example, a polypeptide expressed on a cancer cell, e.g., a tumor-associated antigen.
  • the target binding rnoiety can be a chimeric antigen receptor ("CAR") that can bind an antigen determinant comprising ammo acids within the extracell ular domain of a tumor-associated antigen, a viral antigen or a viral associated antigen or a fragment of such a polypeptide.
  • CAR chimeric antigen receptor
  • Suitable dosage ranges for oral administration are dependent on the potency of the particular compound or compound antibody conjugates, but are generally about 0.001 mg to about 500 mg of drug per kilogram body w eight, preferably from about 0.1 mg to about 200 mg of drug per kilogram body weight, and more preferably about 1 to about 100 mg/kg-body wt. per day. Dosage ranges may be readily determined by methods known to the skilled artisan. The amount of active ingredient that may be, for instance, combined with carrier materials to produce a single dosage form will var - depending upon the subject treated and the particular mode of administration. Dosage unit forms will generally contain between about 1 mg to about 500 mg of active ingredient.
  • Administration can be periodic. Depending on the route of administration, the dose can be administered, e.g., once even' 1, 3, 5, 7, 10, 14, 21, or 28 days or longer (e.g., once every 2, 3, 4, or 6 months). In some cases, administration is more frequent, e.g., 2 or 3 times per day.
  • the subject can be monitored to adjust the dosage and frequency of administration depending on therapeutic progress and any adverse side effects, as will be recognized by one of skill in the art.
  • additional administration is dependent on subject progress, e.g., the subject is monitored between administrations.
  • the subject can be monitored for rate of tumor growth, recurrence (e.g., in the case of a post-surgical subject), or general disease-related symptoms such as weakness, pain, nausea, etc.
  • compositions comprising the IQB-CBI compound or the IQB-CBI antibody conjugate may be administered by any convenient route, for example, by infusion or bolus injection, or by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, ere). Administration can be systemic or local.
  • Various deliver ⁇ ' systems are known, (e.g. , encapsulation in liposomes, microparticles, microcapsules, capsules, etc.) that can be used to administer the antibody conjugate compositions.
  • Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, intranasal, and intracerebral .
  • the amount of compound antibody conjugates that will be effective in the treatment or prevention of proliferativ e disorders in a subject will depend on the specific nature of the condition, and can be determined by standard clinical techniques known in the art. In addition, in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges.
  • the specific dose level for any particular individual will depend upon a variety of factors including the relativ e activ ity of the compound antibody conjugates, the age, body weight, general physical and mental health, genetic factors, environmental influences, sex, diet, time of administration, route of administration, rate of excretion, and the severity of the particular problem being treated.
  • the IQB-CBI conjugates or the IQB-CBI antibody conjugate can be administered by injection or infusion through any suitable route including but not limited to intravenous, subcutaneous, intramuscular or intraperitoneal routes.
  • An example of administration of a pharmaceutical composition includes storing the composition at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4°C, and diluting it in either 100 ml or 200 mi 0.9% sodium chloride for injection prior to administration to the subject.
  • the composition is administered by intravenous infusion over the course of i hour at a dose of between 0.2 and 10 mg/kg.
  • the composition is administered by intravenous infusion over a peri od of between 15 minutes and 2 hours.
  • the composition is administered by intravenous infusion over a peri od of between 15 minutes and 2 hours.
  • the composition is administered by intravenous infusion over a peri od of between 15 minutes and 2 hours.
  • the composition is administered by intrave
  • administration procedure is via sub-cutaneous bolus injection .
  • additional administration is dependent on the progress of the subject, e.g., the subject is monitored between administrations.
  • kits comprising containers containing compositions as provided herein.
  • the containers contain a unit dose of the composition.
  • Kits can comprise boxes containing a plurality of composition-containing containers.
  • kits comprise a container, such as a bag or bottle, containing a composition of this disclosure connected to an insersion device, such as a needle, for example, tiirough a tube that function as a conduit for the composition in the container.
  • Example 1 Experimental protocols for the synthesis of IQB-CBI Dimers
  • ⁇ NMR spectra were recorded on a Varian Inova 300 or 500 MHz NMR instrument. Chromatographic purities were determined on an Agilent 1200 Series or 1 100 Series LC/MS system using a Merck Chromolith RP-18e analytical HPLC column
  • Acid 3 (3.03 g, 10 mmol) was dissolved in dichloromethane (33 mL), and DIEA (2.6 mL, 15 rnmol) was added followed by HATU (4.93 g, 13 mmol). Mixture was stirred for 30 minutes and amine 5 (2.29g, 12 mmol) was added at once. Reaction mixture was allowed to stir overnight, then washed with 0.5 M HQ, saturated NaHCCb and concentrated to dryness. The residue was purified on a 1 10 g silica Teledyne Isco column (0- ⁇ 35% EtOAc in hexane). Evaporation of product containing fractions afforded 2.73 g of 6 (57% yield).
  • Nitro derivative 6 (2.71 g, 5,7 mmol), zinc (7.4 Ig, 1 14 mmol) and NH4CI (12.2 g, 228 mmol) were placed in flask with stirring bar and acetone/water (125 mL, 1 :4 v/v) was added. The reaction mixture was stirred overnight and then filtered off through celite and concentrated. The residue was dissolved in methanol (100 mL) and stored for 24 hr at rt. Formed precipitate was filtered off, washed thoroughly with water and dried to afford 2.18 g of ? (92% yield).
  • TFA (5 mL) was precooled to 0°C and then added to Boc-protected CB1 (29 mg, 0.06 mmol). Solution was kept at 0°C overnight and then concentrated to dryness. Residue was redissolved in anhydrous chloroform evaporated again and partitioned between saturated NaHC03 and DCM. Organic phase was dried over MgS0 4 and concentrated to obtain crude salt of aniline. It was dissolved in DMF (1 .2 mL) and acid 11a (25 mg, 0.068 mmol) was added followed by EDC-HC1 (30 mg, 0.16 mmol).
  • Reaction mixture was stirred for 3 hr and then directly loaded onto a 15.5 g Ci8 Aq Isco column and purified (5 ⁇ 95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophilized to obtain 22 mg of 19a (58% yield).
  • Camphorsulfonic acid (6.4 mg, 0.12 mmol) and benzenesulfinic acid sodium salt (16.4 mg, 0.1 mmol) were added. Vial was flushed with Ar before adding palladium
  • Flask containing solution of 29 (232 mg, 0.55 mmol) in EtOAc (6 mL) was flushed with Ar and Pd(OH)2/C (10% by weight, 50 mg) was added. Hydrogen (ballon) was bubbled through solution for 24 hr and then reaction mixture was filtered off through celite, concentrated and purified on 12 g silica Teledyne Isco column (0 ⁇ 50% EtOAc in hexane). Evaporation of product containing fractions afforded 145 mg of 30 (78% yield).
  • Racemic 30 was dissolved in 5 mL hexane-IPA (9-1 , v/v, 5 mL) and injected in 1 mL portions on chiral HPLC with OD-H column (20 x 250 mm, 5 ⁇ ), 25 mL/min, 0 ⁇ 5% IPA in hexane over 20 minutes.
  • tr(30-(S)) 14 min (J. Am. Chetn. Soc, 1994, 116. 7996-8006).
  • Fractions containing desired enantiomer were combined and concentrated to dryness to afford 51 mg of 30-(S).
  • Reaction mixture was stirred for 1 hr and then directly loaded onto a 15.5 g Cis Aq Isco column and purified (5 ⁇ 95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophilized to obtain 2.5 mg of 32c ( 12% yield).
  • Example 2 Experimental protocols for the synthesis of IQB-CBI with various linking groups (Schemes 5 and 6, referring to Figures 5 and 6)
  • the synthesis protocol used to produce CLT-D801 can be modified to introduce various spacer groups between the IQB moiety and the CBI moiety. Referring to FIGs 5 and 6, the protocol can proceed in an identical fashion, with a modification introduced at the step between compounds 9 and 10. More specifically, rather than 2-bromoacetic acid, a carboxylic acid incorporating a moiety I, as described herein, in used.
  • Example 3 Cytotoxicity of IQB-aminoCBI and IQB-hydroxyCBI Dimers
  • Cytotoxicity of D801 , D803, DOS, D807, D809, D81 1 , D813, D815 and D817 were tested against AML2 and HL60 cell lines. Results are shown in Table 1. Cell killing assay was performed after 3-day incubation with various IQB-CBI dimers.
  • reaction mixture was diluted with 0.5 mL FfcO then directly loaded and purified via reverse phase column chromatography (0— ->100% ACN in FfcO, each containing 0.05% AcOH) and desired fractions Iyophilized to afford (5) as an off-white foam (37.1 mg, 60% yield, 0.0398 mmol).
  • OxoDuocannycin-IQB-3C spacer (7) (29.6 mg, 0.0204 mmol), under Ar, added a solution on 10: 1 DCM/TFA solution ( 1.0 mL). The resulting mixture was stirred at 22 °C for 30 min. The resulting reaction mixture was then directly loaded and purified via reverse phase column chromatography (0 ⁇ 100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford (8) as a white solid ( 1 1.8 mg, 44% yield, 0.00872 mmol).
  • OxoDuocarmycin-IQB-3C spacer (8) (1 1.8 mg, 0.00872 mrnoi) in DCM (0.5 rnL) under Ar, was added TEA (12.2 ( uL, 0.0872 mmol), and maleimido propionate NHS ester (8). The resulting mixture was stirred at 22 °C for 1 h. The reaction mixture was then concentrated, dissolved in DMSO and directly loaded and purified via reverse phase column
  • OxoDuocarmycin 16b was synthesized according to the same procedure as 16a but starting with 3-methoxy-4-nitro benzyl bromide.
  • OxoDuocarmycin 17b was synthesized according to the same procedure as 17a but starting with /-butyl (5)-l-(chloromethyl)-5-((3-methox ⁇ 7 -4-nitroberizyl)oxy)-l,2-dihydro- 3H-benzo [e] indole -3 -carboxylate 17 a.
  • OxoDuocarmycin 18b was synthesized according to the same procedure as 18a but starting with /-butyl (5)-l-(chloromethyl)-5-((3-methoxy-4-aminobenz ⁇ d)oxy)-l ,2- dihydro-3H-benzo [e] indole-3 -carboxylate 17b .
  • the reaction was concentrated in vacuo, then azeotroped with CHCb (4 x 5 mL) and left on high vac for 16b .
  • the residue was then dissolved in DCM (1 mL) and TEA (6 ,LiL, 0.0422 mmol) was then added.
  • An additional 2 ,uL of TEA was added to basify the reaction to pH ⁇ 8, then maleimine NHS ester (9) (9,8 mg, 0.0369 mmol) was added and the resulting mixture was stirred at 22 °C for 15 min, at which point the reaction was judged complete by LC/MS,
  • the reaction mixture was then concentrated and azeotroped with CHCb (3 x 5 ml.) and left on high vac for lh.
  • OxoDuocarmycin 19b was synthesized according to the same procedure as 19a but starting /-butyl (S)-l-(chloromethyl)-5-((4-((34 ⁇ S,37 ⁇ S)-34-isopro
  • reaction vessel was purged with Ar, sealed, and the reaction mixture was stirred at 22 °C for 4 days.
  • the mixture was then concentrated, and the residue was purified via re verse phase chromatography (0 ⁇ T00 % ACN in H2O, each containing 0.05% AcOH).
  • the desired fractions were lyophilized and impure product was purified via column chromatography (0 ⁇ 100% EtOAc in hexane) to afford 15 (520 mg, 72% yield).
  • reaction mixture was diluted with EtOAc ( 10 ml.) and the organics were washed with H2O, NaHCCh (sat), and brine (each, 1 x 5 mL), then dried over MgS04, filtered and concentrated. The residue was purified via column chromatography (20 ⁇ 100% EtOAc in hexane) to afford 16 (385 mg, 96% yield).
  • reaction mixture of 19a was diluted with DMF (1 mL) and pyrrolidine (0.008 mL, 0.1 mmol) was added followed by palladium tetrakis triphenylphosphine (5.6 mg, 0.005 m mol ) After 30 minutes reaction mixture was purified on EZ Prep (Gemini 30 x 150 mm column) (5 ⁇ 95% ACN in H 2 0, each containing 0.05% TFA) to afford 20a (20.5 mg, 99% yield), contains unknown impurities. Used as is in the next step.
  • reaction mixture was concentrated, dissolved in DMSO (1 mL) and purified EZ Prep (Gemini 30 x 150 mm column) (5— ->95% ACN in H2O, each containing 0.05% HOAc) to afford 20c (16 mg) containing unknown amount of impurity.
  • triphenylphosphine (0.6 mg, 0.0005 mmol). After 30 minutes, the reaction mixture was concentrated, dissolved in DMSO (0.5 mL) and purified via reverse phase chromatography (0 ⁇ 100% ACN in ⁇ 2 ⁇ , each containing 0.05% HOAc). Desired fractions were iyophilized to afford 20d (5 ,8 mg, 65% yield).
  • Chi3G7/hu3G7-IQB-CBI (“Chi3G7/hu3G7-IQB-CBI”) (5.0 mg, 1.68 mg/mL, PBS) was exchanged into borate buffer (50 mM, pH 8.5, ImM diethylene triamine pentaacetic acid (DTP A)) via 2 cycles of molecular weight cut-off filtration (MWCO) using a Millipore, 15 mL, 30 kDa de vice.
  • borate buffer 50 mM, pH 8.5, ImM diethylene triamine pentaacetic acid (DTP A)
  • MWCO molecular weight cut-off filtration
  • Antibody 3G7 has amino acid sequences as described herein.
  • Example 6 Binding of 3G7-(IQB-CBI ADCs to Cells: D8 6, D818, D820, D822, D826, D824, D828
  • Figures 15 and 16 show binding, as a function of mean fluorescent intensity, of humanized (hu3G7) or chimeric (Chi3G7) anti-ILlRAP antibody to various cell Sines.
  • HL- 60 cells human promyelocytic leukemia cells
  • EOLl cells human eosinophilic leukemia cells
  • SK-MEL-5 cells human melanoma cell line
  • CO antibody is a non-binding control IgGl .
  • D212 is a composition having the formula:
  • the cells were resuspended in binding buffer (PBS, 2% FBS)) containing 5% NHS (normal human s x 10 6 cells/mL.
  • binding buffer PBS, 2% FBS
  • NHS normal human s x 10 6 cells/mL.
  • 50 ⁇ L ⁇ of primary antibody /ADC was added and incubated at 4° for 30 min.
  • second antibody anti-human APC, 1 :400 in the binding buffer
  • ADCs comprising Chi3G7 anti-ILlRAP chimeric antibody (human constant domain, mouse variable domain) and various TQB-CBI dimer linker- pay loads (D816, D818, D820, D822, D826, D824, D828) is shown in FIGs. 17-23.
  • HL-60 ceils, , EOL1 cells and SK-MEL-5 cells (human melanoma cell line) were treated with the ILIRAP -selective cytotoxic antibody-drag conjugate, Chi3G7-(IQB-CBI) ADC and the control antibody -drug conjugate, CO-(IQB-CBT) ADC or C0-D212 ADC, at varying concentrations at 37° C for five days.
  • FIG. 17 shows target dependent cell killing by Chi3G7-D816 ADC, hu3G7-D816 (humanized), compared with control C0-D212 and C6-D212 ADC.
  • FIG. 18 shows target dependent cell killing by Chi3G7-D818 ADC and hu3G7- D818 (humanized 3G7) compared with C0-D212 and C6-D212.
  • FIG. 1 shows target dependent cell killing by Chi3G7-D820 ADC compared with C0-D212 and Chi3G7 ⁇ D212
  • Example 8 Chi3G7-CLT-(IQB-CBl) ADC or Hu3G7-CLT-(IQB-CBl) ADC

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Hematology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Diabetes (AREA)
  • Dermatology (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Provided herein are isoquinolidinobenzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers, antibody-drug conjugates comprising them and methods of use for killing cells and treating disease.

Description

ISOQUINQLIDiN ©BENZODIAZEPINE (IQB)-l(CHLOROMETHYL)-2,3- DIHYDRO-IH-BE ZO[E]INDOLE (CBI) DIMERS
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
[0001] None.
REFERENCE TO RELATED APPLICATIONS
[0002] The present application is an international application which claims the benefit of the filing date of U.S. Provisional Application No 62/406,077, filed October 10, 2016 entitled "ISOQUINOLIDI O-DUOCARMYCIN DIMERS", and U.S. Provisional Application No 62/451,658, filed January- 27, 2017 entitled "ISOQUINOLIDINOBENZODIAZEPINE (IQB)-l(CHI R.OMETHYI,)-2,3-DiHYDR.O-lH-BENZO[F.]TNDOI,E (CBI) DIMERS", the entire contents of which is incorporated herein by reference for all purposes.
BACKGROUND
[0003] Benzodiazapines have been used as therapeutics. Benzodiazepine derivatives include pyrrolobenzodiazepines. Pyrrolobenzodiazepine dimers function as DNA cross- linking agents, e.g., by binding in the minor groove of DNA molecules. Certain of these have been suggested as antiproliferative agents in the treatment of cancer.
[0004] Duocarmycins also have been used as therapeutics. Duocarmycins bind to the minor groove of DNA. They alkylate the adenine at the N3 position. The general structure of Duocarmycin has two key components - a DNA alkylation unit, such as l-(chioiOmethyl)- 2,3-dihydro-lH-ben.z0[e]mdole (CBI), and an indo!e-2 carbonyl unit that non-covalently binds DNA.
SUMMARY
[0005] The present invention provides isoquinolidinobenzodiazepine-l(chloromethyl)- 2,3-dihydro-lH-benzo[e jmdole ('"IQB-CBI") compounds and methods of use thereof. In one aspect, provided herein is a compound having the Formula I:
Figure imgf000004_0001
Formula I
wherein:
the dotted bond shown between -C(Ra)~ and -N(Rb)- is independently a single bond or a double bond;
o when a double bond is present between -C(Ra)- and -N(Rb)-, the -C(Ra)- is olefmic and has a substituent Ra, and Rb of the -N(Rb)- is not present; o when a single bond is present between -C(R3)- and -N(Rb)~, the -C(Ra)- is saturated and has a hydrogen substituent in addition to the Ra substituent and Rb of the -N(Rb)~ is present;
Ra is independently H, or OH;
if present, Rb is H, L-Rx or -L-Sc;
-L-Rx is a linker L attached to a reactive moiety Rx, and -L-Sc is a linker L attached to a substance Sc; where L, when on its own or when in combination with Rxor Sc, is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, branched, cyclic, unsaturated, heterocyclic, aromatic or heteroaromatic moieties; Rx is a reactive moiety; Sc is a target binding agent selected from a protein, a portion of a protein, a peptide or a nucleic acid;
R2 is selected from H, OH, Ci-Cio alkyl, C2-C10 alkenyl or C2-C10 alkynyl;
R3, RJ , R4, R4 , R6, and R6' are each independently selected from. H, OH, Ci- C10 alkyl, C2-C10 alkenyl or C2-C10 alkynyl, or, if Y is N, is not present;
* each of R5 or R5' is independently NH2 , CO2H, H, OH, C1-C10 alkyl, C2-C10 alkenyl, C2-C10 alkynyl, -L-Rx or -L-Sc, or, if Y is N, is not present; ® R7 is I I:
* G'-Rb' is selected from OH, O-L, O-L-Rx, O-L-Sc, NH2, NH-L, NH-L-Rx, or NH-L-Sc;
* each Y is, independently, N or C;
* each D is, independently, (CH2)n where n = 0-4, provided that at least one D is (CH2)n where n = 1-4;
* XI is any of the listed formulae: m
Figure imgf000005_0001
Figure imgf000005_0002
llie C-C bond of the carbon bonded to C and CI in Formula I can exist in R or S forms, or the composition can be part of a racemic mixture. In preferred embodiments, the IQB-CBI compound has the S,S configuration and, preferably, is stereoismetrically pure.
In another aspect provided herein is an antibody-drug conjugate having a structure of Formula II:
Figure imgf000006_0001
Formula II wherem:
Figure imgf000006_0002
is an antibody or antibody fragment;
W-RM IS a linking moiety formed by W and Rx, wherein W is a moiety attached a natural or unnatural amino acid residue of the antibody/antibody fragment and Rx is a succinimidyi, maleimidyl, cyclooctynyl, aminooxy, bisulfony], sulfonyl, or isothiocyanate moiety, such that W-RM is a disulfide, a thiolated succinimidyi, an amino substituted succinimidyi, a (cyclooctyl)-l, 4 triazolyl, oxime substituted N- glycan, oxime, a substituted bis-sulfopropyl, a sulfonamidyl, an amide, or a thiocarbamate moiety;
L is a linker;
IQB-CBT is a compound having a structure of Formula I:
Figure imgf000006_0003
wherein: the dotted bond shown between -C(Ra)- and -N(Rb)- is independently a single bond or a double bond;
o when a double bond is present between -C(Ra)~ and -N(Rb)-, the -C(R3)~ is olefmic and has a substituent Ra, and Rb of the -N(Rb)- is not present; o when a single bond is present between -C(Ra)- and -N(Rb)-, the -C(Ra)- is saturated and has a hydrogen substituent in addition to the Ra substituent and Rb of the -N(Rb)- is present;
Ra is independently 1 1, or OH;
if present, Rb is H, or -L-;
-L- is a linker L, where L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, branched, cyclic, heterocyclic, aromatic or heteroaromatic moieties;
R2 is selected from H, OH, Ci-Cio alkyl, Ci-Cio alkenyl or C2-C10 alkynyl;
R3, R3 , R4, R4', R6, and R6' are each independently selected from H, OH, Ci- C10 alkyl, C2-C10 alkenyl or C2~Cio alkynyl, or, if Y is N, is not present;
each of R5 or R5 is independently NH2 , CO2H, H, OH, Ci-Cio alkyl, C2-C10 alkenyl, C2-C10 alkynyl, -L-, -L-Rx or -L-Sc, or, if Y is N, is not present;
R is H;
G'-Rb' is selected from OH, O-L, O-L-Rx, O-L-Sc, NH2, NH-L, NH-L-Rx, or NH-L-Sc;
each Y is, independently, N or C;
each D is, independently, (0¾)η where n = 0-4, provided that at least one D is (CH2)n where n =: 1-4;
XI is a spacer group selected from the following formulae:
Figure imgf000008_0001
at least one of Rb, R5, R5' and G'-Rb' comprises -L-
In a preferred embodiment, the antibody-drug conjugate of Formula II has the following structure:
Figure imgf000008_0002
Formula II wherein:
Figure imgf000008_0003
an antibody or antibody fragment; W-RM is a linking moiety formed by W and Rx, wherein W is a moiety attached a natural or unnatural amino acid residue of the antibody/antibody fragment and Rx is a succinimidyl, maleimidyl, cylooctynyl, aminooxy, bisulfonyl, sulfonyl, or
isothiocyanate moiety, such that W-RM is a disulfide, a thiolated succinimidyl, an amino substituted succinimidyl, a (cyclooctyl)-l, 4 triazolyl, oxime substituted N- glycan, oxime, a substituted bis-sulfopropyl, a sulfonamidyl, an amide, or a
thiocarbamate moiety;
L is a Linker L, wherein the Linker L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, amino acid, heterocyclic, aromatic or
heteroaromatic moieties:
IQB-CBI is a compound having a structure of Formula I:
Figure imgf000009_0001
wherein:
* the dotted bond shown between -C(RA)- and -N(RB)- is independently a single bond or a double bond:
o when a double bond is present between -C(Ra)- and -N(Rb)-, the -C(RA)- is olefmic and has a substituent RA, and RB of the -N(RB)- is not present; o when a single bond is present between -C(RA)- and -N(RB)-, the -C(RA)- is saturated and has a hydrogen substituent in addition to the RA substituent and RB of the -N(RB)- is present;
* K" is independently H, or OH;
® if present, RB is H or is a bond to the Linker L;
* R- is selected from H, OH, Ci-Cio alkyl, C2-C10 alkenyl or C2-C10 alkynyl; RJ, R3 , R4, R4', R6 and R6 are each independently selected from H, OH, Ci- Cio alkyl, C2-C10 alkenyl or Ci-Cio alkynyi, or, if Y is N, is not present; each of R5 or R5' ss independently NH2 , CO2H, H, OH, C1-C10 alkyl, C2-C10 alkenyl, C2-C10 alkynyi, is a bond to the Linker L, or, if Y is N, is not present:
R7 is H;
G'-Rb' is selected from OH, O-L, NH2, or NH-L, wherein L is the Linker L; each Y is, independently, N or C;
* each D is, independently , (CH2)n where n = 0-4, pro vided that at least one D is (CH n where n = 1-4;
* I is a spacer selected from the group consisting of the following:
Figure imgf000010_0001
Λ X A
wherem at least one of Rb, R5, R3 and G-Rb is a bond linked to Linker L or comprises Linker L. [0008] In a preferred embodiment, the IQB-CBI compound of Formula I has S,S stereochemistry as follows:
Figure imgf000011_0001
wherein ail of the substitisents of the above IQB-CBl compound are as defined above. Similarly, in a preferred embodiment, the IQB-CBI portion of the antibod -drug conjugate of Formula II also has S.S stereochemistry.
DESCRIPTION OF THE DRAWINGS
[0009] FIG, 1 shows the synthesis of IQB-acids 11 a-e.
[0010] FIG. 2 shows the synthesis of aminoCBI moiety and final assembly of an IQB- aminoCBI dirner.
[0011] FIG. 3 shows the synthesis of a hvdroxyCBl moiety and final assembly of D811, D813, D815, and D817.
[0012] FIG. 4 shows structures of IQB-amino- and hydroxy-CBI dimer compounds.
[0013] FIG. 5 shows the synthesis of an IQB-acid 11 in which the spacer group XI is selected from the XI spacers disclosed, for example, in Table I.
[0014] FIG. 6 shows the synthesis of a CBI moiety and assembly of IQB-CBI dimer variant in wliichthe XI spacer is selected from the X I spacers disclosed, for example, in Table I.
[0015] FIG. 7 shows synthesis of the linkers L.
[0016] FIG. 8 shows synthesis of Carbonate D816.
[0017] FIG. 9 shows synthesis of Carbamate D818.
[0018] FIG. 10 shows synthesis of ether derivatives (D820 and D820b.
[0019] FIG. 11 shows synthesis of a linker L.
[0020] FIG. 12 shows synthesis of a CBI moiety.
[0021] FIG. 13 shows synthesis of IQB moiety and final assembly (Part 1). FIG. 14 shows synthesis of IQB moiety and final assembly (Part 2),
FIG. 15 shows results of a binding assay for IL1RAP-IQB-CBI dimer (D816- 20)-ADCs.
FIG. 16 shows results of a binding assay for IL1 RAP-IQB-CBI dirner (D822, D824, D826,D828)-ADCs.
FIG. 17 shows target-dependent cell killing by an anti-ILlRAP-D816 ADC,
FIG. 18 shows target-dependent ceil killing by an anti-ILlRAP- D818 ADC.
FIG. 19 shows target-dependent cell killing by an anti-ILl RAP-D820 ADC,
FIG. 2,0 shows target-dependent cell killing by an anti~ILlRAP-D822 ADC
FIG. 21 shows target-dependent cell killing by an anti-ILlRAP-D824 ADC.
FIG. 22 shows target-dependent cell killing by an anti-ILl RAP-D826 ADC,
FIG. 23 shows target-dependent ceil killing by an anti-lLIRAP-D828 ADC.
[0032] This disclosure provides isoquino3idinobenzodiazepine-l{chloromethyl}-2,3- dibydro-lH-benzoje] do1e ('IQB-CBI") compounds of Fomiula I, antibody-drug conjugates of Formula II, and methods of using the compounds of Formula I and the antibody-drug conjugates of Formula II. In one aspect, the IQB-CBI compounds of Formula I having the following structure:
Figure imgf000012_0001
as described herein. In another aspect, the antibody-drug conjugates of Fomiula Π have the following structure:
Figure imgf000013_0001
Formula II
as described herein.
II. Definitions
[0033] As referred to herein, "alkyl" means a saturated, branched or straight-chain or cyclic, monovalent hydrocarbon radical having the stated number of carbon atoms (i.e., Cl- C6 means one to six carbon atoms) that is derived by the removal of one hydrogen atom from a single carbon atom of a parent alkane. Typical alkyl groups include, but are not limited to, methyl; ethyl; propyls such as propan-l-yl, propan-2-yl, cyclopropan-l-yl; butyls such as butan-l-yl, butan-2-yl, 2-methyl-propan-l-yl, 2-methyl-propan-2-yl, cyclobutan-l-yl; and the like. In some embodiments, '"alkyl" means a saturated, branched or straight-chain, monovalent hydrocarbon radical having the stated number of carbon atoms (i.e., C1-C6 means one to six carbon atoms) that is derived by the removal of one hydrogen atom from a single carbon atom of a parent alkane. Typical alkyl groups include, but are not limited to, methyl; ethyl; propyls such as propan-l-yl, propan-2-yl; butyls such as butan-l-yi, butan-2- yl, 2-methyl-propan-l-yl, 2-methyl-propan-2-yl; and the like.
[0034] As referred to herein, "alkenyl" means an unsaturated branched, straight-chain or cyclic alkyl having at least one carbon-carbon double bond derived by the removal of one hydrogen atom from a single carbon atom of a parent alkene. The group may be in either the cis or trans conformation about the double bond(s). Typical alkenyl groups include, but are not limited to, ethenyl; propenyls such as prop-l-en-l-yl, prop-l-en-2-yi, prop-2-en-l-yl, prop-2-en-2-yl, cycioprop-l-en-l -yl; cycioprop-2-en~l -yl; butenyls such as but-l-en-l-yl, but-I -en-2-yl, 2-methyl-prop-l -en-l -yl, but-2-en-l-yl, but-2-en-2-yl, buta-l,3-dien-l-yl, buta-l,3-dien-2-yl, cyclobut-l-en-l-yl, cyclobut-l-en-3-yl, cyclobuta-l,3-dien-l-yl, etc.; and the like. As used herein, "lower alkenyl" means (C2-C8) alkenyl . In some embodiments, "alkenyF' means an unsaturated branched, straight-chain alkyi having at least one carbon- carbon double bond derived by the removal of one hydrogen atom from, a single carbon atom of a parent alkene . The group may be in either the ds or trans conformation about the double bond(s). Typical alkenyl groups include, but are not limited to, ethenyl; propenyis such as prop-l-en- l-yi, prop-l-en-2-yi, prop-2-en- l-yi, prop-2-en-2-yi: butenyls such as but-l-en-1- yi, but- l-en-2-yl, 2-methyl-prop-l-en- l-yl, but~2-en~l-yl, but-2~en-2~yl, buta-1, 3-dien-l-yl, buta- 1 , 3-dien-2-yl, etc.; and the like. As used herein, "lower alkenyl" means (C2-C8) alkenyl.
[0035] As referred to herein, "'aikynyl'1 means an unsaturated branched, straight-chain or cyclic alkyl having at least one carbon-carbon triple bond derived by the removal of one hydrogen atom from a single carbon atom of a parent aikyne. Typical aikynyl groups include, but are not limited to, ethynyl; propynyls such as prop-i-yn- l-yl, prop-2-yn-l-yl, etc.:
butynyis such as but-l-yn- l -yl, but-l-yn-3-yl, but-3-yn-l-yl, etc.; and the like. As used herein, "lower aikynyl" means (C2-C8) aikynyl. In some embodiments, '"aikynyl" means an unsaturated branched, straight-chain alkyl having at least one carbon-carbon triple bond derived by the removal of one hy drogen atom from a single carbon atom of a parent aikyne. Typical aikynyl groups include, but are not limited to, ethynyl; propynyls such as prop- l-yn- l-yl, prop-2-yn-l-yl, etc.; butynyis such as but-l-yn-l-yl, but-l-yn-3-yl, but-3-yn-l-yl, etc.; and the like. As used herein, "lower aikynyl" means (C2-C8) aikynyl.
[0036] Cyclic alkyl, alkenyl and aikynyl groups are also defined by the term "cycloalkyl" which means a saturated or partially unsaturated, monocyclic, fused bicyclic or bridged polycyciic ring assembly containing from 3 to 12 ring atoms, or the number of atoms indicated. Cycloalkyl can include any number of carbons, such as C3-6, C4-6, C5-6, C3-8, C4-8, CJ-8, Cb-s, C3-9, C3-10, C.3-n, and C3-12. Saturated monocyclic cycloalkyl rings include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cyclooctyl. Saturated bicyclic and polycyciic cycloalkyl rings include, for example, norboniane, [2.2.2] bicyclooctane, decahydronaphthalene and adamantane. Cycloalkyl groups can also be partially unsaturated, having one or more double or triple bonds in the ring. Representative cycloalkyl groups that are partially unsaturated include, but are not limited to, cyclobutene, cyclopentene, cyclohexene, cyciohexadiene (1 ,3- and 1,4-isomers), cycloheptene, cycloheptadiene, cyclooctene, cyclooctadiene ( 1,3-, 1,4- and 1,5-isomers), norbornene, and norboraadiene. When cycloalkyl is a saturated monocyclic C3-8 cycloalkyl, exemplary groups include, but are not limited to cvclopropyi, cyclobutyl, cyclopentyl, cyclohexyl, cyclohepty] and cyclooctyl. When cycloalkyl is a saturated monocyclic C3-6 cycloalkyl, exemplary groups include, but are not limited to cvclopropyi, cyclobutyl, cyclopentyl, and cyclohexyl. Cycloalkyl groups can be substituted or unsubstituted.
[0037] As referred to herein, "alkylene" means a divalent alkyl moiety.
[0038] As referred to herein, "aikoxy" means an alkyl group having an oxygen atom that connects the alkyl group to the point of attachment: alkyl-O-. As for alkyl group, aikoxy groups can have any suitable number of carbon atoms, such as Ci-6. Aikoxy groups include, for example, methoxy, ethoxy, propoxy, iso-propoxy, butoxy, 2-butoxy, iso-butoxy, sec-butoxy, tert-butoxy, pentoxy, hexoxy, etc. The aikoxy groups can be further substituted with a variety of substituents described herein. Aikoxy groups can be substituted or unsubstituted.
[0039] As referred to herein, "halide" means fluoro, chloro, bromo, or iodo.
[0040] As referred to herein, "carboxamide" means a monovalent moiety having the formula -C(=0)NH2. in some embodiments, one or both of the amide hydrogens may be replaced by substituents other than hydrogen.
[0041] As referred to herein '"carboxamidyi" means a divalent moiety having the formula -C(=0)N(H)-. In some embodiments the amide hydrogen may be replaced by other substituents.
[0042] As referred to herein, "oxo" means a moiety having a formula ^ which is attached to a carbon.
[0043] As referred to herein, "'carboxyl" means a moiety having a formula -C(0)OH or - C(0)0-.
[0044] As referred to herein, "heteroalkyl" means an alkyl group of any suitable length and having from 1 to 3 heteroatoms such as N, O, and S. Additional heteroatoms can also be useful, including, but not limited to, B, Al, Si, and P. The heteroatoms can also be oxidized, such as, but not limited to, ~S(0)~ and ~S(0)2~. For example, heteroalkyl can include ethers, thioethers and alkyl-amines. The heteroatom portion of the heteroalkyl can replace a hydrogen of the alkyl group to form a hydroxy, thio or amino group. Alternatively, the heteroatom portion can be the connecting atom, or be inserted between two carbon atoms. [0045] As referred to herein, "heterocyclic" or "heterocyclyl" means a moiety that is a saturated or partially unsaturated, non-aromatic mono or multicyclic aikyl cyclic moiety- having heteroatom substitution replacing ring carbons. Heterocyclic rings of the present invention can contain 3 to 20 ring atoms, where from 1 to 5 or more of the ring atoms are a heteroatom such as N, O or S. Additional heteroatoms can also be useful, including, but not limited to, B, A3, Si and P. The heteroatoms can also be oxidized, such as, but not limited to, ~S(Q)~ and -8(0)2-, Heterocyclic groups can include any number of ring atoms, such as, 3 to 6, 4 to 6, 5 to 6, 3 to 8, 4 to 8, 5 to 8, 6 to 8, 3 to 9, 3 to 10, 3 to 1 1 , or 3 to 12 ring members. Any suitable number of heteroatoms can be included in the heterocyclic groups, such as I, 2, 3, 4, or 5, or 1 to 2, 1 to 3, 1 to 4, 1 to 5, 2 to 3, 2 to 4, 2 to 5, 3 to 4, or 3 to 5. Heterocyclic groups can have from 3 to 8 ring members and from 1 to 4 heteroatoms, or from
3 to 8 ring members and from 1 to 3 heteroatoms, or from 3 to 6 ring members and from 1 to
4 heteroatoms, or from 3 to 6 ring members and from 1 to 3 heteroatoms. Multicyclic heterocyclic moieties may have fused rings. 'Typical heterocyclic groups include, but are not limited to, tetrahydrofuranyl (e.g., tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, etc.), piperidinyl (e.g., piperidin-l-yl, piperidin-2-yl, etc.), morpholinyl (e.g., morpholin-3-yl, morpholin-4-yl, etc.), piperazinyl (e.g., piperazin-l-yi, piperazin-2-yl, etc.), and the like.
[0046] As referred to herein, "aromatic" or "aryi" means a monovalent aromatic hydrocarbon group having the stated number of carbon atoms (i.e., C6-C14 means from 6 to 14 carbon atoms) derived by the removal of one hydrogen atom from a single carbon atom of a parent aromatic ring system. Typical aryl groups include, but are not limited to, groups derived from aceanthrylene, acenaphthylene, acephenanthrylene, anthracene, azulene, benzene, chrysene, coronene, fluoranthene, fluorene, hexacene, hexaphene, hexylene, as- indacene, s-indacene, indane, indene, naphthalene, octacene, octaphene, octal one. ovaSene, pentacene, pentalene, pentaphene, perylene, phenalene, phenanthrene, picene, pleiadene, pyrene, pyranthrene, rubicene, triphenylene, trinaphthalene, and the like, as well as the various hydro isomers thereof. Specific exemplary aryls include phenyl and naphthyi.
[0047] As referred to herein, "heteroaromatic" or "heteroaryl" means a monocyclic or fused bicyclic or tricyclic aromatic ring assembly containing 5 to 16 ring atoms, where from 1 to 5 of the ring atoms are a heteroatom such as N, O or S. Additional heteroatoms can also be useful, including, but not limited to, B, Al, Si and P. The heteroatoms can also be oxidized, such as, but not limited to, ~S(0)~ and ~S(0)2~. Heteroaryl groups can include any number of ring atoms, such as, 5 to 6, 5 to 8, 6 to 8, 5 to 9, 5 to 10, 5 to 11, or 5 to 12 ring members. Any suitable number of heteroatoms can be included in the heteroaryl groups, such as 1, 2, 3, 4, or 5, or 1 to 2, 1 to 3, 1 to 4, 1 to 5, 2 to 3, 2 to 4, 2 to 5, 3 to 4, or 3 to 5. Heteroaryl groups can have from 5 to 8 ring members and from I to 4 heteroatoms, or from 5 to 8 ring members and from 1 to 3 heteroatoms, or from 5 to 6 ring members and from 1 to 4 heteroatoms, or from 5 to 6 ring members and from 1 to 3 heteroatoms. The heteroaryl group can include groups such as pyrrole, pyridine, imidazole, pyrazole, triazole, tetrazole, pyrazine, pyrimidme, pyridazine, triazine (1 ,2,3-, 1,2,4- and 1,3,5-isomers), thiophene, furan, thiazole, isothiazole, oxazole, and isoxazole. The heteroaryl groups can also be fused to aromatic ring systems, such as a phenyl ring, to form members including, but not limited to, benzopyrroles such as indole and isoindole, benzopyridmes such as quinoline and isoquinoline, benzopyrazine (quinoxaline), benzopyrimidine (quinazoline), benzopyridazines such as phthalazine and cinnoline, benzothiophene, and benzofuran. Other heteroaryl groups include heteroaryl rings linked by a bond, such as bipyridine. Heteroaryl groups can be substituted or unsubstituted.
[0048] As referred to herein, "Ci-Cu" means the range of number of carbon atoms included in the group described. For example, a C1-C12 alkyi has from one carbon to 12 carbon atoms, and may be any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 carbons. A Ci alky! is methyl, a Ci alkyl is ethyl and so on. References to Ci-Cio means one to ten carbons, Ci- Ce means one to sixe carbons, C1-C3 means one to three carbons, and etc.
[0049] As referred to herein, "substituted" means a moiety having a hydrogen radical removed, and another non-hydrogen substituent replacing it. More than one substituent maybe incorporated in any moiety, as long as the rule of chemical valency is observed.
Substituents suitable for use in alkyl, alkenyl, aikynyl, aromatic or heterocyclic groups include, but are not limited to, the following substituents: -OH,
Figure imgf000017_0001
I IK . -NR2, - CO2H, -CO2R, -C(0)NH2, -C(0)NHR, -C(0)NR2, halide, oxo, and R, where R is a Ci-Ce alkyl.
[0050] As referred to herein, a squiggly bond (^ ) denotes a stereocenter of the compounds of the present inveion. It will be understood by those of skill in the art that that bond will determine the chirai configuration of the molecule (R or S and eventually dextro- or laevorotary effects). Hashed and wedged bonds are used to denote specific chirai configurations. The IQB-CBI compounds of the present invention, as well as the antibody- drug conjugates that incorporate such IQB-CBT compounds, can have, for example, the following stereochemistries: S,S: R,R: S,R and R,S. In the IQB-CBI compounds of Formula I, as well as in the antibody-drug conjugates that incorporate the IQB-CBI compounds of Formula II, the S,S stereochemistry is preferred, and it is further preferred that the IQB-CBI compound of Formula I is stereoisomerically or enantiomerically pure (at least 80% enantiomerically pure, at least 85% enantiomerically pure, at least 90% enantiomerically pure, at least 95% enantiomerically pure, at least 97% enantiomerically pure, at least 100% enantiomerically pure).
[0051] As referred to herein, the term "nucleic acid", refers to a linear polymer of nucleosides (including deoxyribonucleosides, ribonucleosides, or analogs thereof) joined by inter-nucleosidic linkages. Nucleic add may encompass the term "polynucleotide" as well as "oligonucleotide". The linear polymer may be represented by a sequence of letters, such as "ATGCCTG," where it will be understood that the nucleotides are in 5' to 3' order from left to right, and that "A" denotes deoxyadenosine, "C" denotes deoxycytidime, "G" denotes deoxyguanosine, and "T" denotes deoxythyrnidine, unless otherwise noted. Another natural nucleotide is "U", denoting uridine. The letters A, C, G, T and U can be used to refer to the bases themselves, to nucleosides, or to nucleotides comprising the bases, as is standard in the art. In naturally occurring nucleic acids, the inter-nucleoside linkage is typically a phosphodiester bond, and the subunits are referred to as "nucleotides." Nucleic acids may also include other inter-nucleoside linkages, such as phosphorothioate linkages, and the like. Such analogs of nucleotides that do not include a phosphate group are considered to fall within the scope of the term "nucleotide" as used herein, and nucleic acids comprising one or more inter-nucleoside linkages that are not phosphodiester linkages are still referred to as "polynucleotides", "oligonucleotides", etc.
[0052] The term "amino acid" refers to both the twenty "canonical" or "natural" amino adds, as well "non-canonical" amino acids, also referred to as "unnatural" amino acids, such as modified or synthetic amino acids, as well as amino acid analogs and ammo acid mimetics that function similarly to naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code. Modified ammo acids include, e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
[0053] Linker L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxyi, carboxamide, carboxamidy], urethanyl, branched, cyclic, unsaturated, amino acid, heterocyclic, aromatic or heteroaromatic moieties. Linker L may be unbranched or branched, flexible or rigid, short or long and may incorporate any combination of moieties as deemed useful. In some embodiments, at least a portion of the linker L may have a polyalkylene oxide polymeric region, which may enhance solubility of the compound of Formula I or II. In some embodiments, the linker L may have a repeating unit of ethy lene glycol, and may have a numbe of repeating ethylene glycol units of about 1 to about 25, or any number
therebetween. In some embodiments, L may include about 3 to about 20, about 4 to about 15, about 5 to about 12 or about 6 to about 10 ethylene glycol units. In some embodiments, at least a portion of Linker L may include one or more ammo acid moieties which may provide enhanced solubility for the compound of Formula I or II or may provide amino acid sequences to enhance target binding, enhance compatibility with a target binding agent, or enhance target binding recognition. In oilier embodiments, the linker L may include one or more amino acid moieties that provide a suitable substrate motif for a protease. When a set of amino acid moieties are incorporated into the linker L that provide a substrate motif specific for a selected protease, the cytotoxic drug compound of Formula I or II may be released from a target bound conjugate to provide localized cytotoxic effects. Such substrate motifs are known in the art and may be incorporated into the linker L as desired to provide selective release from the target bound conjugate. This selectivity can be based on known presence of a desired protease within the localized delivery region of the conjugate drag. Other polymeric types of moieties may be incorporated in the linker L, such as polyacids, polysaccharides, or polyamines. Other moieties such as substituted aromatic or
heteroaromatic moieties may be used to enhance rigidity or provide synthetically accessible sites on substituents therein for linking to reactive moieties or to the compound of Formula 1 or II. [0054] The linker L can include a variety of groups or moieties. For example, the linker L can include a spacer (-YL-), an ammo acid sequence (XAA), and a polyethyleneglycol (PEG or -CH2CH2O-) moiety. A representative linker can have the following structure:
Figure imgf000020_0001
[0055] The Amino Acid unit (~XAA-), when present, links the PEG unit, if present, or reactive moiety to the Spacer unit if the Spacer unit is present. XAA is a dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, heptapeptide, octapeptide, nonapeptide, decapepiide, undecapeptide or dodecapeptide unit. Each amino acid of the XAA group can be arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, glutamine, cysteine, selenocysetein, glycine, proline, alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, tryptophan, or citrulline (Cit). The XAA unit of the compounds of the invention can be emzymatieally cleaved by one or more enzymes, including a tumor- associated protease, to liberate the IQB-CBI unit. Preferred XAA units include, but are not limited to, Ala-Val, Val-Ala, and Val-Cit.
[0056] The spacer -YL-, when present, links an Amino Acid unit to the IQB unit when an Amino Acid unit is present. Spacer units are of two general types: self-immoiaiive and non-self-immolative. A non self-immoiative Spacer unit is one in which part or all of the Spacer unit remains bound to the IQB unit after cleavage, particularly enzymatic, of an Amino Acid unit from the Antibody-Drug Conjugate (ADC). Examples of a non self- immolative Spacer unit include, but are not limited to a (glycine-glycine) Spacer unit and a glycine Spacer unit. When a compound of the invention containing a glycine-glycine Spacer unit or a glycine Spacer unit undergoes enzymatic cleavage via a tumor-cell associated- protease, a cancer-cell -associated protease or a lymphocyte -associated protease, a glycine- glycine-Drug moiety or a glycine-Drug rnoieiy is cleaved from L-Aa-Ww-. In one embodiment, an independent hydrolysis reaction takes place within the target cell, cleaving the glycine-Drug unit bond and liberating the Drug.
[0057] In a preferred embodiment, -YL- is a p-aminobenzyl alcohol (PAB) unit:
Figure imgf000020_0002
[0058] In one embodiment, a non self-immolative Spacer unit (~YL~) is -Gly-Gly-.
[0059] In another embodiment, a non self-immolative the Spacer unit (-YL-) is -Giy-.
[0060] In one embodiment, the invention provides a compound in which the Spacer unit is absent, or a pharmaceutically acceptable salt or solvate thereof.
[0061] Alternatively, a compound of the invention containing a self-immolative Spacer unit can release IQB or the CBI unit without the need for a separate hydrolysis step. In this embodiment, -YL- is a PAB group that is linked to -XAA - via the amino nitrogen atom of the PAB group, and connected directly to either the IQB or the CBI unit via a carbonate, carbamate or ether group.
[0062] In some embodiments, -L-Rx has the structure:
Figure imgf000021_0001
wherein:
T is a self-immolating group, such as those described above as well as a p- aminobenzyl oxycarbonyl group or a p-aminobenzyl alcohol (PAB) unit; t is 0 or 1;
Aa and each Ab are independently selected from the group consisting of alanine, β- alanine, γ-aminobutyric acid, arginine, asparagine, aspartic acid, y- carboxyglutamic acid, citmlline, cysteine, glutamic acid, giutarnine, glycine, histidine, isoleucine, leucine, lysine, methionine, norleucine, norvaline, ornithine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; p is 1, 2, 3, or 4;
q is 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, or 12:
n is 1, 2, 3, 4, or 5;
s is 0 or 1 ; Rx is
Figure imgf000022_0001
the wavy line indicates the position, i.e., point, of attachment.
[0001] Other examples of self-immolative spacers include, but are not limited to, aromatic compounds that are electronically similar to the PAB group such as 2- aminoimidazol -5 -methanol derivatives (see Hay et a! ., Bioorg. Med. Chem. Lett , 1999, 9, 2237) and ortho or para-aminobenzylacetals. Spacers can be used that undergo cyclization upon amide bond hydrolysis, such as substituted and unsubstituted 4-aminobutyric acid amides (Rodrigues et al., Chemistry Biology, 1995, 2, 223), appropriately substituted bicyclo[2.2.1] and bicyclo[2.2.2] ring systems (Storm, et al., J. Amer. Chem. Soc, 1972, 94, 5815) and 2-aminophenylpropionic acid amides (Amsberry, et al., J Org. Chem. , 1990, 55, 5867). Elimination of amine -containing drags that are substituted at the a-position of glycine (Kingsbury, et al., J. Med. Chem.. , 1984, 27, 1447) are also examples of self-immolative spacer useful in the Compounds of the Invention .
[0002] Preferred Spacer units (-YL-) can be:
Figure imgf000023_0001
[0003] For example, the linker L can include ethylene glycol repeating units, and an amino acid sequence. In some embodiments, Sinker L includes the formula:
Figure imgf000023_0002
wherein XAA is an amino acid sequence.
[0004 Any suitable number of ethylene glycol units can be used in the linker L of the present invention. For example, the linker L can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50 or more ethylene glycol units (inclusive of ail ranges within the 1 to 40 ethylene glycol units, including the lower and upper limits). For instance, the linker L can include 1 to 25 ethylene glycol units, preferably 2 to 20 ethylene glycol units, more preferably 2 to 15, even more preferably 5 to 15 ethylene glycol uints. In some embodiments, the linker L can include 8 ethylene glycol units. Several commercially available ethylene glycol groups (polyethylene glycol, PEG) are suitable in the linker L, such as H2N-dPEG®8-C(0)OH, having a discrete ("d") polyethylene glycol having 8 ethylene glycol repeating units. Otlier discrete PEG units are commercially available and known to one of skill in the art, such as by Advanced ChemTech. One of skill in the art recognizes that H2N-dPEG®8-C(0)OH has the following formula:
Figure imgf000023_0003
Accordingly, when FfcN-dPEG®8-C(0)OH is incorporated into the linker L of the present invention, it can be written as -H -dPEGs-C(O)- or -HN-dPEGs-CEbCFfc-CXO)-.
0005 In some embodiments, the linker L includes the formula:
Figure imgf000023_0004
wherein PEG has 1-50 ethylene glycol units, and XAA is an amino acid sequence.
[0006 In some embodiments, the linker L includes the formula: -HN-PEG-CH2CH2-C(0)-XAA- wherein PEG has 1 -50 ethylene glycol units, and XAA is an amino acid sequence.
[0007] The amino acid portion of the linker L can include any suitable number of amino acid moieties, as described above. For example, the amino acid sequence XAA can include from 1 to 100 amino acid moieties, or from 1 to 10 amino acid moieties, or from 1 to 5 amino acid moieties. The linker L can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more ammo acid moieties. In some embodiments, the linker L includes 2 amino acid moieties. In some embodiments, the linker L includes the amino acid sequence Val-Ala. In some embodiments, the linker L includes the formula:
-H -PEGe-C(0)-Val-Ala- wherein PEGs has 8 ethylene glycol units.
[0008] In some embodiments, the linker L includes the formula:
-HN-PEG8-CH2CH2-C(0)-Val-Ala- wherein PEGs has 8 ethylene glycol units.
[0009] The linker L can also include a variety of other connecting groups that connect the ethylene glycol portion to the ammo acid sequence, or connect the ethylene glycol or amino acid sequence to the reactive moiety Rx, substance Sc, or the compound of Formula ! andll. For example, the amino acid sequence can be connected to the compound of Formula I andll via a 4-amino benzyl carboxylate group. In some embodiments, the ethylene glycol portion can be directly linked to the reactive moiety Rx or the substance Sc. In some embodiments, the linker L has the formula:
Figure imgf000024_0001
[0010] The linker L can also include a variety of other connecting groups that connect the ethylene glycol portion to the amino acid sequence, or connect the ethylene glycol or amino acid sequence to the reactive moiety Rx, substance Sc, or the compound of Formula 1 and II. For example, the amino acid sequence can be connected to the compound of Formula I and II via a 4-amino benzyl carboxylate group. In some embodiments, the ethylene glycol portion can be directly linked to the reactive moiety Rx or the substance Sc. In some embodiments, the linker L has the formula:
Figure imgf000025_0001
[0011] Rx is a reactive moiety. Rx may be any suitable reactive moiety as long as it is capable of reacting with a correspondingly reactive moiety present on the substance Sc, which may be a target binding agent as described herein. In various embodiments, Sc is a protein or a portion of a protein, and has accessible conjugatable moieties such as:
[0012] Thiols/disulfides. Reactive moieties Rx that can react with thiols or disulfides include maleimide, iodoacetamide, azide, thiazole and pyrridopyridazine. Disulfides may also be labeled by use of a bisulfone reactive moiety. Additionally malemide reactive moieties can react with engineered selenocysteme moieties.
[0013] Amines. Reactive moieties x that may be used to couple the IQB or the CBI units of the IQB-CBI compounds to a target binding agent Sc include isothiocyanate, succinimidyl ester, sulfonyl lialide, carboxylic acids ( n the presence of carbodiimide coupling reagents), sulfosuccinimidyl ester, 4-sulfotetrafluorophenyl ester, tetrafluorophenyl ester, and sulfodichlorophenol ester. This list is in no way limiting and other reactive moieties Rx that are capable of reacting with an amine of a target binding agent Sc may be used.
[0014] Aldehydes/ketones. These moieties may be introduced into a target binding agent Sc and subsequently reacted with a compound of Formula I and II having a -L-Rx where the reactive moiety Rx is hydrazine, semihydrazide, carbohydrazide, or
hydroxylamine. This list is in no way limiting and other reactive moieties Rx that are capable of reacting with an aldehyde of a target binding agent Sc may be used.
[0015] Other reactive moieties Rx that are useful in the compounds of Formula I and
Π include azides, phosphmes, or alkynes which can be used in Staudinger reactions, Pictet- Spengler reactions and/or Click-type chemistry (Copper containing or not) for selectively labeling of proteins including antibodies and their fragments. This is a non-limiting list of reactive moieties Rx useful for reacting with engineered sites on target binding agents Sc. [0016] In some embodiments, Rx may be maleimide, bis-sulfone, iodoacetamide, azide, isothiocyanate, succinimidyl ester, sulfonyl halide, carboxylic acids, semihydrazide, carbohydrazide, hydroxylamine, phosphine, or alkyne.
[0017] -L-Rx is a linker L attached to a reactive moiety Rx. -L-Rx may be used in a compound of Formula I or 11 to form a reagent bearing IQB-CB1 compounds that can attach to a substance Sc. which may be a target binding agent as described herein. Any combination of linker L and reactive moiety Rx described herein may be used in the compounds of Formula I or II. See FIG. 7 for some exemplary -L-Rx.
[0018] A number of other chemistries are known for attachment of compounds to antibodies. U.S. Patent No. 7,595,292 (Brocchini et al.) refers to linkers that form thioesters with the suifurs in a disulfide bond of an antibody. U.S. Patent No. 7,985,783 (Carico et ai.) refers to the introduction of aldehyde residues into antibodies, which are used to couple compounds to the antibody.
[0019] Sc is a target binding agent selected from a protein, a portion of a protein, a peptide, or a nucleic acid. In some embodiments, a target-binding agent that is a protein may include an antibody, an antibody fragment, or an antibody single-chain fragment variable ("scFV"). The target-binding agent may bind to a tumor-associated antigen, a cancer-stem- cell associated antigen or a viral antigen.
[0020] In various embodiments, the target-binding agent Sc may bind to a target selected from an acute myeloid leukemia (AML M4) ceil, an acute promyelocyte leukemia cell, an acute lymphoblastic leukemia cell, an acute lymphocytic leukemia cell, a chronic lymphocytic leukemia cell, a chronic myeloid leukemia cell, a chronic T-cell lymphocytic leukemia, a myeiodysplastic syndromic cell, a multiple myeloma cell, a prostate carcinoma cell, a renal cell adenocarcinoma cell, a pancreatic adenocarcinoma cell, a lung carcinoma cell or a gastric adenocarcinoma cell, a gastric adenocarcinoma cell, a breast cancer cell, a colon cancer cell, a melanoma cell, a thyroid cancer cell, an ovarian cancer cell, a bladder cancer cell, a liver cancer cell, a head and neck cancer cell, an esophageal cancer cell, a hodgkin lymphoma cell, a non-hodgkin lymphoma cell, a mesothelioma cell, a neuroblastoma cell, a neuroendocrine tumor cell, a neurofibromatosis type 1 (NFl) cell, a neurofibromatosis type 2 (NF2) or an osteosarcoma cell . [0021] In some other embodiments, the target-binding agent Sc may bind a target selected from CLL-L IL1RAP, T1M-3, CD 19, CD20, CD22, RQR1, mesothelin, CD33, CD123/EL3Ra, GPR 14, c-Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA-125, Muc-1 , AFP, Glycolipid F77, EGFRvIII, GD-2, NY-ESO-1 TCR, tyrosinase, TRPI/gp75, g l00/pmel-17, Me lan- A/MART- 1 , Her2/neu, WT1, EphA3, telomerase, HPV E6, HPV E7, EBNA1, BAGE, GAGE and MAGE A3 TCRSLITRK6, ENPP3, Nectm-4, CD27, SLC44A4, CAIX, Cripto, CD3G, MUC16, GPNMB, BCMA, Trop-2, Tissue Factor (TF), CanAg, EGFR, av-integrin, CD37, Folate Receptor-a, CD138, CEACAM5, CD56, CD70, CD74, GCC, 5T4, CD79b, Steapl, Napi2b, Lewis Y Antigen, LIV, c-RET, DLL3, EFNA4, Endosialin/CD248.
[0022] In yet other embodiments, the target-binding agent Sc may be a bi-specific antibody /antibody fragment. In some embodiments, the bi-specific antibody/antibody fragment binds to one or two targets selected from CLL-1, 1LIRAP, T1M-3, CD 19, CD20, CD22, ROR1, mesothelin, CD33, CD123/IL3Ra, GPR114, c-Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA- 125, Muc-1, AFP, Glycolipid F77, EGFRvIII, GD-2, NY- ESO-1 TCR, tyrosinase, TRPI/gp75, gpl00/pmel-17, Melan-A MART-1, Her2/neu, WT1, EphA3, telomerase, HPV E6, HPV E7, EBNA1, BAGE, GAGE and MAGE A3
TCRSLITRK6, ENPP3, Nectin-4, CD27, SLC44A4, CAIX, Cripto, CD30, MUC16,
GPNMB, BCMA, Trop-2, Tissue Factor (TF), CanAg, EGFR, av-integrin, CD37, Folate Receptor, CDI38, CEACAM5, CD56, CD70, CD74, GCC, 5T4, CD79b, Steapl, Napi2b, Lewis Y Antigen, LIV, c-RET, DLL3, EFNA 4, Endosialin/CD248, Ly6e (RIG-e), CD79a, CD274 (PD-L1), CD38, DLL4, CD319 (SLAM7).
"I- Conjugates
[0023] Target binding moieties can be attached to an IQB-CBI compound of this disclosure using a variety of known cross-linking agents. Methods for covalent or non- covalent attachment of moieties to polypeptides are well known in the art. Such methods may include, but are not limited to, use of chemical cross-linkers, photoactivated cross-linkers and/or bifunctional cross-linking reagents. Exemplary methods for cross-linking molecules are disclosed in U.S. Patent No. 5,603,872 and U.S. Patent No. 5,401 ,511. Non-limiting examples of cross-linking reagents include glutaraldehyde, bifunctional oxirane, ethylene glycol diglycidyl ether, carbodiirnides such as l-ethyl-3-(3-dimethylaminopropyl) carbodiimide or dicyclohexylcarbodiimide, bisimidates, dinitrobenzene, N- hydroxysuccinimide ester of suberic acid, disuccinimidyl tartarate, dimethyl-3,3'-dithio- bispropionimidate, azidoglyoxal, N-succinimidyl-3-(2-pyridyldithio)propionate and 4- (bromoadminoethyl)-2-nitrophenylazide.
[0024] In some embodiments, the target binding moiety comprises an antibody. The term "antibody " refers to a polypeptide comprising a framework region from an
immunoglobulin gene, or fragments thereof ("antibody fragment"), that specifically bind and recognize an antigen . Typically, the "variable region" contains the antigen-binding region of the antibody (or its functional equivalent) and is most critical in specificity and affinity of binding. An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kD) and one "heavy" chain (about 50-70 kD).
[0025] An "isotype" is a class of antibodies defined by the heavy chain constant region. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the isotype classes, IgG, IgM, IgA, IgD and IgE, respectively. Antibodies can exist as intact immunoglobulins or as any of a number of well -characterized fragments that include specific antigen-binding activity, e.g., F(ab)'2, or an Fab' monomer.
[0026] A "monoclonal antibody" refers to a clonal preparation of antibodies with a single binding specificity and affinity for a given epitope on an antigen . A "polyclonal antibody" refers to a preparation of antibodies that are raised against a single antigen, but with different binding specificities and affinities. A "chimeric antibody" is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region, CDR, or portion thereof) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule w hich confers new properties to the chimeric antibody (e.g., an enzyme, toxin, hormone, growth factor, drug, etc.); or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity (e.g., CDR and framework regions from different species).
[0027] A "humanized antibody" refers to an immunoglobulin molecule antibodies in which the antigen binding loops, /'. e. , CDRs, obtained from the VH and VL regions of a non- human antibody are grafted to a human framework sequence. Humanization, i.e., substitution of non-human CDR sequences for the corresponding sequences of a human antibody, can be performed following the methods described in, e.g., U.S. Patent Nos. 5,545,806; 5,569,825; 5,633,425; 5,661,016; Riechmann et al. Nature 332:323-327 (1988); Marks et al,
Bio/Technology 10:779-783 (1992); Morrison, Nature 368:812-13 (1994); Fishwild et al , Nature Biotechnology 14:845-51 (1996). Transgenic mice, or other organisms such as other mammals, may also be used to express humanized or human antibodies, as disclosed in U.S. Patent No. 6,673,986.
[0028] The term "cysteine substituted antibody," as used herein, refers to an antibody comprising at least one non-naturally occurring constant region immunoglobulin amino acid residue that has been substituted with cysteine. A non-naturally occurring substitution is one that is not isotypic. In one embodiment, the substituted residues are heavy chain constant regions. Non-limiting examples of cysteine substituted antibodies include the substitutions S 156C and S239C,
[0029] The terms "antigen", "antibody target", and like terms refer to a molecule, compound, or complex that is recognized by an antibody, i.e. can be specifically bound by the antibody. The antibody binds to an "epitope" on the antigen.
[0030] The terms "specific for," "specifically binds," and like terms refer to a molecule (e.g., antibody or antibody fragment) that binds to a target with at least 2-fold greater affinity than non-target compounds, e.g., at least any of 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 25-fold, 50-fold, or 100-fold greater affinity. For example, an antibody that specifically binds a primary antibody will typically bind the primary antibody with at least a 2-fold greater affinity than a non-primary antibody target (e.g., an antibody from a different species or of a different isotype, or a non-antibody target).
[0031] The term "captures" with respect to an antibody target (e.g., antigen, analyte, immune complex), typically indicates that an antibody binds a majority of the antibody targets in a pure population (assuming appropriate molar ratios). For example, an antibody that binds a given antibody target typically binds to at least 2/3 of the antibody targets in a solution (e.g., at least any of 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%). One of skill will recognize that some variability will arise depending on the method and/or threshold of determining binding. [0032] Antibodies or fragments thereof may have functional groups which may be attractive targets for conjugation by compounds of Formula I or 11 having a -L-Rx, as described above. A compound incorporating -L-Rx where maleimide is the reactive moiety may react with thiols of cysteine residues or disulfides formed from two cysteine side chains, where accessible on the antibody or fragment thereof. Alternatively, azido or
iodoacetamidyl reactive moieties attached to a linker of the compound of Formula I or 11 can also form a conjugate with a thiol of cysteine residues or disulfides formed intramolecularly. Disulfides can be specifically targeted by use of a compound of Formula ΐ or II having -L-Rx where the reactive moiety is a bis-sulfone, which can attach to both side chains at once.
[0033] Lysine side chains of antibodies or fragments thereof can be conjugated with a compound of Formula I or II having a -L-Rx where the reactive moiety is selected but not limited to isothiocyanate, succinimidyl ester, suifonyl haiide, carboxylic acid,
sulfosuccinimidyl ester, 4-sulfotetrafluorophenyl ester, tetrafiuorophenyl ester, and sulfodichlorophenol ester. When a carboxylic acid is the reactive moiety, the attachment reaction to the lysine side chain amino moiety is performed in the presence of a coupling reagent such as carbodiimide, which activates the carboxylic acid in situ.
[0034] Glutamine side chains may be targeted by an IQB-CBI having -L-Rx where the reactive moiety is an aminoalkyl moiety. The amino moiety can be a substrate for modified transglutaminase to provide a glutaminyl conjugated IQB-CBI.
[0035] Aldehydes or ketones may be produced on a target binding agent such as an antibody or a fragment thereof, by oxidative treatments, often of the glycan portion of the antibody. Periodate or other oxidizing agents can be used to produce these carbonyl containing sites which may be targeted by a IQB-CBI compound of Formula I having a -L- Rx, where the reactive moiety is hydrazine, semihydrazide, carbohydrazide, or
hydroxylamine.
[0036] Engineered functional moieties on the target binding agent, such as an antibody or fragment thereof, may also be conjugated by the compounds of Formula of 1 or II having a -L-Rx. Seienocysteine may be incorporated ribosomaHy in engineered antibody fragments, which may afford a highly discriminating conjugation reaction with either an IQB or CBI unit having a maleimide reactive moiety. [0037] Azido or cyclooctyne moieties may be engineered into a target binding agent which can then permit the opposite reactive moiety, cyclooctynyl or azidyl reactive groups of an IQB having a -L-Rx, using copper-free click chemistry.
[0038] Introduction of unnatural amino acids via ribosomal incorporation can introduce a para-acetyl phenylalanine into a target binding agent. The acetyl group can be conjugated with an IQB or a CBI having a -L-Rx where the reactive moiety is an aminooxy reactive group, providing an oxime conjugation product of the target binding agent. Another unnatural amino acid introduced via this process, can provide an azidyl- derivative of lysine which can be reacted with an IQB or a CBI having a -L-Rx where the reactive moiety is a cyclooctyne, and copper-free click chemistry is used.
[0039] These examples are in no way limiting; many oilier approaches to defined conjugation of a target binding agent such as an antibody or fragment thereof are envisioned by the use of the IQB-CBI compounds of Fonnula I having -L-Rx to form conjugates of formula having -L-Sc.
[0040] In some embodiments, an antibody-drug conjugate may have a structure of
Formula II as defined herein.
IV. Pharmaceutical Compositions
[0063] Dosage forms containing compounds of the present invention as the active ingredient may be advantageously used to treat or prevent proliferative diseases. The dosage forms may be administered or applied singly, or in combination with other agents. The formulations may also deliver a compound of the present invention to a subject in combination with another pharmaceutically active agent, including another compounds.
[0064] The formulations, for human medical use, of the present disclosure comprise an active ingredient in association with a pharmaceutically acceptable carrier therefor and optionally other therapeutic ingredient(s). The carrier(s) must be "acceptable" in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient thereof.
[0065] The terms ''effective amount," "effective dose," "therapeutically effective amount," etc. refer to that amount of the therapeutic agent sufficient to ameliorate a disorder, as described herein. For example, for the given parameter, a therapeutically effective amount will show an increase or decrease of therapeutic effect of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy can also be expressed as "-fold" increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
[0066] Dosage forms can be prepared for mucosal (e.g., nasal, sublingual, vaginal, buccal, or rectal), parenteral (e.g., subcutaneous, intravenous, intramuscular, or intraarterial injection, either bolus or infusion), oral, or transdermal administration to a subject. Examples of dosage forms include, but are not limited to: dispersions; suppositories; ointments;
cataplasms (poultices); pastes; powders; dressings; creams; plasters; solutions; patches;
aerosols (e.g., nasal sprays or inhalers); gels; liquid dosage forms suitable for oral or mucosal administration to a subject, including suspensions (e.g., aqueous or non-aqueous liquid suspensions, oil-in-water emulsions, or a water-in-oil liquid emulsions), solutions, and elixirs; liquid dosage forms suitable for parenteral administration to a subject; and sterile solids (e.g., crystalline or amorphous solids) that can be reconstituted to provide liquid dosage forms suitable for parenteral administration to a subject.
[0067] Injectable (e.g., intravenous) compositions can comprise a solution of the IQB- CBI compounds or the antibody-drug conjugates of the present invention suspended in an acceptable carrier, such as an aqueous carrier. Any of a variety of aqueous carriers can be used, e.g., water, buffered water, 0.4% saline, 0.9% isotonic saline, 0.3% glycine, 5% dextrose, and the like, and may include glycoproteins for enhanced stability, such as albumin, lipoprotein, globulin, etc. Often, normal buffered saline (135-150 mM NaCl) will be used. The compositions can contain pharmaceutically acceptable auxiliary substances to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, e.g., sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chioride, sorbitan monolaurate, triethanolamine oleate, etc. In some embodiments, the composition can be formulated in a kit for intravenous
administration.
[0068] Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intratumoral, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. Injection solutions and suspensions can also be prepared from sterile powders, granules, and tablets. In the practice of the present invention, compositions can be administered, for example, by intravenous infusion, topically, intraperitoneally, intravesical ly, or intrathecally. Parenteral administration and intravenous administration are the preferred methods of administration. The formulations of the IQB-CBI compounds or the antibody-drag conjugates of the present invention can be presented in unit- dose or multi-dose sealed containers, such as ampoules and vials.
[0069] The pharmacologically active compounds of the disclosure are useful in the manufacture of pharmaceutical compositions comprising an effective amount thereof in conjunction or admixture with the excipients or carriers suitable for either enteral or parenteral application. Preferred are tablets and gelatin capsules comprising the active ingredient together with one or more of the following: (a) diluents, such as lactose, dextrose, sucrose, mannitol, sorbitol, cellulose, glycine and the like; (b) lubricants, such as silica, talcum., stearic acid, its magnesium or calcium salt, poiyethyleneglycol and the like: for tablets also; (c) binders, such as magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethyl -cellulose or polyvinylpyrrolidone and the like: and, if desired, (d) disintegrants, such as effervescent mixtures and the like: and (e) absorbents, colorants, flavors, and sweeteners and the like.
[0070] Hie formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods well-known in the art of pharmacy. All methods include the step of bringing the active ingredient into association with the earner which constitutes one or more accessory- ingredients. In general, the formulations are prepared by uniformly and intimately bringing the active ingredient into association with a liquid carrier or a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation.
[0071 ] Said pharmaceutical compositions may be sterilized and/or contain adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure, and/or buffers. In addition, they may also contain other therapeutically valuable substances. Said compositions are prepared according to conventional mixing, granulating, or coating methods, respectively, and contain about 0.1 to 75%, preferably about 1 to 50%, of the active ingredient. [0072] The concentration of the active agent in the formulation can vary a great deal, and will depend on a variety of factors, including the disease or condition to be treated, the nature and activity of the active agent, the desired effect, possible adverse reactions, the ability and speed of the active agent to reach its intended target, and other factors within the particular knowledge of the subject and physician. The formulations will typically contain on the order of about 0.5 wt % to 50 wt % active agent, preferably about 0.5 wt % to 5 wt % active agent, optimally about 5 wt % to 20 wt % active agent.
[0073] An IQB-CBI compound or an IQB-CBI antibody -drug conjugate of the present invention can also be formulated to provide more than one active compound, e.g., additional chemotherapeutic or cytotoxic agents, cytokines, or growth inhibitory agents. The active ingredients may also be prepared as sustained-release preparations (e.g., semi-permeable matrices of solid hydrophobic polymers (e.g., polyesters, hydrogels (for example, poly (2- hydroxyethyl-methacrylate), or poly (vinylalcohol)) or poiyiactides). The antibodies and immunocongugates can be entrapped in a nanoparticle prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
hydroxymethylcellulose or gelatin microcapsules and poly- (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in
macroemulsions.
[0074] IQB-CBIs or IQB-CBI antibody-drug conjugates of this disclosure may take the form of a pharmaceutically acceptable salt, e.g., a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound. Such salts include: ( 1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like: or formed with organic acids such as acetic acid, butyric acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, pyruvic acid, lactic acid, valeric acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, 3-(4-hydroxybenzoyl) benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic acid, 2-hydroxyethanesulfonic acid, benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2-naphthalenesulfonic acid, 4- toluenesulfonic acid, camphorsulfonic acid, 4-methylbicycloj 2.2.2 j-oct-2-ene-l-carboxyiic acid, glucoheptonic acid, 3-phenylpropionic acid, trimethyiacetic acid, tertiary butylacetic acid, lauryl sulfuric acid, gluconic acid, glutamic acid, hydroxynaphthoic acid, salicylic acid, stearic acid, muconic acid, and the like, made by conventional chemical means; or (2) salts formed when an acidic proton present in the parent compound either is replaced by a metal ion, e.g., an alkali metal ion, an alkaline earth ion, or an aluminum ion; or coordinates with an organic base such as ethanolamine, diethanolamine, triethanolamme, N-methylglucamine and the like, made by conventional chemical means.
V. Methods of Use
A. Treatment of proliferative disease
[0075] Compounds of this disclosure inhibit ceil growth (proliferation), and thus are useful in pharmaceutical compositions to treat a subject, e.g., a vertebrate, e.g., a mammal, e.g., a human. IQB-CBIs can be administered alone or as antibody-drug conjugates wherein they are conjugated to a ceil targeting agent such as an antibody.
[0076] "Subject," "patient," "individual" and like terms are used interchangeably and refer to, except where indicated, mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species. The term does not necessarily indicate that the subject has been diagnosed with a particular disease, but typically "patient" refers to an individual under medical supervision. A patient can be an individual that is seeking treatment, monitoring, adjustment or modification of an existing therapeutic regimen, etc. A "cancer patient" can refer to an individual that has been diagnosed with cancer, is currently following a therapeutic regimen, or is at risk of recurrence, e.g., after surgery to remove a tumor. In some embodiments, the cancer patient has been diagnosed with cancer and is a candidate for therapy. Cancer patients can include individuals that have not received treatment, are currently receiving treatment, have had surgery, and those that have discontinued treatment.
[0077] The terms "therapy," "treatment," and "amelioration" refer to any reduction in the seventy of symptoms. In the case of treating cancer, treatment can refer to, e.g. , reducing tumor size, number of cancer cells, growth rate, metastatic activity, reducing cell death of non-cancer cells, reduced nausea and other chemotherapy or radiotherapy side effects, etc. In the case of treating an inflammatory condition, the treatment can refer to, e.g., reducing blood levels of inflammatory cytokines, pain, swelling, recruitment of immune cells, etc. As used herein, the terms "treat" and "prevent" are not intended to be absolute terms. Treatment and prevention can refer to any delay in onset, amelioration of symptoms, improvement in patient survival, increase in survival time or rate, etc. Treatment and prevention can be complete (undetectable levels of neoplastic cells) or partial, such that fewer neoplastic cells are found in a patient than would have occurred without the present invention. The effect of treatment can be compared to an individual or pool of individuals not receiving the treatment, or to the same patient prior to treatment or at a different time during treatment. In some aspects, the severity of disease is reduced by at least 10%, as compared, e.g. , to the individual before administration or to a control individual not undergoing treatment. In some aspects the severity of disease is reduced by at least 25%, 50%, 75%, 80%, or 90%, or in some cases, no longer detectable using standard diagnostic techniques.
[0078] Compositions of this disclosure are useful in the treatment of proliferative diseases such as cancer. "Cancer", "tumor," "transformed" and like terms include precancerous, neoplastic, transformed, and cancerous ceils, and can refer to a solid tumor, or a non-solid cancer (see, e.g., Edge et al A ICC Cancer Staging Manual (7th ed. 2009); Cibas and Ducatman Cytology: Diagnostic principles and clinical correlates (3rd ed. 2009)). Cancer includes both benign and malignant neoplasms (abnormal growth). "Transformation" refers to spontaneous or induced phenotypic changes, e.g., immortalization of cells, morphological changes, aberrant cell growth, reduced contact inhibition and anchorage, and/or malignancy (see, Freshney, Culture of Animal Cells a Manual of Basic Technique (3rd ed. 1994)).
Although transformation can arise from infection with a transforming virus and incorporation of new genomic DNA, or uptake of exogenous DNA, it can also arise spontaneously or following exposure to a carcinogen.
[0079] The term "cancer" can refer to carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, solid and lymphoid cancers, etc. Examples of different types of cancer include, but are not limited to, lung cancer (e.g., non-small cell lung cancer or NSCLC), ovarian cancer, prostate cancer, colorectal cancer, liver cancer (i.e.,
hepatocarcmoma), renal cancer (i.e., renal cell carcinoma), bladder cancer, breast cancer, thyroid cancer, pleural cancer, pancreatic cancer, uterine cancer, cervical cancer, testicular cancer, anal cancer, pancreatic cancer, bile duct cancer, gastrointestinal carcinoid tumors, esophageal cancer, gall bladder cancer, appendix cancer, small intestine cancer, stomach (gastric) cancer, cancer of the central nervous sy stem, skin cancer, choriocarcinoma; head and neck cancer, blood cancer, osteogenic sarcoma, fibrosarcoma, neuroblastoma, glioma, melanoma, B-ceil lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, Small Cell lymphoma, Large Cell lymphoma, myelodisplastic syndromes (MDS), monocytic leukemia, myelogenous leukemia, acute lymphocytic leukemia, acute myelocytic leukemia (AML), chronic myeloid leukemia (CML), and multiple myeloma. In some embodiments, the compositions and methods of the present invention are useful for treating cancer.
[0080] Cancers that can be targeted include, for example, leukemia (e.g., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL) and chronic myeloid leukemia (CML)), breast cancer, prostate cancer, colorectal cancer, brain cancer, esophageal cancer, head and neck cancer, bladder cancer, gynecological cancer, liposarcoma, and multiple myeloma. In some embodiments, the target binding domain within the CAR of the disclosed disclosure is capable of binding any of a broad group of targets, including but not limited to, GPR114, CLL-1, IL1 RAP, TIM-3, CD19, CD20, CD22, RORI, mesotheim, CD33, CD 123/IL3Ra, c-Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA-125, Muc-1, AFP, Glycolipid F77, EGFRvIIL GD-2, NY- ESO-1 TCR, tyrosinase, TRPT/gp75, gpl 00/pmel-17, Melan- A/MART- 1 , Her2/neu, WT1, EphA3, teiomerase, HPV E6, HPV E7, EBNA1, BAGE, GAGE and MAGE A3
TCRSLITRK6, ENPP3, Nectm-4, CD27, SLC44A4, CAIX, Cripto, CD30, MUC16, GPNMB, BCMA, Trop-2, Tissue Factor (TP), CanAg, EGFR, v-integrin, CD37, Folate Receptor, CD138, CEACAM5, CD56, CD70, CD74, GCC, 5T4, CD79b, Steap 1 , Napi2b, Lewis Y Antigen, LTV, c-RET, DLL3, EFNA4, EndosiaIin/CD248, Ly6e (RIG-e), CD79a, CD274 (PD-Ll), CD38, DM .4. CD319 (SI . AM 7) and other targets known to one of skill in the art. In some embodiments, the cancer marker is CLL-1,
[0081] A "cancer target" or "cancer marker" is a molecule that is differentially expressed or processed in cancer, e.g., on a cancer cell or in the cancer milieu. Exemplary cancer targets are cell surface proteins such as ILIRAP (also, e.g., cell adhesion molecules and receptors), intracellular receptors, hormones, and molecules such as proteases that are secreted by cells into the cancer milieu. Markers for specific cancers are known in the art, e.g., MUC1 expression on colon and colorectal cancers, bombesin receptors in lung cancer, and prostate specific membrane antigen (PSMA) on prostate cancer.
[0082] The terms "overexpressed" or "upregulated" interchangeably refer to a protein or nucleic acid, generally a biomarker, that is transcribed or translated at a detectably greater level than control level. The term includes overexpression due to transcription, post transcriptional processing, translation, post-translational processing, cellular localization (e.g., organelle, cytoplasm, nucleus, cell surface), and K A and protein stabilit '.
Overexpression can be detected using conventional techniques for detecting biomarkers, whether mRNA (i.e., RT-PCR, hybridization) or protein (i.e., flow cytometry, imaging, ELBA, immunohistochemical techniques). Overexpression can be at least any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a normal cell.
[0083] In some embodiments, the cancer target can be associated with a certain type of cancer cell, e.g., leukemia, myeloma, lymphoma, AML, CML, non-small cell lung cancer cells, prostate cancer, colorectal cancer, breast cancer or ovarian cancer. A cell type specific target is typically expressed at levels at least 2-fold greater in that cell type than in a reference population of cells. In some embodiments, the cell type specific marker is present at levels at least 3, 4, 5, 6, 7, 8, 9, 10 20, 50, 100, or 1000 fold higher than its average expression in a reference population. Thus, the target can be detected or measured to distinguish the cell type or types of interest from other cells. In some embodiments, the cancer treated is a leukemia, lymphoma or a solid tumor,
[0084] In some embodiments, the cancer treated is a cancer of myeloid origin, that is originating from myeloid cells. Chronic myeloproliferative disorders are a collection of conditions characterized by increased number of mature and immature granuloc tes, erythrocytes, and platelets. Chronic myeloproliferative disorders can transition to other forms within this group, with a tendency to terminate in acute myeloid leukemia. Specific diseases within this group include cancers of myeloid origin, such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia syndrome), myelofibrosis, CMML (chronic myelomonocytic leukemia), multiple myeloma,
plasmacytoma, and CML (chronic myelogenous or myeloproliferative leukemia). Other myeloproliferative disorders include polycythemia vera, agnogenic myeloid leukemia, essential thrombocythemia, chronic myeloid leukemia, and chronic neutrophilic leukemia. In some embodiments, the cancer treated is a my eloproliferative cancer. In some embodiments, the myeloproliferative cancer is selected from the group consisting of acute
myeloproliferative leukemia, myelodysplasia syndrome, chronic myeloproliferative leukemia, chronic myelomonocytic leukemia, multiple myeloma, plasmacytoma and myelofibrosis. In some embodiments, the cancer treated is a cancer of my eloid cell origin. In some embodiments, the cancer of myeloid cell origin is selected from the group consisting of acute myelogenous leukemia, myelodysplasia syndrome, chronic myelogenous leukemia, chronic myelomonocytic leukemia, multiple myeloma, plasmacytoma and myelofibrosis.
[0085] Specific diseases within this group include cancers of myeloid origin, such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia- syndrome), myelofibrosis, C-MML (chronic myelomonocytic leukemia), multiple myeloma, plasmacytoma, and CML (chronic myelogenous or myeloproliferative leukemia). Other myeloproliferative disorders include polycythemia vera, agnogenic myeloid leukemia, essential thrombocythemia, chronic myeloid leukemia, and chronic neutrophilic leukemia. In some embodiments, the myeloproliferative cancer is selected from the group consisting of AML, CML, CMML, multiple myeloma, plasmacytoma and myelofibrosis.
[0086] Elevated CLL-1 levels are associated with cancer, in particular, in hematopoietic CSCs (e.g., LSCs), and in myeloproliferative disorders, including leukemias such as AML (acute myelogenous or myeloproliferative leukemia), MDS (myelodysplasia syndrome), myelofibrosis, CMML (chronic myelomonocytic leukemia), multiple myeloma,
plasmacytoma, and CML (chronic myelogenous or myeloproliferative leukemia). See Bakker et al. (2004) Cancer Res. 64:8443; Van Rhenen et al. (2007) Blood 110:2659-66; Zhao et al. (2010) Haematologica (2010) 95:71; Van Rhenen et al. (2007) Leukemia 21 : 1700; and Herrmann et al. (2012) Haematologica 97:219.
[0087] A cancer stem cell (CSC) is a cell found in a tumor or blood cancer that can give rise to the ceils that make up the bulk of the cancer. The CSC can also be self-renewing, similar to a normal (non-cancer) stem cell. CSCs can thus mediate metastasis by migrating to a non-tumor tissue in an individual and starting a "new" tumor, CSCs make up a very small percentage of any given cancer, depending on the stage that the cancer is detected. For example, the average frequency of CSCs in a sample of AML ceils is believed to be about 1 : 10,000. Hematopoietic CSCs can be identified as CD34+, similar to normal hematopoietic stem cells (HSCs). Other CSC associated markers include CD44 (breast), CD 133 (glial cancers), and Notch (e.g., myelomas and neuroblastoma).
[0088] One non-limiting example of a cancer target for which the IQB-CBIs described herein can be incorporated within an antibody-drug conjugate, is C type Lectin Like molecule 1 ("CI. !.·· ! "'). CLL-1 is expressed on AML blasts and LSCs, but not on normal hematopoietic stem ceils. CLL-1 is expressed on leukemic cells within both the bone marrow and blood compartments. The target antigen is present across all AML French American British (FAB) classifications and cytogenetic risk categories and is expressed independent of FLT-3 status. The target is expressed in de novo and recurrent disease states. Expression of CLL-1 antigen in combination with multidrug resistance (MDR) is associated with poor disease prognosis and greater probability of relapse.
[0089] In addition to being expressed in AML, CLL-1 is expressed in MDS and oilier myeloproliferative disorders (e.g., polycythemia vera, essential thrombocythemia and polynryelofibrosis) .
[0090] C-type Lectin -Like molecule 1 (CLL-1), also known as CLEC12A, DCAL-2, and MICL, is a type II membrane protein (ITIM domain— TM domain-stalk domain-lectin-like domain). The extracellular domain of CLL-1 is highly glycosylated, and it is expressed exclusively in cells of myeloid lineage.
[0091] The nucleotide and protein sequences of CLL-1 are known for many species. For example, the human sequences can be found at Genbank accession number AF247788.1 and Uniprot accession number Q5QGZ9. For the human CLL-1 protein, the extracellular domain comprises approximately amino acids 65-265, the transmembrane domain comprises approximately amino acids 44-64, and the cytoplasmic domain comprises approximately amino acids 1-43. The stalk domain of human CLL-1 spans amino acids 65-139, and the C lectin domain spans amino acids 140-249. One of skill will understand that CLL-1 variants (e.g., species homologs, allelic variants, etc.) can be optimally aligned, e.g., for identification of conserved residues and domains.
[0092] The terms "CLL-1 specific antibody," "anti -CLL-1 antibody," "CLL-1 antibody," "CLL-1 ADC" and "anti -CLL-1 " are used synonymously herein to refer to an antibody (or antibody conjugate, depending on context) that specifically binds to CLL-1, including variously glycosylated forms of CLL-1. The CLL-1 antibodies described herein specifically bind the CLL-1 polypeptide expressed, e.g., on the surface of certain cancer cells, but not to HSCs. As discussed in more detail below, the present anti-CLL-1 antibodies can bind CLL-1 expressing cells, bind a larger percentage of AML cells compared to other AML-targeting antibodies, inhibit AML cell proliferation, and mediate their destruction.
[0093] A "CLL-1 associated disorder" (or CLL-1 related disorder, CLL-1 disorder, CLL- 1 related condition or disease, etc.) refers to conditions and diseases correlated with elevated or reduced cell surface expression of CLL-1 as compared to CLL-1 expression in a standard control (e.g., a normal, non-disease, non-cancer cell). Elevated CLL-1 levels are associated with cancer ceils, in particular, leukemias such as AML (acute myelogenous leukemia), MDS (myelodyspiastic syndrome), and CML (chronic myelogenous leukemia), and in
hematopoietic CSCs (e.g., LSCs).
[0094] One non-limiting example of an antibody that may be useful to target AML and cancer stem cells of involved lineages is an anti-CLL-1 antibody, and more specifically, a humanized anti-CLLl antibody. Such antibodies are described, for example, in U.S. Patent Application Publication No. 2013/02951 18 and PCX International Publication No. WO 2017/091615 A 1 , both incorporated herein by reference. In some embodiments, the anti- CLL-1 antibody is optionally a chimeric (e.g., humanized) antibody referred to as "C6" and comprises light chain variable region:
DTQMTQSPSSLSASVGDRVTLTCRATQELSGYLSWLQQKPGKAIKRLIYAASTLDSG r PSR SGNRAGTDYTLTISSLQPEDFATYYCLQYAIYPYTFGQGTKLEIK (SEQ ID NO:
1) and heavy chain variable region:
EVQLVQSGAEVKKPGASVKMSCKASGYTFTSYFMWVRQAPGQGLEWIGFINPYND GSKYAQKFQGKATLTSDKSTSTWMELSSLRSEDTAVYYCTRDDGYYGYAMDYWG QGTLVTVSS (SEQ ID NO:2), respectively.
[0095] In another non-limiting example of an antibody that may be useful to target AML and cancer stem cells of involved lineages is an anti-ILlRAP antibody, and more specifically, a humanized anti-ILl RAP antibody. As used herein "ILl -RAP" refers to human interleukin 1 receptor accessory protein. A sequence of IL1-RAP can be as shown in Uniprot accession number Q9NPH3-1 (isoform 1). IL1RAP expression is elevated on cancer cells (e.g. , B cell lymphoma, AML cells, and solid tumor cells described herein); CSCs (e.g., myeloid CSCs); and cells associated with the IL I RAP associated disorders provided herein. ILIRAP is not significantly expressed on normal hematopoietic stem cells (HSCs). IL IRAP antibodies are described, for example, in U.S . Provisional Patent Application No. 62/425,970 and U.S . Patent Application Publicatin No. 2015/0315279 both incorporated herein by reference.
[0096] In some embodiments, the anti-ILl RAP antibody is referred to as "3G7". In a chimeric antibody, 3G7 can have light chain variable and heavy chain variable sequences as follows (CDRs indicated in bold highlight):
3G7 light chain variable sequence:
DIVLTOSPATLSVTPGDSVSLSCRASOSISNNLHWYOOKSHESPRLLIKYASOSISGIP SRFSGSGSGTDFTLSI SVETEDFGWFCOOSHNWPHTFGGGTKLEIKR rSEO ID NO: 5 ). and
3G7 heavy chain variable region sequence:
QIQLVQSGPELKKPGEWKISC ASGYTFTNYGMH^^VKQSPGEGLKWTVIGWINTYT GEPTYADDFKGRFGFSLETSASSAYLQINDLKNEDMATYFCARYYGNFDYWGQGTT LTVSS (SEQ ID NO:6).
[0097] In some embodiments, the 3G7 anti-ILlRAP antibody is a humanized antibody and comprises:
light chain:
EIVMTQSPATLSVSPGERATLSCRASQSISNNLHWYOQKPGOAPRL YYASQSISGIP
ARFSGSGSGTEFTi:FISSLOSEDFA\^YCOOSH WPHTFGOGTKLEiKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTY SLSSTLTLSKi\DYEKHKWACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 3), heavy chain:
EVQLVQSGAEVKKPGASVKISCKASG-YTFTNYG-MI-I VVRQAPGQGLEWMGWI TY
TGEPTYAQKFOGRFTFTLDTSTSTAYLEIRSLRSDDTAVYYCARYYGNFDYWGQGT
LL SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKOYFPEPVTVCWNSGALTSGVH
TFPAVLQSSGIA¾LSSVVWPSSSLGTQTYICNWH PSNTKVDKKVEPKSCDKTOTC
PPCPAPELLGGPSWLFPPKPKDTLMISRTTEVTCVVVDVSHEDPEVKFNWYVDGVE
VH AKTXPREEQY STTRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA
KGQPREPQWTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGNWSCSVMHEAIJH HYTQKSLSLSPG (SEQ ID
NO: 4). CDRs and a cysteine substitution for attachment of the pay load linker are set forth in bold and underline.
[0098] In certain embodiments, the antibody can include substitutions of a cysteine residue for another residue. Compositions of tins disclosure can be attached to the antibodies through the cysteine residue. In one example, a serine residue at position 156 is substituted with cysteine (S156C). In another example, a serine residue at position 239 is substituted with cysteine (S239C). More than one IQB-CBI compound may be incorporated into antibodies so modified. In some embodiments, the number of IQB-CBI compounds attached to an antibody may be any number in the range from 1 to about 10, or any number in between, including a fractional number, in some embodiments, the number of IQB-CBI compounds attached to the antibody is in the range from 1 to about 3. Such an antibody incorporating the IQB-CBIs described herein have been found to be effective in invitro and invivo applications as described below.
B. Dosage
[0099] The amount of compounds that will be effective in the treatment or prevention of proliferative disorders in a subject will depend on the specific nature of the condition, and can be determined by standard clinical techniques known in the art. In addition, in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges. The specific dose level for any particular individual will depend upon a variety of factors including the relative activity of the compounds, the age, body weight, general physical and mental health, genetic factors, environmental influences, sex, diet, time of administration, route of administration, rate of excretion, and the severity of the particular problem being treated.
[00100] The terms "'dose" and "dosage" are used interchangeably herein. A dose refers to the amount of active ingredient given to an individual at each administration . For the present invention, the dose can refer to the concentration of the antibody or associated components. The dose will v ary depending on a number of factors, including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; the route of administration; and the imaging modality of the detectable moiety (if present). One of skill in the art will recognize that the dose can be modified depending on the above factors or based on therapeutic progress. The term "dosage form" refers to the particular format of the pharmaceutical, and depends on the route of administration. For example, a dosage form can be in a liquid, e.g. , a saline solution for injection.
[00101] A "control" sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample. For example, a test sample can be taken from a test condition, e.g. , in the presence of a test compound, and compared to samples from known conditions, e.g., in the absence of the test compound (negative control), or in the presence of a known compound (positive control). A control can also represent an average value gathered from a number of tests or results. One of skill in the art will recognize that controls can be designed for assessment of any number of parameters. For example, a control can be devised to compare therapeutic benefit based on pharmacological data {e.g., half-life) or therapeutic measures (e.g., comparison of benefit and/or side effects). Controls can be designed for in vitro applications. One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are widely variant in controls, variation in test samples will not be considered as significant.
[00102] In certain embodiments, the compounds of the disclosure will be conjugated to a target binding moiety, such as an antibody. The target binding moiety can be specific to targets on cells targeted for elimination in order to treat a subject suffering from a condition caused by the presence of such cells. The target can be any biomoiecule on a target cell. Target cells can include cancer cells. Therefore, the target can comprise, for example, a polypeptide expressed on a cancer cell, e.g., a tumor-associated antigen. In another embodiment, the target binding rnoiety can be a chimeric antigen receptor ("CAR") that can bind an antigen determinant comprising ammo acids within the extracell ular domain of a tumor-associated antigen, a viral antigen or a viral associated antigen or a fragment of such a polypeptide.
[00103] Suitable dosage ranges for oral administration are dependent on the potency of the particular compound or compound antibody conjugates, but are generally about 0.001 mg to about 500 mg of drug per kilogram body w eight, preferably from about 0.1 mg to about 200 mg of drug per kilogram body weight, and more preferably about 1 to about 100 mg/kg-body wt. per day. Dosage ranges may be readily determined by methods known to the skilled artisan. The amount of active ingredient that may be, for instance, combined with carrier materials to produce a single dosage form will var - depending upon the subject treated and the particular mode of administration. Dosage unit forms will generally contain between about 1 mg to about 500 mg of active ingredient.
[00104] Administration can be periodic. Depending on the route of administration, the dose can be administered, e.g., once even' 1, 3, 5, 7, 10, 14, 21, or 28 days or longer (e.g., once every 2, 3, 4, or 6 months). In some cases, administration is more frequent, e.g., 2 or 3 times per day. The subject can be monitored to adjust the dosage and frequency of administration depending on therapeutic progress and any adverse side effects, as will be recognized by one of skill in the art.
[00105] Thus in some embodiments, additional administration is dependent on subject progress, e.g., the subject is monitored between administrations. For example, after the first administration or round of administrations, the subject can be monitored for rate of tumor growth, recurrence (e.g., in the case of a post-surgical subject), or general disease-related symptoms such as weakness, pain, nausea, etc.
C. Methods of Administration
[00106] Compositions comprising the IQB-CBI compound or the IQB-CBI antibody conjugate may be administered by any convenient route, for example, by infusion or bolus injection, or by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, ere). Administration can be systemic or local. Various deliver}' systems are known, (e.g. , encapsulation in liposomes, microparticles, microcapsules, capsules, etc.) that can be used to administer the antibody conjugate compositions. Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, intranasal, and intracerebral .
[00107] The amount of compound antibody conjugates that will be effective in the treatment or prevention of proliferativ e disorders in a subject will depend on the specific nature of the condition, and can be determined by standard clinical techniques known in the art. In addition, in vitro or in vivo assays may optionally be employed to help identify optimal dosage ranges. The specific dose level for any particular individual will depend upon a variety of factors including the relativ e activ ity of the compound antibody conjugates, the age, body weight, general physical and mental health, genetic factors, environmental influences, sex, diet, time of administration, route of administration, rate of excretion, and the severity of the particular problem being treated.
[00108] The IQB-CBI conjugates or the IQB-CBI antibody conjugate can be administered by injection or infusion through any suitable route including but not limited to intravenous, subcutaneous, intramuscular or intraperitoneal routes. An example of administration of a pharmaceutical composition includes storing the composition at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4°C, and diluting it in either 100 ml or 200 mi 0.9% sodium chloride for injection prior to administration to the subject. The composition is administered by intravenous infusion over the course of i hour at a dose of between 0.2 and 10 mg/kg. In other embodiments, the composition is administered by intravenous infusion over a peri od of between 15 minutes and 2 hours. In still other embodiments, the
administration procedure is via sub-cutaneous bolus injection . [00109] Thus m some embodiments, additional administration is dependent on the progress of the subject, e.g., the subject is monitored between administrations.
D. Kits
[00110] Also provided herein are kits comprising containers containing compositions as provided herein. In certain embodimens, the containers contain a unit dose of the composition. Kits can comprise boxes containing a plurality of composition-containing containers. In other embodiments, kits comprise a container, such as a bag or bottle, containing a composition of this disclosure connected to an insersion device, such as a needle, for example, tiirough a tube that function as a conduit for the composition in the container.
The following examples are offered by way of illustration and not by way of limitation.
EXAMPLES
[00111] Example 1 : Experimental protocols for the synthesis of IQB-CBI Dimers
[00112] General Methods:
[00113] Ή NMR spectra were recorded on a Varian Inova 300 or 500 MHz NMR instrument. Chromatographic purities were determined on an Agilent 1200 Series or 1 100 Series LC/MS system using a Merck Chromolith RP-18e analytical HPLC column
(monolithic, 50 χ 2 mm) and the following analytical HPLC method: injection volume 5 ,u,L; flow rate 1 mL/min; 5→95% acetonitrile in water with 0.05% AcOH over 5 mins; Agilent diode array detector at λ = 254, 22,0 or 195 nra; room temperature.
[00114] Synthesis of IOB-acids lla-e (Scheme 1) (Referring to Figure 1)
[00115] 4-Benzyloxy-5-methoxy-2-nitro-benzoic acid methyl ester (2)
[00116] 4-Benzyloxy-5-methoxy-benzoic acid methyl ester 1 ( 13.6 g, 50 mmol) was dissolved in acetic anhydride (130 mL). Copper nitrate trihydrate (15.1 g, 62.5 mmol) was added in small portions over period of 30 minutes. After stirring for 1 h reaction mixture was poured on ice and stirred for 1 h. Precipitate was filtered off, washed with water and dried thoroughly. Material was recrystallized from ethyl acetate to afford 9.1 g of 2 (57% yield).
[00117] Ή NMR (500 MHz, CDCb) δ: 7.52 (s, 1 H), 7.36-7.46 (rn, 5H), 7.09 (s, 1H), 5.22 (s, 2H), 3.99 (s, 3H), 3.91 (s, 3H). [00118] LC/MS: retention time 3.18 min. (ESI) CieHieNOe calculated for [M+Hf 318; found 340 (M+Na).
[001.19] 4-BenzyIoxy-5-methoxy-2-nitro-benzoic acid (3)
[00120] 4-Benzyloxy-5-methoxy-benzoic acid methyl ester (9.1 g, 29 mmol) was dissolved in methanol (145 mL) and sodium hydroxide (6 M solution, 24 mL) was added at once. Reaction mixture was stirred for 1 h at 50 degrees and methanol was evaporated.
Concentrated hydrochloric acid (12 mL) was added slowly to the residue with stirring.
Formed precipitate was filtered off, washed with water and dried to afford 8.1 g of 3 (92% yield).
[00121] Ή NM (500 MHz, DMSO-d6) δ: 7,69 (s, 1H), 7,36-7,47 (m, 5H),7,31 (s, 1H), 5.24 (s, 21-1), 3.91 (s, 3H).
[00122] (S)-1.,2,3,4-Tetrahydro-isoquinoline-3-carboxyIic acid methyl ester (5)
[00123] (5)- l,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid 4 (10.6 g, 60 mmol) was dissolved in anhydrous methanol (86 mL). Thionyl chloride (6.5 mL, 90 mmol) was added dropwise and reaction mixture was refluxed for 5 h. Methanol was evaporated and residue was partitioned in chloroform and saturated sodium bicarbonate solution. Water phase was additionally extracted with chloroform, and combined organics were dried over anhydrous MgSOi, filtered and concentrated to dryness to afford 9.2 g of 5 (81% yield) .
[00124] ¾ NMR (500 MHz, CDCb) δ: 7.16 (br, 3H), 7.03 (br, 1H), 4.13 (far, 2H), 3.80 (br, 3H), 3.05 (br, 2H), 2.20 (br, 1H).
[00125] (S)-2-(4-Benzyloxy-5-methoxy-2-nitro-benzoyl)-l,2,3,4-tetrahydro- isoquinoline-S-carboxylic acid methyl ester (6)
[00126] Acid 3 (3.03 g, 10 mmol) was dissolved in dichloromethane (33 mL), and DIEA (2.6 mL, 15 rnmol) was added followed by HATU (4.93 g, 13 mmol). Mixture was stirred for 30 minutes and amine 5 (2.29g, 12 mmol) was added at once. Reaction mixture was allowed to stir overnight, then washed with 0.5 M HQ, saturated NaHCCb and concentrated to dryness. The residue was purified on a 1 10 g silica Teledyne Isco column (0-→35% EtOAc in hexane). Evaporation of product containing fractions afforded 2.73 g of 6 (57% yield).
[00127] I .(VMS: retention time 3.31 mm. (ESI) C ·.<.! i -N ·(>- calculated for [M+H] + 477; found 477. [00128] 2-Benzyloxy-3-metho.xy-1.1,11.a-dihydro-6H,13H-5a,13-diaza- benzo[4,5]cydohepta[l,2-b]naphthaIene~5,12-dione (7)
[00129] Nitro derivative 6 (2.71 g, 5,7 mmol), zinc (7.4 Ig, 1 14 mmol) and NH4CI (12.2 g, 228 mmol) were placed in flask with stirring bar and acetone/water (125 mL, 1 :4 v/v) was added. The reaction mixture was stirred overnight and then filtered off through celite and concentrated. The residue was dissolved in methanol (100 mL) and stored for 24 hr at rt. Formed precipitate was filtered off, washed thoroughly with water and dried to afford 2.18 g of ? (92% yield).
[00130] ¾ NMR (500 MHz, DMSO~d6) δ: 7.46 (m, 2H), 7.42 (m, 2H), 7.36 (m, IH), 7.21-7.33 (m, 5H), 6.80 (s, i l l). 5.09 (s, 2H), 4.86 (d. J 15.1 Hz, IH), 4.42 id. ./ 15.1 Hz, 1H), 4.21 (t, J ------- 6.4 Hz, IH), 3.77 (s, 3H), 3.27 (m, IH), 2.99 (m, IH).
[00131] LC/MS: retention time 2.82 min. (ESI) C25H23N2O4 calculated for [M+H]+415; found 415.
[00132] 2-Benzyloxy-3-methoxy-13-(2-trimethylsilanyl-ethoxymethyl)-ll,l la- dihydro-6H,13H-5a,13-diaza-benzo[4,5]cyclohepta[l,2-b]naphthalene-5,12-dione (8)
[00133] To suspension of amide 7 (2.20 g, 5.3 mmol) in THF-DMF (40 mL, 3: 1 v/v) sodium hydride in mineral oil (424 mg, 10.6 mmol) was added in small portions. After stirring for 30 minutes, reaction mixture was cooled to -78°C and SEMC1 (2.34 mL, 13.3 mmol) was added dropwise. Solution was allowed to warm to rt and stirred overnight. THF was removed under reduced pressure and residue was partitioned in chloroform-water. Water phase was additionally extracted with chloroform, and combined organics were dried over anhydrous MgS04, filtered, concentrated to dryness. The residue was purified on a 40 g silica Teledyne Isco column (0→50% EtOAc in hexane). Evaporation of product containing fractions afforded 2.55 g of 8 (88% yield).
[00134] Ή NMR (500 MHz, CDCb) δ: 7.46 (m, 2H), 7.37 (m, 2H), 7.31 (m, 4H), 7.25 (m, 3H), 5.43 (d, ./ 9.8 Hz, IH), 5.21 (s, 2H), 5.14 (d, J = 15.1 Hz, IH), 4.49 (d, ./ 9.8 Hz, IH), 4.41 (d, ./ 15.1 Hz, IH), 4.27 (t, J= 6.4 Hz, IH), 3,92 (s, 3H), 3.70 (m, IH), 3.56 (m, 2H), 2.99 (m, IH), 0.97 (m, 2H), 0,05 (s, 9H).
[00135] LC/MS: retention time 3.92 mm. (ESI) C H h-V().<Si calculated for [M+H]+ 545: found 545. [00136] 2-Hydroxy-3-methoxy-13-(2-trimethylsilanyl-ethoxymethyl)-ll,l la-dihydro- 6H,13H-5a,13-diaza-benzo[4,5]cyclohepta[l,2-b]naphthalene-5,12-dione {9}
[00137] Solution of 8 (2,55 g, 4.7 mrnol) in methanol (47 mL) was flushed with Ar and 10% Pd/C (375 mg) was added. Hydrogen (ballon) was bubbled through solution for 2 h and then reaction mixture was filtered off through celite, concentrated and purified on 24 g silica Teledyne Isco column (0→60% EtOAc in liexane). Evaporation of product containing fractions afforded 2.13 g of 9 (99% yield).
[00138] ¾ N .MR (500 MHz, CDCh) 6: 7.32 (m, 2H), 7.27 (m, 4H), 6.06 (br, 1H), 5.42 (d, ,/ = 9.8 Hz, IH), 5.15 (d, J= 15 , 1 Hz, lH), 4,70 (d, ,/= 9.8 Hz, IH), 4.4 ! (d, J= 15 , 1 Hz, 1H), 4.28 (t, J ------- 6.4 Hz, IH), 3.93 (s, 3H), 3.71 (m, IH), 3.62 (m, 2H), 3.00 (m, IH), 0.99 (m,
2H), 0.03 (s, 9H).
[00139] LC/MS: retention time 3.22 min. (ESI) C24H31N2O5S1 calculated for | .\ί · Η | 455; found 455.
[00140] SEM-protected IQB-acid (10a)
[00141] To a solution of phenol 9 (90 mg, 0.2 mmol), 2-bromoacetic acid (83 mg, 0.6 mmol) in DMF (0,8 mL) cesium carbonate (197 mg, 0.6 mmol) was added and mixture was stirred overnight. No product was formed and MeOH (0.5 mL) was added and mixture was stirred for additional 24 hr after that LC/MS showed 100% conversion. Reaction mixture was diluted with water (10 mL) and saturated with solid NH4CL After extraction with
DCM:MeOH (15 mL, 0: 1 v/v) organics were concentrated to dryness and purified on a 12 g silica Teledyne Isco column (0→I5% MeOH with 0.1 % AcOH in DCM). Evaporation of product containing fractions afforded 120 mg of 10a (>99% yield).
[00142] Ή NMR. (500 MHz, CDCh) δ: 10.73 (br, IH), 7.32 (s, IH), 7.29 (m, 2H), 7.24 (m, 2H), 7.19 (s, IH), 5.43 (d, ,/ 9.8 Hz, I H), 5.12 (d, J -- 15.1 Hz, IH), 4.65 (d, J ----- 9.8 Hz, IH), 4.40 (d. ./ 15.1 Hz, IH), 4.27 it. ./ 6.8 Hz, 2H), 3.88 (s, 3H), 3.67 (m, 2H), 3.53 (m, IH), 3.10 (m, 2H), 2.99 (m, IH), 0.96 (m, 2H), 0,00 (s, 9H).
[00143] LC/MS: retention time 3.44 rain. (ESI) C26H33N2O7S1 calculated for I M \ \ \ 513; found 513.
[00144] SEM-protected IQB-acid (10b) [00145] To a solution of phenol 9 (136 mg, 0.3 mmol), 2-(2-bromoethyl)-l,3-dioxolane
(108 mg, 0.6 mmol) in DMF (0.6 mL), cesium carbonate (295 mg, 0.9 mmol) was added and mixture was stirred for 2 hr. LC MS showed 100% conversion. Reaction mixture was diluted with water ( 10 mL) and extracted with EtOAc (2x15 mL) organics were concentrated to dryness and dissolved in THF (8 mL). 6 M HCl (1 mL) was added and reaction mixture was stirred at rt for 24 hr and finally concentrated to dryness to produce crude aldehyde.
[00146] Crude aldehyde was dissolved in tBuOH/2-methyl-2-butene/water (3/1/1 v/v/v; 10 mL), sodium dihydrogen phosphate (420 mg, 2.1 mmol) followed by sodium chlorite (244 mg, 2.7 mmol). Reaction mixture was stirred vigorously for 30 minutes and LC/MS indicated reaction was complete. Organic layer was separated; water was extracted with EtOAc (2x20 mL). Combined organics were concentrated to dryness and purified on preparative TLC plates (Hexane:EtOAc:AcOH, 1 : 1 :0.05). Silica gel containing product was scraped off and washed with DCM:MeOH (15 : 1, v/v) and organic solution evaporated to afford 78 mg of 10b (49% yield).
[00147] ¾ NMR (500 MHz, CDCh) δ: 7.31 (br m, 8H), 5 ,49 (br m, 1H), 5.12 (br d, J = 15 , 1 Hz, 1H), 4.69 (br m, 1 H), 4.42 (br d, J= 15.1 Hz, III), 4,28 (br m, 2H), 3.54-3.93 (br m, 7H), 2.99 (br rn, 1H), 0.96 (br m, 2H), 0.00 (br s, 9H).
[00148] I .C . MS: retention time 3.13 min. (ESI) C H I -VihSi calculated for [M+H 527; found 527.
[00149] SEM-protected IQB-acid (10c)
[00150] To a solution of phenol 9 (90 mg, 0.2 mmol), ethyl 4-bromobutanoate (1 17 mg, 0.6 mmol) in DMF (0.4 mL), cesium carbonate ( 197 rng, 0.6 mmol) was added and mixture was stirred for 2 hr. LC/MS showed 100% conversion. Reaction mixture was diluted with water ( 10 mL) and extracted with EtOAc (2x 15 mL), organic fractions were concentrated to dryness and dissolved in THF-MeOFI-FkO (3-1-1, v/v/v, 2 mL). LiOH (32 mg, 1.3 rnmol) was added and reaction mixture was stirred for 3 hr and then concentrated to dryness. The residue was dissolved in DMSO (1 mL) and loaded directly onto a 15.5 g Cie Aq Isco column and purified (5→95% ACN in HiO, each containing 0.05% of AcOFI), Desired fractions were lyophilized to obtain 88 mg of 10c (81% yield).
[00151] ¾ NMR (500 MHz, CDCI3) δ: 7,31 (s, 1 H), 7.30 (m, 2FI), 7.27 (m, 111), 7,21 (s, I I I ). 5.49 (d. ./ 9.8 Hz, ! ! ! }. 5.15 (d,■/ 15.1 Hz, 1H), 4.69 id. ./ 9.8 Hz, i l l ). 4.42 (d, ./ 15.1 Hz, 1 H), 4.28 (t J = 6.8 Hz, 2H), 4.11 (m, 2H), 3 ,88 (s, 3H), 3 ,77 (m, IH), 3.67 (m, III), 3.56 (m, IH), 3.01 (m, IH), 2.60 (m, 2H), 2.19 (m, 2H), 0.97 (m, 2H), 0.00 (s, 9H).
[00152] I .(VMS: retention time 3.29 mm. (ESI) C28H37N2O7S1 calculated for [M+H]+ 541 ; found 541 .
[00153] SEM-protected IQB-aeid (lOd)
[00154] To a solution of phenol 9 (100 mg, 0.22 mmol), methyl-5-bromovalerate ( 129 mg, 0.66 mmoi) in DMF (0.4 mL), cesium carbonate (215 mg, 0.66 mmol) was added and the mixture was stirred for 1 6 hr. LC/MS showed 100% conversion. Reaction mixture was diluted with water (10 mL) and extracted with EtOAc (2x15 mL) organic fractions were concentrated to dryness and dissolved in THF-MeOH-HiO (3-1-1, v/v/v, 2 mL). LiOH (17 mg, 0.69 mmol) was added and reaction mixture was stirred for 1 hr and then concentrated to dryness. The residue was dissolved in DMSO (1 ml.) and loaded directly onto a 50 g Cis Aq Isco column and purified (5-->95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophiiized to obtain 107 mg of lOd (83% yield).
[00155] Ή NMR (500 MHz, CDCb) δ: 7.36 - 7.14 (m, 6H), 5.50 (d, J ----- 10.0 Hz, IH), 5.15 (d, ./ 15.3 Hz, IH), 4.67 {0. .J 10.0 Hz, IH), 4.41 (d,■/ 15.3 Hz, IH), 4.28 (dd. ./ 7.4, 6.4 Hz, IH), 4.15 - 4.00 (m, 2H), 3.89 (s, 3H), 3.79 (td, J = 9,8, 6,7 Hz, IH), 3 ,68 (td, J = 9.7, 6.7 Hz, IH), 3.56 (dd, J= 15.4, 7.5 Hz, I H), 3.00 (dd, J= 15.5, 6.4 Hz, IH), 2.47 (t, J = 7.2 Hz, 2H), 1.94 (q, ./ 7.4 Hz, 21 1). 1.86 (q, ./ 7.4 Hz, 21 1 ). 1.05 - 0.87 (m, 2H), 0.03 (s, 9H).
[00156] LC/MS: retention time 3.34 mm. (ESI) C29H37N2Q7S1 calculated for j M-l I ! 543; found 543.
[00157] SEM-protected IQB-acid (lOe)
[00158] To a solution of phenol 9 (227 mg, 0.5 mmoi), methy l 6-bromohexanoate (313 mg, 1.5 mmol) in DMF (1 mL) cesium carbonate (313 mg, 1 ,5 mmol) was added and mixture was stirred for 2 hr. LC/MS showed 100% conversion. Reaction mixture was diluted with water ( 10 mL) and extracted with diethyl ether (2x15 mL) organics were concentrated to dryness and dissolved in THF-MeOH-HbO (3-1-1, v v v, 4 mL). LiOH (64 mg, 2.6 mmol) was added and reaction mixture was stirred for 3 hr and then concentrated to dryness. The residue was dissolved in ACN-H2O (1-1, v/v, 2 mL) and loaded directly onto a 50 g Cis Aq Isco column and purified (5→95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophiiized to obtain 260 mg of lOe (92% yield).
[00159] ¾ NMR (500 MHz, CDCb) δ: 7.32 (m, 3H), 7,27 (m, 2H), 7.21 (m, IH), 5.51 (d, ./ 9.8 Hz, i l l). 5.15 id. ./ 15.1 Hz, 1H), 4.68 (d. ./ 9.8 Hz, i l l). 4.43 (d, J ------- 15.1 Hz,
1H), 4.30 (t, J ------- 6.8 Hz, 1H), 4.05 (m, 2H), 3.89 (s, 3H), 3.79 (m, H i ). 3.69 (m, 1H), 3.56 (m, i l l). 3.0.1 (m, i l l). 2.40 (m, 2H), 1.90 (m, 2H), 1 ,75 (m, II I). 1.55 (m, 2H), 0.98 (m, 21 1). 0.00 (s, 9H).
[00160] LC MS: retention time 3.42 min. (ESI) C30H41N2O7S1 calculated for [M+H]+ 569: found 569.
100161] IQB-acid (11a)
[00162] SEM-protected IQB-acid 10a (102 mg, 0.2 mmol) was dissolved in anhydrous THF (4 ml) and mixture was cooled to -78°C and superhydride solution (0.5 mL, 1 M in THF, 0.5 mmol) was added dropwise. Solution was kept at that temperature for 90 minutes and then warmed to it before quenching with MeOH (1 mL). All voiatiles were removed on rotovap, residue was dissolved in DMSO and loaded directly onto a 15.5 g Cis Aq Isco column and purified (5-->95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophiiized to obtain 51 mg of 11a (70% yield).
[00163] ¾ NMR (500 MHz, CDCb) δ: 7.57 (s, 1H), 7.48 (br, 1H), 7.32 (m, 5H), 6.89 (s, i l l ). 5.02 (d, J - 15.6 Hz, i l l ). 4.78 (m, 2H), 4.48 (d, J = 15.6 Hz, i l l ). 4.01 (m, ! ! !). 3.98 (s, 3H), 3.28 (m, IH), 3.16 (m, 1H).
[00164] LC MS: retention time 2.10 min. (ESI) C20H19N2O5 calculated for [M+Hj+ 367; found 367.
[00165] IQB-acid (lib)
[00166] Procedure as described for 11a. Obtained 51 mg of lib (60% yield).
[00167] Ή NMR (500 MHz, CDCb) δ: 7,54 (s, IH), 7.46 (br, 1H), 7.32 (m, 5H), 6.94 (s, IH), 5.02 (d, J = 15.6 Hz, IH), 4.53 (d, J = 15.6 Hz, IH), 4.35 (m, 21 1). 3.92 (s, 3H), 3.27 (m, IH), 3.15 (m, IH), 2.90 (m, 2H).
[00168] LC/MS: retention time 2.10 rain. (ESI) C > : l i < : N <0-- calculated for [M+H 381; found 381. [00169] IQB-acid (l lc)
[00170] Procedure as described for 11a. Obtained 51 mg of 11c (61% yield).
[00171] Ή NMR (500 MHz, CDCb) δ: 7.53 (s, 1H), 7.46 (br, 1H), 7.34 (m, 5H), 6.88 (s, ! ! !}. 5.02 (d. J - 15.6 Hz, 1H), 4.54 (d, J - 15.6 Hz, 1H), 4.11 (in. 21 1). 3.93 (m, 4H), 3.27 (m, H i ). 3.16 (ni, IH), 2,58 (m, II I). 2.18 (m. 2H),
[00172] LC/MS: retention tune 2.10 min. (ESI) C22H23N2O5 calculated for [M+H]+ 395; found 395.
[00173] IQB-acid (lid)
[00174] Procedure as described for 11a. Obtained 56 mg of lid (49% yield),
[00175] Ή NMR (500 MHz, CDCb) δ 7.53 (s, i l l). 7.48 (d, J ----- 5.1 Hz, IH), 7.43 - 7.28 (m, 4H), 6,82 (s, IH), 5.01 (d, ./ 15.5 Hz, H), 4.56 (d, ./ 15.5 Hz, IH), 4, 18 - 4.02 (m, 3H), 3.95 (s, 'ill), 3,28 (dd, J= 15.5, 5.6 Hz, IH), 3.16 (dd, J= 15.5, 4.1 Hz, IH), 2.46 (t, J= 72 Hz, 2H), 1.94 (q,■/ 7.0, 6.4 Hz, 2H), 1.86 (q. 7.4 Hz, 2H).
[00176] LC/MS: retention time 2.18 min. (ESI) C23H25N2O5 calculated for [M+H]+ 409; found 409,
[00177] IQB-acid (lie)
[00178] Procedure as described for 11a. Obtained 140 mg of lie (72% yield).
[00179] ¾ NMR (500 MHz, CDCb) δ: 7.54 (s, IH), 7.48 (br, IH), 7.32 (m, 5H), 6.82 (s, IH), 5.02 (d, J = 15.6 Hz, IH), 4.57 (d, J = 15.6 Hz, IH), 4.01 (m, 2H), 3.98 (m, 4H), 3 ,28 (m, IH), 3.16 (m, 1H), 2.39 (m, 2H), 1.90 (m, 2H), 1.73 (m, 11 1 ). 1.54 (m, 2H).
[00180] LC/MS: retention time 2.24 min. (ESI) C24H27N2O5 calculated for [M+Hf 423; found 423.
[00181] Synthesis of 'IQB-aminoCBI dimers - 20a-e (Scheme 2, referring to Figure 2) [00182] (3-ter/-Butoxycarbonylamino-naphthalen-l-yl)-carbamic acid ferf-butyl ester (13)
[00183] To an Ar purged solution of 1,3-dinitro-naphthalene 412) (20.0 g, 92.0 mmol) in methanol (400 mL) was added 10% Pd/C (2.0 g). The mixture was degassed and purged with l-h (3x). Hie resulting reaction mixture was stirred under 1 atm of l b gas for 16 h at which time the reaction was judged complete by LC/MS. The catalyst was removed from the reaction mixture via filtration through celite. The reaction was concentrated in vacuo and the crude product was used without further purification.
[00184] B0C2O (1 16 g, 535 mmol) was added to a solution of crude 1 ,3-diamino- naphthaline in THF (400 mL). The resulting mixture was stirred at 60°C, under Ar, until the reaction was judged complete by TLC and LC/MS. The reaction mixture was concentrated in vacuo. The resulting residue was purified by column chromatography (0→30% EtOAc in Hex) to afford 20.0 g of 13 (61 % yield),
[00185] LC MS: retention time 3.55 min. (ESI) calculated for C12H10N2O4: [M-2 Bu]+ 247; found 247.
[00186] (4-terf-Butoxycarbonylamino-l-iodo-naphthalen-2-yl) arbamic acid tert- biityS ester (14)
[00187] A degassed solution of (3-feri-butoxycarbonylamino-naphthalen-l-yl)-carbamic acid tert-butyl ester (13) (20,0 g, 56.0 mmol) in 1 : 1 THF/MeOH (150 mL), under Ar, was cooled to -78°C. A solution of NTS (14.4 g, 64,2 mmol) in THF (50 mL) was added, followed by a solution of ?-Ts()H (21.3 g, 112 mmol) in MeOH (50 mL). The mixture was stirred at -78°C until the reaction was judged complete by LC/MS. The mixture was then allowed to warm to room temperature, diluted with EtOAc (200 mL) washed with H2O (2 x 100 mL), then brine (2 x 100 mL), dried over MgS04, filtered and concentrated in vacuo. The resulting residue was purified by column chromatography (0→50% EtOAc in Hex) to afford 17.8 g of 12 (66% yield).
[00188] I .(VMS: retention time 3.96 mm, (EST) calculated for C2oFl25l 204 a: [M+Na]+ 507; found 507.
[00189] AIlyI-[3-(aIlyI-/eri-butoxycarbonyl-amino)-4-iodo-naphthalen-l-yI]-carbamic acid fer/-butyl ester (15)
[00190] To a solution of (4-ter -butoxycarbonylamino-l-iodo-naphthalen-2-yl)-carbamic acid rerf-butyl ester (14) (13,5 g, 27.9 mmol) in DMF (100 mL) under Ar, cooled to 0°C was added NaH (60% in mineral oil) (3.34 g, 83.6 mmol). The mixture was stirred at 0°C for 30 min followed by the addition of allyl bromide (24.0 mL, 279 mmol) over 5 min. The resulting mixture was allowed to warm to room temperature over 2 h, at which point the reaction was judged complete. The reaction was then diluted with EtOAc (500mL) and washed with NaHCCb (sat, aq) (2 x 100 mL), H2O (2 x 100 mL), then brine (2 x 100 mL), dried over MgSQ4, filtered and concentrated in vacuo. The resulting residue was purified by column chromatography (0→50% EtOAc in Hex) to afford 11 ,9 g of IS (76% yield).
[00191] LC MS: retention time 4.34 min. (ESI) calculated for CieifelNiCUNa: [M+Na 587; found 587.
[00192] 5-(Allyl-ter/-butoxycarbonyl-amino)-l-(2,2,6,6-tetramethyl-piperidin-l- yloxymethyl)-l,2-dihydro-benzo[e]indole-3-carboxylic acid ter/-butyl ester (16)
[00193] To a solution of (allyl-[3-(ally3-fer -butoxycarbonyl~amino)-4-iodo-naphthalen- ! - yl]-carbamic acid /erf-butyl ester (15) ( 11.0 g, 19.5 rnmol) in benzene (400 mL), under Ar, was added TEMPO (9.0 g, 58 mmol) and Bu.iSnH (5.3 mL, 19.5 mmol). The mixture was stirred at 60°C for 30 min, then another equivalent of BusS H (5.3 mL, 19.5 mmol) was added. After an additional 30 min, TEMPO (6.1 g, 39 mmol) and BusSnH (5.3 mL, 19.5 mmol) were added and the mixture was stirred for another 30 rnin, at which point more TEMPO (6.1 g 39 mmol) was added. After another 20 min, a final portion of Bu3SnH (5.3 mL, 19.5 mmol) was added. The resulting mixture was stirred for 45 min at 60°C. The reaction was cooled to room temperature and concentrated in vacuo. The resulting residue was purified by column chromatography (0→10% EtOAc in Hex, very slow gradient) to afford 10.5 g of 16 (91% yield).
[00194] LC/MS: retention time 5.33 rnin. (ESI) calculated for C35H51N3O5: [M+H]+ 594; found 594.
[00195] tert-BvAyl 5-(a!Iy!(ter/!-butoxycarbony!)am!5io)~l-(hydroxymethy!)-l ,2- dihydro-3H-benzo[e]indole-3-carboxylate (17)
[00196] To a solution of 5-(al3y]-/e t-butoxycarbonyl-amino)-l -(2,2,6,6-tetramethyl- piperidin-l-yloxymethyl)-l,2-dihydro-benzo[e]indole-3-carboxylic acid ferr-butyl ester (16) (1.0 g, 1.68 mmol) in THF (45 mL), HOAc (15 mL) and H2O (15 mL) was added Zn dust (8.81 g, 134.7 mmol). The resulting mixture was stirred at 70°C for 16 h, at which point the reaction was judged complete by LC/MS and TLC. The reaction was then cooled to room temperature, the reaction was filtered through a pad of celite and the solid residue was washed with DCM. The combined filtrate was concentrated in vacuo. Remaining water was removed by azeotrope with CHCb (3 x 50 mL). The resulting residue was purified by column chromatography (0— ->50% EtOAc in Hex) to afford 636 mg of 17 (83% yield). [00197] LC/MS: retention time 3.71 tnin. (ESI) calculated for CieHr NzOsNa: [M+Na]+ 477: found 477
[00198] tert-Butyl 5-(a!Iy!(ter/!-butoxycarbony!)am!5io)~l-(chIoromethy!)~l ,2~dihydr<)- 3H-benzo[e|indo!e-3-carboxy!ate (18)
[00199] To a solution of tert-batyl 5-(a31y3(ferr-butoxycarbonyl)amino)~l-
Figure imgf000056_0001
,2-dihydro-3H-benzo[e]indole-3-carboxylate (17) ( 1.0 g, 1.40 mmol) in DCM (5.6 rnL), under Ar, was added PPh3 (1.10 g, 4.20 mrnoi) followed by CCU (1.22 mL, 12.6 mmol). The resulting mixture was stirred at 22 °C for 2 h, at which point the reaction was judged complete by LC/MS and TLC. The reaction was then concentrated in vacuo and resulting residue was purified by column chromatography (0-->5Q% EtOAc in Hex) to afford 592 mg of l8 (89% yield).
[00200] LC MS: retention time 4.42 tnin. (ESI) calculated for C ! L -C!N -O iNa: [M+Na]+ 495; found 495.
[00201] Ally! protected IQB-CBI (19a)
[00202] TFA (5 mL) was precooled to 0°C and then added to Boc-protected CB1 (29 mg, 0.06 mmol). Solution was kept at 0°C overnight and then concentrated to dryness. Residue was redissolved in anhydrous chloroform evaporated again and partitioned between saturated NaHC03 and DCM. Organic phase was dried over MgS04 and concentrated to obtain crude salt of aniline. It was dissolved in DMF (1 .2 mL) and acid 11a (25 mg, 0.068 mmol) was added followed by EDC-HC1 (30 mg, 0.16 mmol). Reaction mixture was stirred for 3 hr and then directly loaded onto a 15.5 g Ci8 Aq Isco column and purified (5→95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophilized to obtain 22 mg of 19a (58% yield).
[00203] ¾ NMR (500 MHz, CDCb) δ: 7,81 (d, J = 8.3 Hz, 1H), 7.77 (s, i l l). 7.68 (d, J = 8.8 Hz, H), 7.59 (s, 1H). 7.52 (m, lH), 7,46 (m, 1H), 7.34 (m, 7H), 6.87 (m, 1H), 6.05 (m, 1H), 5.37 (d, J = 17.1 Hz, 1H), 5.24 (d, J = 10.3 Hz, I I I ). 5.02 (d, J = 15.1 Hz, I I I ). 4.92 (m, 2H), 4.55 (d, J = 15.1 Hz, 1H), 4.33 (m, 2H), 4.07 (m, IH), 4.00 (s, 3H), 3.95 (m, 3H). 3.44 (m, IH), 3 ,26 (m, IH), 3.13 (m, IH),
[00204] LC/MS: retention time 3.28 rain. (ESI) r.l Ι πΠΧ ,Ο , calculated for [M+H]+ 622; found 622. [00205] Ailyl protected IQB-CBI (19b)
[00206] Procedure as described for 19a, obtained 21 nig of 19b (45% yield).
[00207] Ή NM (500 MHz, CDCb) δ: 7.81 (d, J = 8.3 Hz, i l l). 7.80 (s, 1H), 7.68 (d, J - 8.8 Hz, 1H), 7.54 (s, IH). 7.49 (m, 3H), 7.31 (m, 7H), 6.94 (s, IH), 6.05 (m, 1H), 5.39 (d, J - 17.1 Hz, i l l). 5.36 (m, IH), 5.24 (d . ./ 10.3 Hz, IH), 5.02 (d . ./ 15.1 Hz, IH), 4.55 (d . ./ 15.1 Hz, IH), 4.54 (m, IH), 4.31 (m, 2H), 4,07 (m, IH), 3.98 (m, 3H), 3.94 (m, 3H). 3.41 (m, IH), 3.26 (m, IH), 3.18 (m, 2H), 3.13 (m, IH).
[00208] LC/MS: retention time 3.24 mm. (ESI) C ·! b.-.i .0. calculated for [M+H]+ 635; found 635.
[00209] Ally! protected IQB-CBI (19c)
[00210] Procedure as described for 19a, obtained 20 mg of 19c (31% yield).
[00211 ] ¾ NMR (500 MHz, CDCb) δ: 7.82 (d, J = 8.3 Hz, IH), 7,79 (s, IH), 7,65 (d, J = 8.8 Hz, IH), 7.53 (s, IH). 7.47 (rn, 3H), 7.35 (m, 7H), 6.87 (s, IH), 6.08 (rn, IH), 5.38 (d, J = 17.1 Hz, IH), 5.25 (d.■/ 9.1 Hz, IH), 5.01 (d. ./ 10.3 Hz, IH), 5.02 id. ./ 15.1 Hz, IH), 4.53 (d, J = 15.1 Hz, H), 4.27 (m, 2H), 4 ,00 (m, 2H), 3.92 (m, 3H). 3,38 (m, IH), 3.24 (m, IH), 3.16 (m, IH), 2.80 (m, IH), 2.72 (m, IH), 2.34 (m, 2H).
[00212] LC/MS: retention time 3.35 mm. (ESI) C =«! b«i i .\ sO s calculated for | M ! ! i 649; found 649.
[00213] Ally! protected IQB-CBI (19d)
[00214] Procedure as described for 19a, obtained 14 mg of 19d (15% yield).
[00215] ¾ NMR (500 MHz, CDCb) δ 7.86 - 7.74 (m, 2H), 7.66 (d, J = 8.3 Hz, IH), 7.54 - 7.43 (m, 3H), 7.41 - 7.28 (m, 5H), 6.81 (d, ./ 1.1 Hz, IH), 6.07 (ddt, ./= 16.4, 10.8, 5.4 Hz, IH), 5.37 (dq, J= 17.2, 1.7 Hz, IH), 5.24 (ddq, J = 10.3, 2,5, 1 ,4 Hz, IH), 5,01 (dd, J= 15,6, 1.3 Hz, IH), 4.55 (d../ 15.5 Hz, I H), 4.31 - 4.14 (m, 4H), 4.02 - 3.96 (rn, 4H), 3.95 - 3.91 (m, 5H), 3.38 (td, ./ 10.9, 3.9 Hz, IH), 3.33 - 3.06 (m, 2H), 2.78 - 2.65 (m Hz, IH), 2.63 - 2.46 (m, IH), 2.04 - 1 .92 (m, 4H).
[00216] LC/MS: retention time 3.38 mm. (ESI) C39H40CIN4O4 calculated for [M+H]+ 663; found 663.
[00217] Ally! protected IQB-CBI (19e) [00218] Procedure as described for 19a, obtained 6 mg of 19e (12% yield).
[00219] ¾ NMR (500 MHz, CDCb) δ 7.83 (s, 1H), 7.79 (d, J= 8.5 Hz, 1H), 7.66 (d, J= 8,3 Hz, 1H), 7,59 - 7.42 (m, 2H), 7,41 - 7.28 (m, 6H), 6.81 (s, 1H), 6.07 (ddd, ,/ = 16.1, 10.6, 5.3 Hz, 1H), 5,38 (dq, J = 17.3, 1.7 Hz, I I I). 5.27 5.20 (m, I I I ). 5.01 (d. ./ 15.5 Hz, i l l). 4.56 (d, ./ 15.5 Hz, 1H), 4.39 - 4.16 (m, 2H), 4.15 - 4.04 (m, 3H), 4.02 - 3.96 (m, 3H), 3.95 - 3.87 (m, 5H), 3.38 (t, J = 10.9 Hz, 1H), 3.27 (dd, J= 15.4, 5.6 Hz, iH), 3.16 (dd, J = 15 ,4, 4.2 Hz, IH), 2.62 (dt, ,/ = 15.6, 7.4 Hz, IH), 2.50 (dt, ,/= 15.6, 7.4 Hz, IH), 1 .96 (q, J= 7,2 Hz, 2H), 1.85 (q,■/ 7.9 Hz, 2H), 1.63 (p. ./ 7.9 Hz, 2H).
[00220] LC/MS: retention time 3.46 mm. (ESI) C40H42CIN4O4 calculated for [M+H]+ 677; found 677.
[00221] Synthesis of D801 (20a)
[00222] 19a (22 rng, 0.04 mmol) was dissolved in anhydrous DCM (0.8 mL).
Camphorsulfonic acid (6.4 mg, 0.12 mmol) and benzenesulfinic acid sodium salt (16.4 mg, 0.1 mmol) were added. Vial was flushed with Ar before adding palladium
tetrakistriphenylphosphine (4.6 mg, 0.004 rnmol). Reaction mixture was stirred for 30 minutes and concentrated to diyness. Residue was dissolved in DMSO (0.5 mL) and loaded directly onto 15,5 g Cis Aq Isco column and purified (5→95% ACN in H2O, each containing 0.05% of AcOH), Desired fractions were lyophiiized to obtain 9 mg of 20a (39%> yield).
[00223] ¾ NMR (500 MHz, CDCb) 6: 7.88 (s, IH), 7.80 (d, J = 8.3 Hz, IH), 7.68 id. J = 8,8 Hz, IH), 7,59 (s, IH). 7,52 (m, IH), 7.46 (m, IH), 7.34 (m, 6H), 6.87 (m, IH), 5.02 (d, J = 15.1 Hz, IH), 4,92 (m, 2H), 4.55 (d, J = 15.1 Hz, IH), 4.33 (m, 2H), 4.07 (m, IH), 4.00 (s, 3H), 3.95 (m, 3H). 3.44 (m, IH), 3.26 (m, IH), 3.13 (rn, IH).
[00224] LC/MS: retention time 2,93 min. (ESI) C33H30CIN4O4 calculated for [M+Hf 581 ; found 581.
[00225] Synthesis of D807 (20b)
[00226] Procedure as described for 20a, to obtain 2.1 mg of 20b ( 11% yield).
[00227] Ή NMR (500 MHz, CDCb) δ: 7,93. (s, IH), 7.81 (d, J = 8.3 Hz, IH), 7,69 (d, J = 8.8 Hz, IH), 7.54 (s, IH). 7.49 (m, 2H), 7.35 (m, 6H), 6.94 (m, IH), 5.02 (d../ 15.1 Hz, IH), 4.56 (d, J = 15.1 Hz, IH), 4.54 (m, 2H), 4.30 (m, 3H), 4.05 (m, IH), 3.95 (m, 5H). 3.41 (m, IH), 3 ,2.5 (m, IH), 3.18 (m, 2H), 3.11 (m, IH). [00228] LCMS: retention time 2.90 min. (ESI) C34H32CIN4O4 calculated for [M+Hf 595; found 595.
[00229] Synthesis of D803 (20c)
[00230] Procedure as described for 20a, to obtain 5.0 mg of 20c (26% yield).
[00231] Ή NMR (500 MHz, CDCI3) δ: 7,94 (d, J = 8.3 Hz, 1H), 7.80 (d, J = 8.8 Hz, 1H), 7.67 id. ./ 8,8 Hz, i l l ). 7.48 (m, 4H), 7.34 (m, 6H), 6.87 (m, 1H), 5.02 (d, J ----- 15.1 Hz, 1H), 4.56 (d, J - 15.1 Hz, 1H), 4.28 (m, 4H), 4.05 (m, 1H), 3.92 (m, 5H). 3.39 (m, i l l). 3.26 (m, 1H), 3.14 (m, IH). 2.75 (m, 2H), 2.34 (m, 2H).
[00232] LCMS: retention time 2.98 min. (ESI) C30H34QN4G4 calculated for M+Hf 609; found 609.
[00233] Synthesis of D809 (20d)
[00234] Procedure as described for 20a, to obtain 2.0 mg of 20d (15% yield).
[00235] ¾ NMR (500 MHz, CDCI3) δ 7.92 (s, IH), 7.79 (dd, J = 8.5, 5.4 Hz, i l l). 7.66 (d, J= 8.4 Hz, IH), 7,54 - 7,44 (m, 3H), 7.42 - 7,28 (m, 5H), 6.82 (d, J = 1 ,5 Hz, i l l). 5,01 (dd, J= 15 ,5, 2,4 Hz, IH), 4,56 (d, J= 15.5 Hz, IH), 4.27 (d, J= 10.1 Hz, IH), 4, 19 (dt, J= 13,3, 7.5 Hz, 3H), 4.12 (t, J--- 7.3 Hz, 21 1). 4.02 id../ 9.8 Hz, I H), 3.97 - 3.82 (m, 5H), 3.39 (td, J ----- 10.9, 3.5 Hz, IH), 3.27 (..id.■/ 15,4, 5,6 Hz, IH), 3.15 (c!i. ./ 15,4, 3,7 Hz, IH), 2.71 - 2,62 (m, I H), 2.61 - 2.57 (m, IH), 2.11 - 1.91 (m, J= 7.1, 6.6 Hz, 4H).
[00236] LCMS: retention time 3,03 min. (ESI) C36H36QN4G4 calculated for [M+Hf 623; found 623.
[00237] Synthesis of D805 (20e)
[00238] Procedure as described for 20a, to obtain 1.7 mg of 20e (30% yield).
[00239] ¾ NMR (500 MHz, CDCI3) δ 7.94 (s, IH), 7.79 (d, ,/ 8.4 Hz, IH), 7.67 (d, J ----- 8.3 Hz, IH), 7.53 (d, J= 0,7 Hz, IH), 7,52 - 7.44 (m, 2H), 7.41 - 7.29 (m, 5H), 6.81 (s, i l l). 5.01 (d, J= 15 ,5 Hz, IH), 4,56 (d, ,/= 15.5 Hz, IH), 4.27 (d, J= 10.9 Hz, 2H), 4.23 - 4.16 (m, IH), 4.15 - 4.05 (m, IH), 4.01 i i. ./ 9.4 Hz, IH), 3.97 - 3.87 (m, 5H), 3.39 (t, ./ 10.9 Hz, IH), 3.27 (dd, ./ 15.4, 5.6 Hz, IH), 3.16 (dd, ./ 15,4, 4,2 Hz, IH), 2,68 - 2.55 (m, IH), 2,55 - 2,43 (m, IH), 1.97 (p, J= 6,9 Hz, 2H), 1.86 (p, J= 7.4 Hz, 21 1). 1.63 (p, J= 7,9 Hz, 2H). [00240] LC/MS: retention time 3.10 min. (ESI) C37H38CIN4O4 calculated for [M+Hf 637; found 637.
[00241 ] Synthesis of IQB-hydroxyCBI dimers~33c; 33c-S,S; 33e and 33e~S,S (Scheme 3, referring to Figure 3)
[00242] Tert-butyl (4-((tert-buto.xycarbonyl)o.xy)naphthalen-2-yl)carbamate (22)
[00243] 4-methoxynaphthalen-2~amine (5.7 g, 33 mmol) was dissolved in mixture of AcOH and 48% HBr in water (2-3, v/v, 330 mL). The mixture was heated at 100 °C under Ar atmosphere for 24 hr and then concentrated to dryness. The residue was partitioned in EtOAc and saturated NaHCOs. Organic layer was separated and concentrated to dryness. The residue was dissolved in dioxane (66 mL) and B0C2O (8,6 g, 40 mmol) was added. The mixture was heated at 100 °C under Ar atmosphere for 2 hr and additional amount of B0C2O (4.3 g, 20 mmol) was added. After another 2 hr reaction mixture was concentrated to dryness, dissolved in small amount of DCM and purified on 120 g a silica Teiedyne Isco column (0→50% EtOAc in hexane). Evaporation of product containing fractions afforded 6.5 g of 22 (55% yield).
[00244] LC/MS: retention time 3.87 min. (ESI) C20H28NQ& calculated for i \! I K) i l l 378; found 378.
[00245] Tert-butyl (4-hydroxynaphthalen-2-yl)carbamate (23)
[00246] Diboc derivative 22 (6.5 g. 18 mmol) was dissolved in THF-MeOH-LbO (3-1-1, v/v/v, 180 mL). LiOH (650 mg, 27 mmol) was added and reaction mixture was stirred for 3 hr and then concentrated to dryness. After dilution with saturated NH4CI, the product was extracted with EtOAc (2x100 mL). The organic layer was concentrated to dryness, dissolved in small amount of DCM and purified on 80 g a silica Teiedyne Isco column (0→20% EtOAc in hexane). Evaporation of product containing fractions afforded 3.2 g of 23 (67% yield).
[00247] ¾ N .MR (500 MHz, CDCI3) δ: 8.07 (d, J - 8.3 Hz, i l l). 7.68 (d, J = 8.3 Hz, IH), 7,44 {! ../ 7,3 Hz, 1H), 7,36 (m, I H). 7.29 (s, H i ). 7.14 (br, 1H), 6.60 (br, 1H), 5,69 (br, 1H), 1.56 (s, 9H).
[00248] LC/MS: retention time 2.96 min. (ESI) C :.<H .«NO = calculated for [M+H]÷ 260; found 2.60,
[00249] Tert-butyl (4-(benzyloxy)naphthalen-2-yl)carbamate (24) [00250] To a solution of phenol 23 (3.2 g, 12 mmol), BnBr (1 .75 mL, 15 mmol) in DMF (25 mL) cesium carbonate (8.1 g, 25 mmol) was added and mixture was stirred for 30 minutes Reaction mixture was diluted with water (100 mL) and extracted with diethyl ether (3x50 mL), combined organics were concentrated to dryness and purified on 80 g a silica Teledyne Isco column (0→10% EtOAc in hexane). Evaporation of product containing fractions afforded 3.2 g of 24 (77% yield).
[00251] I .( /MS: retention time 3.98 min. (ESI) C22H24NO3 calculated for [M+Hf 350; found 350.
[00252] Tert-butyl (4-(benzyloxy)-l-iodonaphthalen-2-yl)carbamate (25)
[00253] To a 24 (3 ,2 g, 9.2 mmol) and TsOH-rfcO (50 mg) in THF-MeOH (1 -1, v/v, 150 mL), MS (2.23 g, 10 mmol) in THF (5 mL) was added dropwise at -78 °C (dry ice/acetone cooling bath). Mixture was stirred at that temperature for 1 hr and then concentrated to dryness on rotary evaporator. The residue was purified on 120 g a silica Teledyne Isco column (0-→10% EtOAc in hexane). Evaporation of product containing fractions afforded 3.2 g of 25 (73% yield).
[00254] LC MS: retention time 4.57 min. (ESI) C22H23INO3 calculated for | \M 1 | 476; found 476.
[00255] Tert-butyl allyl(4-(benzyloxy)-l-iodonaphthalen-2-yl)carbamate (26)
[00256] To solution of 25 (3.2 g, 6.7 mmol) in DMF (13 mL) sodium, hydride in mineral oil (536 mg, 13.4 mmol) was added in small portions. After stirring for 5 minutes AllylBr (2.9 mL, 33 rnmol) was added dropwise. After stirring for 30 minutes reaction mixture was diluted with water (1 0 mL) and extracted with diethyl ether (3x50 mL), combined organics were concentrated to dryness and purified on 80 g a silica Teledyne Isco column (0→10% EtOAc in hexane). Evaporation of product containing fractions afforded 3,4 g of 26 (98%j yield).
[00257] Ή NMR (500 MHz, CDCI3) δ mixture of rotamers in ratio 3: 1, signals for major one are reportedLJ : 8.32 (d, J - 8.3 Hz, i l l ). 8.22 (d, J - 8.3 Hz, 1H), 7.61 (m, 1H), 7.36 (m, 1H), 7.49 (in. 3H), 7.42 (m, 3H), 6.70 (s, 1H), 5.93 (m, i l l). 5.27 (m, 1H), 5.04 (m, 2H), 4.56 (m, H i ). 3.82 (m, 1H), 1 ,32 (s, 9H).
[00258] LC/MS: retention time 4.52 mm. (ESI)
Figure imgf000061_0001
calculated for [M+Naf 538; found 538. [00259] Tert-butyl 5-(benzyloxy)-l-(((2,2,6,6-tetramethylpiperidin-l-yl)oxy)methyl)- l,2-dihydro-3H-benzo[e]indole-3-carboxylate (27)
[00260] To a solution of 26 (3.4 g, 6.6 mmol) in benzene (220 mL), under Ar, was added TEMPO (3.1 g, 20 mmol) and Bu.iSnH (1.8 mL, 6.6 mmol). The mixture was stirred at 70°C for 15 mill, then additional amount of BusSnH (1 mL) and TEMPO (Ig) were added. After an additional 15 min, TEMPO (1 g) and BujSnH (1 ml.) were added and the mixture was stirred for another 15 min, at which point more TEMPO ( 1 g 39 rnmol) and BusSnH ( 1 mL) were added. After another 15 min, a final portion of BusSnH ( 1 mL, 19.5 mmol) and TEMPO (1 g) were added. The resulting mixture was stirred for additional 30 min at 70 °C and
concentrated to dryness. The resulting residue was purified by column chromatography (0→10% EtOAc in Hex) to afford 5 g of crude 27, containing TEMPO as impurity. Used as is in the next step.
[00261] LC MS: retention time 5.29 rain. (ESI) C34H45N2O4 calculated for | \ i I I I 545; found 545.
[00262] Tert-butyl 5-(benzyloxy)-l-(hydroxymethyl)-l,2-dihydro-3H-benzo[e]indole- 3-carboxylate (28)
[00263] To solution of crude 27 (5 g, 6 mmol) in AcOH-THF-HiO (3-1 -1 , v/v/v, 120 mL) Zn powder (4.7 g, 72 mmol) was added in small portions. The mixture was stirred at 80 °C for 3 hr and then concentrated to dryness. Residue was carefully quenched with saturated NaHC03 and extracted with diethyl ether (2x100 mL). Organic solution was concentrated to dryness and purified on 80 g a silica Teledyne Isco column (0-->60% EtOAc in hexane). Evaporation of product containing fractions afforded 1.69 g of 28 (63% yield over 2 steps).
[00264] ¾ NMR (500 MHz, CDCb) δ: 8.30 (d, J = 8.3 Hz, 1H), 7.92 (br, I I I ). 7.72 (d, J = 8.3 Hz, 1 H), 7.55 (m, 2H), 7.48 (m, IH), 7,44 (m, 2H), 7.34 (m, 2H), 5.28 (br s, 2H), 4.23 (m, IH), 4.14 (rn, 1H), 3.96 (m, IH), 3.86 (m, I H), 3.79 (m, IH), 1.61 (s, 9H).
[00265] LC/MS: retention time 3.77 min. (ESI) C25H25NO4 calculated for [M+Hf 406; found 406.
[00266] Tert-butyl 5-(benzyloxy)-l-(chloromethyl)-l,2-dihydro-3H-benzo[e]indole-3- carboxylate (29)
[00267] Alcohol 28 (406 mg, 1 mmol) was dissolved in anhydrous DCM ( 10 mL) and PluPCh (500 mg, 1 .5 mmol) was added at once. After stirring for 1 hr reaction mixture was quenched with saturated aHCOn and extracted with chloroform. Combined organics were dried over MgS04 and concentrated. The residue was purified 12 g a silica Teledyne Isco column (0→50% EtOAc in hexane). Evaporation of product containing fractions afforded 230 g of 29 (54% yield) .
100268] ¾ NMR (500 MHz, CDCb) δ: 8.32 (d, J = 8.79 Hz, 1H), 7.90 (br, 1H), 7.66 (d, J = 8.30 Hz, 1H), 7.55 (m, 3H), 7.46 (t, J = 7.57 Hz, 2H), 7.37 (m, 2H), 5.30 (s, 2H), 4 ,28 (br s, 1 H), 4.15 (t, ,/ = 10.50 Hz, 1 H), 3.98 (m, 2H), 3.46 (t, J = 10,50 Hz, 1H), 1.64 (s, 9H).
[00269] LC MS: retention time 4.50 min. (ESI) C25H27CINO3 calculated for [M+H]+ 424; found 424.
[00270] Tert-butyl l-(chloromethyl)-5-hydroxy-l,2-dihydro-3H-benzo[e]indole-3- carboxylate (30) and chiral separation to (30-(S))
[00271] Flask containing solution of 29 (232 mg, 0.55 mmol) in EtOAc (6 mL) was flushed with Ar and Pd(OH)2/C (10% by weight, 50 mg) was added. Hydrogen (ballon) was bubbled through solution for 24 hr and then reaction mixture was filtered off through celite, concentrated and purified on 12 g silica Teledyne Isco column (0→50% EtOAc in hexane). Evaporation of product containing fractions afforded 145 mg of 30 (78% yield).
[00272] Racemic 30 was dissolved in 5 mL hexane-IPA (9-1 , v/v, 5 mL) and injected in 1 mL portions on chiral HPLC with OD-H column (20 x 250 mm, 5 μιη), 25 mL/min, 0→5% IPA in hexane over 20 minutes. tr(30-(i?))== 12 min; tr(30-(S))= 14 min (J. Am. Chetn. Soc, 1994, 116. 7996-8006). Fractions containing desired enantiomer were combined and concentrated to dryness to afford 51 mg of 30-(S).
[00273] ¾ NMR (500 MHz, CDCb) δΠ : 8.22 (d, J= 8 ,20 Hz, I I I). 7.82 (br s, 1H), 7.64 (d, J = 8.20 Hz, 1H), 7.50 (m, 1H), 7,34 (ddd, J = 8.34, 6.88, 1.17 Hz, 2H), 4.26 (m, 1 H), 4.14 (m, 1H), 3.96 (m, 2H), 3.43 (m, 1H), 1.61 (m, 9H).
[00274] LC MS: retention time 3.55 min. (ESI) Ci8H2iClN03 calculated for [M+H]+ 334 ; found 334.
[00275] Synthesis of D811 (32c)
[00276] (6aS)-3-(4-(l-(chloromethyl)-5-hydroxy-l,2-dihydro-3H-benzo[e]indol-3-yl)- 4-oxobutoxy)-2-methoxy-7,12-dihydrobenzo[5,6] [l,4] diazepino[l,2-b]isoquinolin-
14(6aH)-one (32c/D811) [00277] 4 M HC1 in dioxane ( 1 mL) was added to Boc-protected CBI racemic 30 (15 mg, 0.03 mmol). Solution was kept at rt for 2 hr and then concentrated to dryness to afford hydrochloride of 31. Residue was redissolved in anhydrous chloroform (2 mL) evaporated again, procedure was repeated twice. Then it was dissolved in DMF (0.8 mL) and acid 11c (15 mg, 0.039 mmol) was added followed by EDC-HC1 ( 16 mg, 0.09 mmol). Reaction mixture was stirred for 1 hr and then directly loaded onto a 15.5 g Cis Aq Isco column and purified (5→95% ACN in H2O, each containing 0.05% of AcOH). Desired fractions were lyophilized to obtain 2.5 mg of 32c ( 12% yield).
[00278] ¾ N .MR (500 MHz, CDCh) 6: 8.26 (d, ./ 8.30 Hz, 1H), 8.23 (s, 1H), 8.17 (s, 1H), 7.51 (m, 3H), 7.33 (m, 5H), 6.88 (m, IH), 4,98 (d, J = 15.1 Hz, IH), 4,53 (d, J = 15.1 Hz, I I I ). 4.28 ( ni. 4H), 4.04 (m, 2H), 3.95 (rn, 2H), 3.86 (m, 4H), 3.41 (m, 1H), 3.18 (m, i l l). 3.07 (m, 1H), 2.84 (m, 1H), 2.40 (m, 2H).
[00279] LC/MS: retention time 3.07 mm. (ESI) C35H33CIN3O5 calculated for [M+Hf 610; found 610.
[00280] Synthesis of D813 (32e)
[00281] (6aiy)-3-((6-(l-(chloromethyl)-5-hydroxy-l,2-dihydro-3H-benzo[ejindol-3-yl)- 6-oxohexyl)oxy)-2-methoxy-7,12-dihydrobenzo[5,6] [l,4]diazepino[l,2-b]isoquinolin- 14(6aH)-one (32e D813)
[00282] Procedure as described for 32c but staring with lie. Obtained 3.0 mg of 32e (14% yield).
[00283] ¾ NMR (500 MHz, CDCI3) δ: 8.26 (d, J = 8.30 Hz, 1H), 7.65 (m, 1H), 7.53 (m, 3H), 7.33 (m, 5H), 6.83 (m, 1H), 5 ,02 (d, J = 15.1 Hz, 1H), 4.56 (d, J = 15.1 Hz, 1H), 4.30 (m, 2H), 4.10 (m, 3H), 3 ,90 (m, 4H), 3.42 (m, 1H), 3.25 (m, IH), 3 , 14 (m, IH), 3.07 (m, 1H), 2.66 (m, 1H), 2.59 (m, IH), 2.84 (m, IH), 1.99 (m, 2H), 1.92 (m, 2H).
[00284] LC/MS: retention time 3.34 min. (ESI) C37H37CIN3O5 calculated for [M+Hf 638; found 638.
[00285] Synthesis of D815 (32c-S,S)
[00286] (S)-3-(4-((S)-l-(chloromethyl)-5-hydroxy-l,2-dihydro-3H-benzo[e]indol-3- yl)-4-oxobutoxy)-2-methoxy-7,12-dihydrobenzo[5,6J [l,4Jdiazepino[l,2-b]isoquinolin-
14(6aH)-ene (32c-(SJS)) [00287] Procedure as described for 32c but staring with 1 1 c and 30-(S). Obtained 3.3 mg (16% yield).
[00288] ¾ NMR (500 MHz, CDCb) δ: 8.26 (d, J = 8.30 Hz, 1H), 8.20 (s, IH), 7,64 (m, 1H), 7.51 (m, 3H), 7.33 (m, 5H), 6.87 (s, 1H), 5.00 (d. J 15.1 Hz, 1H), 4.54 (d. ,/ 15.1 Hz, 1H), 4,27 (m, 4H), 4.02 i rn. IH), 3.92 (m, 2H), 3 ,86 (m, 3H), 3.78 (m, i l l). 3 ,71 (m, 1H), 3.65 (ni, IH), 3 ,39 (m, i l l ). 3.19 (m, IH), 3 ,08 (m, IH), 2.88 (m, H), 2.78 (m, IH), 2,40 (m, 2H).
[00289] LC./MS: retention time 3.07 min. (ESI) C35H33CIN3O5 calculated for [M+H]+ 610; found 610.
[00290] Synthesis of D817 (32e-S,S)
[00291] (S)-3-((6-((S)-l -(chloromethyl)-5-hydroxy-l ,2-dihydro-3H-benzo[e]indol-3- yl)-6-oxohexyl)oxy)-2-methoxy-7 2-dihydrobenzo[5,6] [l,4]diazepino[l,2-b]isoquinolin- 14(6aH)-one (32e-(5,5))
[00292] Procedure as described for 32c but staring with lie and 30-(S). Obtained 2.5 mg (12% yield),
[00293] Ή NMR (500 MHz, CDCb) δ: 8 ,26 (d, ,/ = 8.30 Hz, H), 8.23 (m, IH), 7.65 (m, IH), 7.53 (m, 3H), 7.33 (m, 5H), 6.85 (s, IH), 5.02 (d, J ------ 15.1 Hz, IH), 4.57 (d, J ------ 15.1
Hz, IH), 4.30 (in. 21 1 ). 4.14 (m, 2H), 4.04 (m, IH), 3.90 (m, 6H), 3 ,41 (m, IH), 3.26 (in. IH), 3.16 (m, IH), 2.66 (m, IH), 2,59 (m, IH), 1.99 (m, 2H), 1.92 (m, 2H), 1 ,65 (m, 2H).
[00294] LC MS: retention time 3 ,34 min. (ESI) C37H37QN3Q5 calculated for [M+H]+638; found 638 ,
[00295] Example 2: Experimental protocols for the synthesis of IQB-CBI with various linking groups (Schemes 5 and 6, referring to Figures 5 and 6)
[00296] The synthesis protocol used to produce CLT-D801 can be modified to introduce various spacer groups between the IQB moiety and the CBI moiety. Referring to FIGs 5 and 6, the protocol can proceed in an identical fashion, with a modification introduced at the step between compounds 9 and 10. More specifically, rather than 2-bromoacetic acid, a carboxylic acid incorporating a moiety I, as described herein, in used.
[00297] Example 3: Cytotoxicity of IQB-aminoCBI and IQB-hydroxyCBI Dimers [00298] Cytotoxicity of D801 , D803, DOS, D807, D809, D81 1 , D813, D815 and D817 were tested against AML2 and HL60 cell lines. Results are shown in Table 1. Cell killing assay was performed after 3-day incubation with various IQB-CBI dimers.
Table 1 :
Figure imgf000066_0001
[00299] General Methods:
[00300] ¾ NMR spectra were recorded on a Varian Inova 300 or 00 MHz NMR instrument. Chromatographic purities were determined on an Agilent 1200 Series, 1100 Series or 6130 Series LC/MS system using a Merck Chromolith RP-18e analytical HPLC column (monolithic, 50 χ 2 mm) and the following analytical HPLC method: injection volume 5 μί: flow rate 1 mL/min; 5→95 % acetonitrile in water with 0.05% AcOH over 5 mins; Agilent diode array detector at λ = 254, 220 or 195 nm; room temperature.
[00301] 1.0 Synthesis of Linkers (Scheme 7} (Referring to FIG, 7}
[00302] 1 J i-boc-N-amido-dPEGiVVaI-A!a-4-aminobenzy!-pentafliioropheny! carbonate (3).
[00303] To an Ar purged solution of ^boc-N-amido-dPEG*VVal-Ala-4-aminobenzyl- alcohol (1) (350 mg, 0,428 mmol) in DMF (2.1 mL), added DIEA (149 ,LlL, 0.856 mmol), followed by bis-(pentafluorophenyl)-carbonate (253 mg, 0.643 mmol). The reaction was then stirred at 22 °C for 45 min. The resulting reaction mixture was then directly loaded and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford (3) as a yellow foam (347 mg, 79% yield, 0.338 mmol),
[00304] ¾ NMR (500 MHz, CDCI3): δ 8.69 (bs, 1H), 7.78 (d, J= 8.4 Hz, 2H), 7.36 (d, J = 8.4 Hz, 2H), 6.98 (bs, 1H), 6.86 (bs, 11 1). 5.27 (s, 2H), 5.02 (bs, 1H), 4.70-4.64 (m, i l l). 4.20 {·../ 5.9 S !,··:. 1H), 3.86 (td, J = 9.9, 2.9 Hz, 1H), 3.69-3.61 (m, 29H), 3.53 4.8 Hz, 2H), 3.31 (bd, J= 4.3 Hz, 2H), 2.70-2.65 (m, 1H), 2.49-2.45 (m, 1H), 2.30 (dq, J= 12.7, 6,4 Hz, 1H), 1,45 (d, ,/= 1 1.5 Hz, 3H), 1.44 (s, 9H), 1.01 (dd, J= 15.0, 6,8 Hz, 6H). [00305] LC/MS: retention time 2.98 min. (ESI) C κ-Ι !·.~Γ. Ν ιΟ · η: [M+Na] * 1049; found 1049.
[00306] 1.2 /-boc-N-amido-dPEG®8-Val-Ala-4-aminobenzyl- iV^^-dimethylethane- 1,2-diamine carbamate (S).
[00307] To a solution of N, N^dimethylethane- -diamine (4) (142 ,uL, 1.32 mmol) in DMF (0.33 mL) under Ar, was added a crude solution of (5) reaction mixture (described above) (0.0661 mmol) in 0.33 mL DMF, dropwise. An additional 100 lL of DMF was used to wash the transfer flask and added to the reaction mixture to ensure a complete transfer of (3) to the reaction mixture. The resulting mixture was then stirred at 22 °C for 1 h. The reaction mixture was diluted with 0.5 mL FfcO then directly loaded and purified via reverse phase column chromatography (0— ->100% ACN in FfcO, each containing 0.05% AcOH) and desired fractions Iyophilized to afford (5) as an off-white foam (37.1 mg, 60% yield, 0.0398 mmol).
[00308] T-I MR (500 MHz, CDCI3): δ 8,56 (bs, 1H), 7,68 (d, ,/= 8.3 Hz, 2H), 7.30 (d, J ------ 8.3 Hz, 2H), 6.95 (bs, 1H), 6.81 (bs, 1H), 5.04 (s, 2H), 4.65 (quintet, ./ 7.4 Hz, 1H), 4.20
(t, ./ = 6.3 Hz, 1H), 3.88-3.83 (m, 1H), 3.70-3.59 (m, 29H), 3.53 (t, J= 5.0 Hz, 2H), 3 ,43-3 ,37 (m, 2H), 3.31-3.30 (m, 2FI), 2.94 (s, 'ill), 2,80-2,78 (m, 1H), 2.73-2.71 (m, IH), 2.68-2.63 (m, i l l). 2.50-2.45 (m, 4H), 2.40 (s, 2H), 2.29 (dt, J ----- 7.1, 6.3 FIz, I I I). 1.45 id. J= 7.4 Hz,
3H), 1.44 (s, 9H), 1.00 (dd. J 15.1, 6.9 Hz, 6H).
[00309] LC/MS: retention time 2. 15 mm. (ESI) C44H79N6O15: [M+H] + 932; found 932.
[00310] 2.0 Synthesis of Carbonate D816 (Scheme 8) (Referring to FIG. 8)
[00311] 2.1 ί-boc- N-amido-dPEG*'8-Val-Ala-4-aminobenzyl carbonate of
OxoDuocarmycin-IQB-3C spacer (7).
[00312] To a solution of (6aS)-3-(4-(l -(chloromethyl)-5-hydroxy-l,2-dihydro-3H- benzo[e]indol-3-yl)-4-oxobutoxy)-2-methoxy-7,12-dihydrobenzo[5,6] [l,4]diazepino[l,2- b]isoquinolin-14(6aH)-one (6) (20.3 mg, 0.333 mmol) in DMF (1.1 mL), under Ar, added - boc-N-amido-dPEG¾-Vai-Ala-4-aminobenzyl-pentafluorophenyl carbonate (3) (34.2 mg, 0.0333 mmol) and DMAP (10.2 mg, 0.0833 mmol). The resulting mixture was stirred at 22 °C for 1 h. The resulting reaction mixture was then directly loaded and purified via reverse phase column chromatography (0→100% ACN in Η2Ο, each containing 0.05% AcOH) and desired fractions Iyophilized to afford (7) as a white solid (29.6 mg, 61% yield, 0,0204 mmol). [00313] LC/MS: retention time 3.01 min. (ESI) (-<Η·>·>('ΐν( ·· [M+H] ÷ 1452; found 1452.
[00314] 2.2 Amino-dPEG®8-Val-Ala-4-aminobenzyl carbonate of OxoDuocarmycin- IQB-3C spacer (8)
[00315] To ί-boc- N-amido-dPEG®8-Val-Ala-4-aminobenzyl carbonate of
OxoDuocannycin-IQB-3C spacer (7) (29.6 mg, 0.0204 mmol), under Ar, added a solution on 10: 1 DCM/TFA solution ( 1.0 mL). The resulting mixture was stirred at 22 °C for 30 min. The resulting reaction mixture was then directly loaded and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford (8) as a white solid ( 1 1.8 mg, 44% yield, 0.00872 mmol).
[00316] LC/MS: retention time mm. (ESI) ( ].·. (Ί \ -() :*: [M+H] * 1352; found 1352.
[00317] 2.3 Maleimido propionate-Amido-dPEG*8-Val-Ala-4-aminobenzyl carbonate of OxoDuocarmycin-IQB-3C spacer, (D816) (10)
[00318] To a solution of amino-dPEG®8-Val-Ala-4-aminobenzyl carbonate of
OxoDuocarmycin-IQB-3C spacer (8) (1 1.8 mg, 0.00872 mrnoi) in DCM (0.5 rnL) under Ar, was added TEA (12.2 (uL, 0.0872 mmol), and maleimido propionate NHS ester (8). The resulting mixture was stirred at 22 °C for 1 h. The reaction mixture was then concentrated, dissolved in DMSO and directly loaded and purified via reverse phase column
chromatography (0— ->100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford (10) as a white solid (6.8 mg, 52% yield, 0.00452 mmol).
[00319] LC/MS: retention time 2.74 min. (ESI)
Figure imgf000068_0001
[M+H] + 1503; found 1503.
[00320] 3.0 Synthesis of Carbamate D81S (Scheme 9) (Referring to FIG. 9)
[00321] 3.1 i-boc- N-amido-dPEG®8-Val-Ala-4-aminobenzyl dicarbamate of
dimethyldiamine and OxoDuocarmycin-IQB-3C spacer (12).
[00322] To a solution of tert-butyl (S)-l-(chloromethyl)-5-hydroxy-l ,2-dihydro-3H- benzo[e]indole-3-carboxylate (11) (83 mg, 0.25 mmol) in ACN (1.3 mL), under Ar, added p- nitrophenoxychloroformate (55 mg, 0.28 mmol) and DIEA (0.112 mL, 0.65 mmol). The resulting mixture was stirred at 22 °C for 1 h and 5 (200 mg, 0,21 mmol) was added. The reaction mixture was stirred for 30 minutes was then directly loaded and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford (12) as a white solid (161 mg, 58% yield). [00323] LC/MS: retention time 3.79 min. (ESI) C63H98CIN7O20: [M+H2O+H] ÷ 1308; found 1308.
[00324] 3.2 Maleimido propionate-Amido-dPEG®8-Val-Ala-4-aminobenzyl
dkarbamale of dimethyldiamine and OxoDuocarmycin-IQB-3C spacer (13).
[00325] To 12 ( 161 mg, 0.125 mmol), under Ar, added a solution on 10: 1 DCM/TFA solution (1.0 mL). The resulting mixture was stirred at 22 °C for 30 mm. The resulting reaction mixture was then directly loaded and purified via reverse phase column
chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophiiized to afford free amine intermediate.
[00326] To a solution of deprotected amine (42 mg, 0.0382 mmol) in DCM (1.5 mL) under Ar, was added DIEA (13 μΕ, 0.076 rnmol), and maleimido propionate NHS ester (15 mg, 0.057 mmol). The resulting mixture was stirred at 22 °C for 1 h. The reaction mixture was then concentrated, dissolved in DMSO and directly loaded and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophiiized to afford (13) as a white solid (38 mg, 81% yield).
[00327] I .(VMS: retention time 2.87 mm. (ESI) CeoHeeClNeOis: [M+H] + 1241; found 1241.
[00328] 3.3 (S)-l-(chloromethyl)-3-(4-(((S)-2-methoxy-14-oxo-6a,7,12,14- tetrahydrobenzo[5,6]-[l,4]diazepino[l,2-b]isoquinolin-3-yl)oxy)butanoyl)-2,3-dihydro- l.H-benzo[e]indol-5-yI (4-((2S,5S)-37-(2,5-dioxo-2,5-dihydro-lH-pyrroI-l-yl)-5- isopropyl-2-methyl-4,7,35-trioxo-10,13,16,19,22,25,28,31-octaoxa-3,6,34- triazaheptatriacontanamido)benz l) ethane-l,2-diylbis(methylcarbamate (D818) (15).
[00329] To 13 (11 mg, 0,009 mmol) in anhydrous DMF (0.1 mL) and IQB acid (14) (4.3 mg, 0.011 mmol), ?TsOH (1 mg, 0.005 mmol) and EDOHC1 (6.2 rng, 0.032 mmol) were added to the reaction. The resulting mixture was stirred at 22 °C for 10 min, then directly loaded and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and product containing fractions were lyophiiized then repurified on EZ Prep (Gemini 30 x 150 mm column) (5→95% ACN in H2O, each containing 0.05% AcOH) to afford (15) as a white solid (1.6 mg, 11% yield).
[00330] LC/MS: retention time 2.64 rain. (ESI) (V! ! ::,„( ΙΝ -..0 · .: [M+H] ÷ 1618; found 1618.
[00331] 4.0 Synthesis of Ether Linked Derivatives (Scheme 10) (Referring to FIG. 10) [00332] 4.1a f-Butyl {iS)-l~(chloromethyl}-5~((4-nitrobenzyl}oxy)-l ,2-dihydro~3H- benzofe]indo!e-3~earboxyIate (16a).
[00333] To a solution of -butyl (5)-l-(chloromethyl)-5-hydroxy-l ,2-dihydro-3H- benzo[e]indole-3-carboxy]ate (11) (200 mg, 0,599 mmol) in anhydrous DMF (1.20 mL), under Ar, was added 4-nitrobenzyl bromide (518 mg, 2.40 mmol) and 2CO3 (585 mg, 1.80 mmol). The resulting mixture was stirred at 22 °C for 2 h. The reaction mixture was then partitioned between EtOAc and Η2Ο, and extracted with EtOAc (3 x 20 mL). The combined organics were washed with Η2Ο (4 x 20 mL), dried over MgSC , filtered and concentrated. The crude residue was purified via column chromatography (0→10% EtOAc in Hexanes) to afford the desired product (16a) as a yellow solid (208 mg, 74% yield, 0.443 mmol).
[00334] T-I NMR (500 MHz, CDCb): δ 8,29 (t, J= 7.5 Hz, 3H), 7.86 (bs, 1H), 7.73 (d, J = 7.9 Hz, 2H), 7.67 (d, J ----- 8.6 Hz, I I I). 7.54 (t,■/ 7.4 Hz, I I I ). 7.40-7.37 (m, i l l). 5.39 (s, 2H), 4.26 (bd, J = 10.3 Hz, 1H), 4. 14 (t. -/ 10.0 Hz, IH), 3.99 (t, J= 9.8 Hz, 1H), 3.94 (d, J = 9.6 Hz, 1H), 3,45 (t, ./= 10.6 Hz, 1H), 1.60 (s, 9H).
[00335] LCMS: retention time 3,93 min. (ESI) C25H26CIN2O5: [M+H] + 469; found 469.
[00336] 4.1b i-But l (S)-l-(chloromethyl)-5-((3-methoxy-4-nitrobenzyl)oxy)-l,2- dihydro-3H-benzo[e]indole-3-carboxylate (16b)
[00337] OxoDuocarmycin 16b was synthesized according to the same procedure as 16a but starting with 3-methoxy-4-nitro benzyl bromide.
[00338] ¾ NMR (500 MHz, CDCb) δ: 8.29 (d, ./ 7.5 Hz, 1H), 7.92. (d, ,/ 7,9 Hz, 2H), 7.68 (d, J 8.6 Hz, IH), 7.55 (i. ./ 7.4 Hz, 1H), 7.40-7.37 (m, 1H), 7.30 (s, 1H), 7.22 (d.■/ 7,5 Hz, IH), 5,34 (s, 2.H), 4 ,2.6 (bd, ./ = 10.3 Hz, I H). 4.15 (t, J = 10.0 Hz, IH), 4.02 (s, 3H), 3 ,96 (t, ./ 9.8 Hz, IH), 3.93 (d, J= 9,6 Hz, ! ! !}. 3,46 (t, ./ 10,6 Hz, IH), 1.61 (s, 9H).
[00339] LC/MS: retention time 3.93 rain. (ESI)
Figure imgf000070_0001
[M+Na] ÷ 521 ; found 521.
[00340] 4.2a i-Butyl (S)-l-(chloromethyl)-5-((4-aminobenzyl)oxy)-l,2-dihydro-3H- benzo[e]indole-3-carboxylate (1.7a)
[00341] To a solution of -butyl (5)-l-(chloromethyl)-5-((4-nitrobenzyl)oxy)-l,2-dihydro- 3H-benzo[e]indole-3-carboxylate (16a) (208 mg, 0.443 mmol) in THF/Acetone (11.1 mL/8.9 mL, respectively), under Ar, was added H2O (4.5 mL), Zn dust (868 mg, 13.3 mmol) and NH CI (1.42mg, 26.6 mmol). The resulting mixture was stirred at 22 °C for 45 min. The reaction mixture was then filtered through a pad of Ceiite® and w ashed with DCM (20 mL). The filtrate was concentrated then partitioned between DCM and H2O. H e organics were then dried over MgS04, filtered and concentrated. The isolated crude residue was deemed pure desired product (17a) as a yellow foam (191 mg, 98% yield, 0,435 mmol).
[00342] T-I NMR (500 MHz, CDCb): δ 8,25 (d, ,/= 8.2 Hz, IH), 7.85 (bs, 1H), 7.63 (d, J = 8.2 Hz, 1H), 7.50-7.47 (m, 1H), 7.32-7.30 (m, 3H), 6.73 (d, J= 8.2 Hz, 2H), 5.13 (s, 2H), 4.25 (bs, 1H), 4.12 (t, ./ 10.0 Hz, 1H), 3.95 (q, ./ 9.9 Hz, 2H), 3.73 (s, 2H), 3.43 (t, J ------
10.3 Hz, i l l). 1.61 (s, 9H),
[00343] LC/MS: retention time 3.44 min. (ESI) ί -I >Ο Λα: [M+Na] + 461 ; found
461.
[00344] 4.2b i-Butyl (S)-l-(chloromethyl)-5-((3-methoxy-4-aminobenzyl)oxy)-l,2- d!hydro-3H-benzo[e]!odoIe-3-carboxyIate (17b).
[00345] OxoDuocarmycin 17b was synthesized according to the same procedure as 17a but starting with /-butyl (5)-l-(chloromethyl)-5-((3-methox}7-4-nitroberizyl)oxy)-l,2-dihydro- 3H-benzo [e] indole -3 -carboxylate 17 a.
[00346] I .( /MS: retention time 3.44 min. (ESI) C26H30C N2O4: [M+H] ÷ 469; found 469.
[00347] 4.3a /-Butyl (S)-l-(chloromethyl)-5-((4-((34S,37S)-34-isopropyl-2,2,37- trimethyl-4,32,35-trioxo-3,8,11 4 7,20,23,26,29-nonaoxa-5,33,36-triazaoctatriacontan- 38-amido)benzyl)oxy)-l,2-dihydro-3H-benzo[e]indole-3-carboxylate (18a).
[00348] To a solution of /-butyl (5)-l-(chloromethyl)-5-((4-aminobenzyl)oxy)-l,2- dihy dro-3H-benzo | e ] indole-3 -carboxylate (17a) (51.5 mg, 0.1 17 mmol) and
HO.AJaVaiPegsNHBoc (91.9 mg, 0. 129 mmol) in 10: 1 DCM/MeOH (550 ,LlL), under Ar, was added EEDQ (55.0 mg, 0.222mmol). The resulting mixture was stirred at 22 °C for 3.5 h. The reaction mixture was then concentrated, dissolved in DMSO and directly loaded and purified via reverse phase column chromatography (0-→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophiiized to afford (18a) as a white solid (49.2 mg, 38% yield, 0.00439 mmol).
[00349] Ή NMR (500 MHz, CDCb): δ 8.59 (bs, IH), 8.25 (d, J= 8 ,7 Hz, lH), 7,86 (bs, 1H), 7.76 (d. ./ 8.0 Hz, 2H), 7.64 (d,■/ 8.1 Hz, 1H), 7.51-7.46 (m, 3H), 7.32 (i. ./ 7.2 Hz, 1H), 6.96 (s, 1H), 6.82 (s, 1H), 5.20 (s, 2H), 5.02 (bs, 1H), 4.67 (L ./ 7.0 Hz, IH), 4.28-4.21 (m, 2H), 4.13 (t, J = 10.5 Hz, 1 H), 3.95 (q, J = 10.6 Hz, 2H), 3.88 (dt, J= 10.6, 5.2 Hz, IH), 3.71-3.61 (m, 281 1 ). 3.53 (t, ./ 4.7 Hz, 2H), 3.43 (t, J= 10.4 Hz, 2H), 3.30 (bs, 2H), 2,67 (t, J= 13 ,3 Hz, 1H), 2,50-2.47 (m, 1H), 2.31 -2.30 (m, 1H), 1.6 ! (s, 9H), 1.47 (d, J= 7.2 Hz, 3H), 1.44 (s, 9H), 1.01 (dd. J 15.0, 6.9 Hz, 6H).
[00350] I .('MS: retention time 3.44 min. (ESI) !^Π Ν.<) Νπ: [M+Na] + 1154; found 1154.
[00351] 4.3b -Butyl (S)-l-(chloromethyl)-5-((4-((34S,37S)-34-isopropyl-2,2,37- trimethyl-4,32,35-trioxo-3,8,ll,14,17,20,23,26,29-nonaoxa-5,33,36-triazaoctatriacontan- 38-amido)-3-methoxybenzyl)oxy)-l,2-dihydro-3H-benzo[e]indole-3-carboxylate (18b).
[00352] OxoDuocarmycin 18b was synthesized according to the same procedure as 18a but starting with /-butyl (5)-l-(chloromethyl)-5-((3-methoxy-4-aminobenz}d)oxy)-l ,2- dihydro-3H-benzo [e] indole-3 -carboxylate 17b .
[00353] Ή NMR (500 MHz, CDCh) δ: 8.37 (bs, 1 H), 8.34 (d, J= 8.7 Hz, 1H) 8.25 (d. ./ 8.7 Hz, 1H), 7.86 (bs, ! H), 7.64 (d, J= 8, 1 Hz, 1H), 7,51 (t, J= 8.0 Hz, 1H), 7.33 (t, ,/= 7.2 Hz, I I I ). 7.12 (d,■/ 8.0 Hz, I I I ). 7.07 (s, i l l). 6.94 (d, J ------- 8.0 Hz, 1H), 6.84 (br, I I I). 5.22
(s, 2H), 5.07 (bs, 1H), 4.65 (t, ./ 7.0 Hz, 1H), 4.35-4.24 (m, 2H), 4.13 (L .i 10.5 Hz, 1H), 3 ,95 (m, 2H), 3.92 (s, 3H), 3.77 (m, 2H), 3 ,71-3,61 (m, 28H), 3.54 (t, J = 4.7 Hz, 2H), 3.43 (t, ,/ = 10.4 Hz, 1H), 3.31 (m, 2H), 2.55 (m, 1H), 2..21 (m, 1H), 1.81 (br, 3H), 1.61 (s, 9H), 1 ,48 (d, ./ 7.2 Hz, 3H), 1.45 (s, 9H), 0.98 (dd, J -- 15.0, 6.9 Hz, 6H).
[00354] I . (VMS: retention time 3.46 min. (ESI) CssHssClNsOn: [M+Na] + 1184; found 1184.
[00355] 4.4a Λ^(5)-1-(((£)-1-((4-^
6a,7,12,14-tetrahydrobenzo[5,6] [l,4]diazepino[l,2-b]isoquinolin-3-yl)oxy)butanoyl)-2,3- dihydro-lH-benzo[e]iodoI-5-yS)oxy)methyS)pheoyl)amino)-l-oxopropan-2-yl)amino)-3- methyl-l-oxobutan-2-yl)-l -(3-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)propanamido)- 3,6,9,12,15,18,21, 24-octaoxaheptacosan-27-amide (19a) (D820b),
[00356] To r-bu yi (5)-l-(cWorome l)-5-((4-((34^,375)-34-isopropyl-2,2,37-trimethyl-
4,32,35~trioxo-3,8, l l, 14,r7,20,23,26,29-nonaoxa~5,33,36-triazaoctatnacontan~38- amido)benzy])oxy)-l ,2-dihydro-3H-benzo[e]indole-3-carboxylate (18a) in a 20 mL vial, cooled to 0°C, was added 2: 1 DCM/TFA (0.75 mL, precooled to -20 °C). The reaction mixture was stirred at 0°C for 30 min, at which time the reaction was judged complete by LC/MS. The reaction was concentrated in vacuo, then azeotroped with CHCb (4 x 5 mL) and left on high vac for 16b . The residue was then dissolved in DCM (1 mL) and TEA (6 ,LiL, 0.0422 mmol) was then added. An additional 2 ,uL of TEA was added to basify the reaction to pH~8, then maleimine NHS ester (9) (9,8 mg, 0.0369 mmol) was added and the resulting mixture was stirred at 22 °C for 15 min, at which point the reaction was judged complete by LC/MS, The reaction mixture was then concentrated and azeotroped with CHCb (3 x 5 ml.) and left on high vac for lh. The residue was then dissolved in anhydrous DMF ( 1 mL) and IQB acid (14) (20,8 mg, 0.0528 mmol), p TsOH (10 mg, 0.053 mmol) and EDOHC1 (30.3 mg, 0.158 mmol) were added to the reaction. The resulting mixture was stirred at 22 °C for 10 min, then directly loaded and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and product containing fractions were lyophilized then repurified on EZ Prep (Gemini 30 x 1 0 mm column) (5→95% ACN in H2O, each containing 0.05% AcOH) to afford (19a) as a white solid ( 1.7 mg, 5.5% yield over 3 steps, 0.001 16 mmol).
100357] LC MS: retention time 2.73 min. (ESI) CydfceClNeOig: [Μ+Ή] + 1459; found 1459.
[00358] 4.4b N-((S)-l-(((S)-l - ((4-((((Λ)-1 -(chSorometlhyS)-3-(4~(((iST)-2-methoxy-14~oxo-
6a,7,12,14-tetrahydrobenzo[5,6] [l ,4]diazepino[l,2-b]isoquinolin-3-yl)oxy)butanoyl)-2,3- dihydro-LH-benzo[e]indol-5-yl)oxy)methyl)-2-methoxyphenyl)amino)-l-oxopropan-2- yl)amino)-3-methyl-l-oxobutan-2-yl)-l-(3-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)propanamido)-3,6,9,12,lS,lS,21,24-octaoxaheptacosan-27-amide (19b) (D820).
[00359] OxoDuocarmycin 19b was synthesized according to the same procedure as 19a but starting /-butyl (S)-l-(chloromethyl)-5-((4-((34<S,37<S)-34-isopro
4,32,35-trioxo-3,8, l l, 14, 17,20,23,26,29-nonaoxa-5,33,36-tria^
methoxybenzyl)oxy)- l,2-dihydro-3H-benzo| e |indole-3-carboxylate 18b.
[00360] LC/MS: retention time 2.77 min. (ESI) ('--I ΙοχΠ ΝχΟ ·,.·: [M+H] + 1491; found
1491.
[00361 ] Example 4: Genera! experimental protocols for the synthesis of IQB- oxoduocarmycins analogs: D822, D824, D826 and D828
[00362] General Methods:
[00363] Ή NMR spectra were recorded on a Varian Inova 300 or 500 MHz NMR instrument. Chromatographic purities were determined on an Agilent 1200 Series, 1 100 Series or 6130 Series LC/MS system using a Merck Chromolith RP-18e analytical HPLC column (monolithic, 50 χ 2 mm) and the following analytical HPLC method: injection volume 5 μΐ,; flow rate 1 raL/min; 5-->95% acetonitrile in water with 0.05% AcOH over 5 mins: Agilent diode array detector at λ := 254, 220 or 195 nm; room temperature.
[00364] 1.0 Synthesis of Linker (Scheme 11} (Referring to Figure 11).
[00365] 1.1 ((Allyloxy)carbonyl)-L-valyl-L-alanine (2).
[00366] To a solution NHb-Val-Ala-OH (941 mg, 5 mmol) in DMF ( 10 mL), added DIEA (1.73 mL, 10 mmol) and N-(Allyloxycarbonyloxy)succinimide (1.15 rnL, 7.5 mmol).
Reaction mixture was stirred for 3 hr, quenched with water (3 mL) and stirred overnight. Solvent was removed in vacuo and the residue was diluted with HCl in water (40 mL, 0.25 M). After soni cation, the precipitate was filtered off and dried thoroughly to afford 2 (600 mg, 44% yield).
[00367] Π N .MR (500 MHz, DMSO~d6): δ 12.48 (bs, 1H), 8.18 id. ./ 7,0 Hz, 1H), 7, 16 id. ./ 9.4 Hz, 1H), 5.95-5.83 (m, IH), 5.28 id. ./ 15.8 Hz, 1H), 5.17 (d. ./ 10.5 Hz, 1H), 4 ,47 (m, 2H), 4.18 (m, I I I). 3,87 (m, 11 1). 1.94 (m, IH), 1.26 id ../ 7.6 Hz, 3H), 0.86 (dd, J = 14.6, 6.7 Hz, 6H).
[00368] I . (VMS: retention time 0,25 min. (ESI) C : <H < : N <()*: | M ! ! i ' 273: found 273, [00369] 1.2 Ally! ((.?)- l-(((5)-l-((4-(hydroxymethy!)phenyI)amino)-l-oxopropan-2- yI)amino)-3-methyl-l.-o.xobutan-2-yl)carbamate (3).
[00370] To a solution of ((Allyloxy)carbonyl)-L-valyl-L-alanine (2) (3.00 g, 11.0 mmol) and o-aminobenzyl alcohol (1.56 g, 12.7 mmol) in DCM (110 mL) and MeOH (55 mL), under Ar, added EEDQ (5.12 g, 20.7 mmol). The reaction mixture was stirred at 22 °C for 19 hr, then concentrated and purified via column chromatography (0→10% MeOH in DCM) to afford 3 (2.48 g, 60% yield).
[00371] ¾ NMR (500 MHz; CDsOD): δ 7,57 (d, J = 8.3 Hz, 2H), 7.32 (d, ./ 8.3 Hz, 2H), 6.00-5.92 (m, IH), 5.33 (d, J= 17.4 Hz, IH), 5 ,20 (d, ,/ = 10.5 Hz, IH), 4.57 (s, 2FI), 4.51 ic]. ./ 7.1 Hz, IH), 3.97 id. ./ 6.6 Hz, IH), 3.37 (s, 2H), 2.11 (dq. ./ 13.7, 6.8 Hz, IH), 1.46 (d. ./ 7.1 Hz, 3H), 0.99 (dd, ./ 17.8, 6.8 Hz, 6H),
[00372] LC/MS: retention time 2.02 min, (ESI) C19H28N4O5: [M+H] ' 378: found 378.
[00373] 1.3 Allyl ((iST)-3-methyl-l-oxo-l-(((lS)-l-oxo-l-((4-
((((perfluorophenoxy)carbonyl)-oxy)-methyl)-phenyl)-amino)-propan-2-yl)-amino)- butan-2-yl)carbamate (4).
[00374] To a solution of allyl ((S)- 1 -(((S)- 1 -((4-(hydroxymethyl)pheny])amino)- 1 - oxopropan-2-yl)ainino)-3-methyl-l-oxobutan-2-yl)carbaniate (3) (417 mg, 1.10 mmol) in DMF (5.5 mL), under Ar, added DIEA (383 \iL, 2.20 mmol) and
bis(pentafluorophenyl)carbonate (653 mg, 1.66 mmol). The reaction was stirred at 22 °C for 1 hr, then additional DIEA (190 ml, 1.10 mmol) and bis(pentafluorophenyl)carbonate (433 mg, 1.10 mmol) were added and the mixture was stirred for an additional 1 hr. The mixture was then loaded directly and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford 4 (442 mg, 68% yield).
[003751 Ή NMR (500 MHz; CDC! }. δ 8.51 (s, 1H), 7.65 (d, J = 7.8 Hz, 2H), 7.40 (d, ./ 8.5 Hz, 2H), 6.34 (d, ./ 7.3 Hz, 1H), 5.98-5.89 (m, 1H), 5.36-5.25 (m, 2H), 5.30 (s, 21 1). 5.19-5.18 (m, 1H), 4,67 (t, J= 7.1 Hz, 1H), 4.62 (d, J= 4.9 Hz, 2H), 4.01 (t, J= 6.4 Hz, 1H), 2.27-2.20 (m, 1H), 1.52 (d, J= 7.1 Hz, 3H), 1 .00 (dd, J= 23.2, 6.9 Hz, 6H).
[00376] LC/MS: retention time 3.44 mm. (ESI) ( -i i -i >N =0 -: [M+H] + 588; found 588.
[00377] 2.0 Synthesis of CBI moiety (Scheme 12) (Referring to Figure 12).
[00378] 2.1 Tert-butyl (S)-5-((bisallyloxy)phosphoiyl)oxy)-l-(chloromethyl)-l,2- dihydro-3H-benzo[e]indole-3-carboxylate (6a).
[00379] To a solution of 5 (67 mg, 0.2 mmol) in THF (1 mL), under Ar, added ietrazine (0.9 mL, 0.45 M solution in ACN) and diallyloxyphosphoramide (0.11 mL, 0.4 mmol). The resulting mixture was stirred at 22 °C for 2 hr, then hydrogen peroxide (0.045 mL, 50% in water) was added at once. After stirring for 45 minutes, the mixture was concentrated to dryness, dissolved in 1 mL DMSO and purified via reverse phase column chromatography (0→100% ACN in H2O, each containing 0.05% AcOH) and desired fractions lyophilized to afford 6a (72 mg, 73% yield).
[00380] ¾ NMR (500 MHz, CDCb): 8.13 (d, ./ = 8.3 Hz, 1H), 7.69 (d, ./ 8,3 Hz, 1H), 7.53 (t, J= 7,6 Hz, 1H), 7.40 (t, J= 7.6 Hz, IH), 5 ,96 (m, 2H), 5.39 (d, J= 17.1 Hz, IH), 5.26 (m, 2H), 4.71 (m, 4H), 4.30 (m, IH), 4.14 (m, I H), 3.99 (m, IH), 3.91 (d, J ----- 10.7 Hz, IH), 3.46 (i. 10.7 Hz, IH), 1.62 (bs, 9H).
[00381] LC/MS: retention time 3.75 min. (ESI)
Figure imgf000075_0001
[M+Na] +516; found 516.
[00382] 2.2 Tert-butyl (S)-l-(chloromethyl)-5-((methoxycarbonyl)oxy)-l,2-dihydro-
3H-benzo[e]indoSe-3-carbox late (6b).
[00383] To a solution of 5 (67 mg, 0.2 mmol) in DCM (2 mL), under Ar, added a solution pyridine (0.081 mL, 1 rnmol) and methyl chloroformate (0.046 mL, 0.6 rnmol). After 30 minutes, the reaction mixture was concentrated to dryness, dissolved on small amount of DCM and loaded on 12 g silica Isco column (0→50 % EtOAc in hexane). Desired fractions were concentrated to afford 6b (71 mg, 91% yield)
[00384] ¾ NMR (500 MHz, CDCb): 8.16 (bs, 1H), 7.93 (d, J = 8 ,8 Hz, 1H), 7,72 (d, J = 8.8 Hz, 1H), 7,54 (m, 1H), 7.40 (m, 1H), 4.30 (bs, 1H), 4.16 (m, 1H), 4.03 (m, 1H), 3.97 (m, 4H), 3.49 (t, J ------- 1 1.0 Hz, 1H), 1.61 (s, 9H).
[00385] LC/MS: retention time 3.72 min. (ESI) ( ,-,H -Ci\0,Aa [M+Na] + 414; found 414.
[00386] 2.3 Tert-butyl ( )-l-(ch!oroinethy!)-5-((4-methy!piperazi!ie-l-carbony!)oxy)~ l,2-dihydro-3H-benzo[e]indoIe-3-carboxyIaie (6c).
[00387] To a solution of 5 (100 mg, 0.3 mmol) in DCM (2 mL), under Ar, added pyridine (0.073 mL, 0.90 mmol) and 4-methylpiperazine-l-carbonyl chloride (0.061 mL, 0.45 mmol). After 16 h, the reaction mixture was concentrated to dryness, dissolved on 1 mL of DMSO purified via reverse phase column chromatography (0→100% ACN in Η2Ο, each containing 0.05% AcOH) and desired fractions lyophilized to afford 6c (133 mg, 97% yield).
[00388] ¾-NMR (500 MHz: CDCb): δ 8.09 (bs, 1H), 7.86 (d, J= 8.3 Hz, 1H), 7.72 (d, J ----- 8.5 Hz, 1H), 7.52 (t, ./ 7.6 Hz, 1H), 7.39 (t, J= 7.7 Hz, 1H), 4.28 (bs, 1H), 4.16 {· . ./ 10.2 Hz, I I I). 4.05-4.01 (m, 1H), 3 ,97-3 ,95 (m, 1H), 3.87 (bs, 2H), 3.66 (bs, 2H), 3.49 (t, J = 10.8 Hz, 1H), 2.54 (bd. J 16.6 Hz, 4H), 2.41 (s, 3H), 1.61 (s, 9H).
[00389] LC/MS: retention time 2.31 min. (ESI) C I I - C! VO I : [Μ+Ή] + 460; found 460.
[00390] 2.4 General procedure for removal of Boc group (7a-c)
[00391] 6a, 6b, or 6c (0.05 mmol) was dissolved in anhydrous DCM ( 1.6 mL) and boron trifluoride etherate (0.031 mL, 0.25 mmol) was added at once. After stirring for 40 minutes, the reaction mixture was concentrated to dryness and thoroughly dried on hi-vacuum before next step. No purification, material used as is in subsequent step.
[00392] 3.0 Synthesis of I B moiety and final assembly (Scheme 13) (Referring to
Figures 13 and 14) .
[00393] 3.1 4-(BenzyIoxyj-5-methoxy-2-oitrobenzoic acid (9).
[00394] 4-Benzyloxy-5-methoxy-benzoic acid methyl ester (9.1 g, 29 mmol) was dissolved in methanol ( 145 mL) and sodium hydroxide (6 M solution, 24 mL) was added at once. The reaction mixture was stirred for 1 hr at 50 °C, then methanol was evaporated. Concentrated hydrochloric acid ( 12 mL) was added slowly to the residue with stirring. Formed precipitate was filtered off, washed with water and dried to afford 8.1 g of 3 (92% yield).
[00395] Ή NMR (500 MHz, DMSO-d6) δ: 7.69 (s, IH), 7.36-7.47 (m, 5H),7,31 (s, IH), 5.24 (s, 2H), 3.91 (s, 3H).
[00396] LC/MS: retention time 2.40 min (EST) CisHisNOeNa: [M+Na] + 326; found 326.
[00397] 3.2 (S)-(4-(Benzyloxy)-5-methoxy-2-nitrophenyl)(3-(hydroxymethyl)-3,4- dihydroisoquinolin-2(lH)-yl)methanone (10).
[00398] To a solution of 4-(benzyloxy)-5-methoxy-2-nitrobenzoic acid (9) (10.0 g, 33.0 mmol) in DCM (100 mL) added HATU (16.3 g, 42.9 mmol) and DIEA (8.61 mL, 49.5 mmol). The mixture was stirred at 22 °C for 15 min, then added (/5)-(l,2,3,4- tetrahydroisoquinolin-3-y])methanol (6.46 g, 39.6 mmol). The resulting mixture was stirred at 22 °C for 2 hr, under Ar, then MeOH (50 mL) was added and the resulting precipitate was filtered and washed with DCM (100 mL). The resulting filtrate was concentrated and purified via column chromatography (25→85% EtOAc in hexane) to afford impure 10 (15.3 g 34.1 mmol) as a yellow foam.
[00399] ¾ NMR (500 MHz; CDCb) (contains rotamers and impurities): δ 8.67 (d, J= 4.6 Hz, 0.3H), 8,43 (d, J= 8.5 Hz, 0.3H), 7,85-7.82 (m, 2H), 7.79 (s, 0.3H ), 7,50 (t, J= 5.4 Hz, 5H), 7.46-7.43 (m, 4H), 7.40-7.38 (m, 2H), 7.26-7.22 (m, 2H), 7.19-7.16 (m, IH), 7.11-7.06 (m, 0.3H), 6.87 (d, ./ 7.0 Hz, IH), 6.75 (d l. ./ 1.8, 0.5 Hz, 0.3H), 6.67 (s, i l l). 5.62-5.52 (m, IH), 5 ,26 (s, 21 1). 5.25-5 ,25 (m, H), 5.11 (s, 0.3H), 4,98-4.96 (m, 11 1). 4.46-4.41 (m, IH), 4.34 (d, J= 15.4 Hz, IH), 4.28-4.23 (m, IH), 4.03 (s, 2H), 3.97 (s, 3H), 3.93-3.91 (m, 3H), 3.80-3.75 (m, IH), 3.68-3.62 (m, IH), 3.49-3.48 (m, IH), 3.28-3.22 (m, 0.3H), 3.19- 3.10 (m, IH), 3 ,08-3,03 (m, IH), 2.82 (s, 14H).
[00400] LC/MS: retention time 3.15 min. (ESI) C -i ! -N ,·{)<·: [M+H] + 449; found 449, [00401] 3.3 (S)-(4-(Benzyloxy)-5-methoxy-2-nitrophenyl)(3-(((tert- butySdimethylsiSyl)oxy)methyl)-3,4-diIiydroisoquinoSin-2(lH)-yS)methanone (11).
[00402] To a solution of (iS)-(4-(benzyloxy)~5-methoxy-2-nitroplienyl)(3- (hydroxymethy])-3,4-dihydroisoquinolin-2(IH)-yl)methanone (10) (15.3 g, 34.1 mmol) in DCM (155 mL), under Ar, added imidazole (4.64 g, 68.2 mmol) then TBSC1 (7.71 g, 51.2 mmol). The resulting mixture was stirred at 22. °C for 15 min, then was quenched with H2O (100 mL), extracted with DCM (3 x 150 mL), dried over MgS04, filtered and concentrated. The residue was purified via column chromatography (0→50% EtOAc in hexane) to afford 11 ( 14.0 g, 76% yield) yellow foam.
[00403] ¾ NMR (500 MHz; CDCbXcontains a mixture of rotamers) : δ 7.85 (s, 0.4H), 7,82-7,81 (m, Q.6H), 7.50-7.49 (m, 2H), 7,45-7,42 (m, 2H), 7.41 -7.36 (m, 1H), 7.24-7.20 (m, 3H), 7.16-7.12 (m, 1H), 6.91 (s, 0.3H), 6.85-6.82 (m, 1H), 6.75 (bs, 0.3H), 6.67 (s, 0.3H), 5.42-5.37 (m, 0.3H), 5.26 (s, 2H), 5.10 (bs, 0.2H), 5.01 (bs, 0.3H), 4.43 {ά. .ί 17.1 Hz, 0.5H), 4.32 (d, ./ 15.3 Hz, 0.6H), 4.24-4.19 (m, 0.5H), 4,00 (d, ./ 12.1 Hz, II I). 3.91 (s, 1 H), 3.85 (s, 0.4H), 3 ,78-3 , 74 (m, 0.6H), 3.68-3.64 (m, 0.4H), 3 ,50 (bs, 0.6H), 3.38 (s, 0.3H ), 3.21 ( bd. ./ 16.5 Hz, 0.5H), 3 , 10 (dd. J 16.8, 5.9 Hz, 0.4), 2.99 id. ./ 17.3 Hz, 0.6H), 2.77 (h l. J 15.0 Hz, 0.2), 0.92 (s, 2H), 0.87 (d. ./ 7.6 Hz, 3H), 0.81-0.76 (m, 4H), 0.04 (dd, J = 22,9, 12,2 Hz, 3H), -0.1 1- -0, 18 (m, 2H).
[00404] LC/MS: retention time 4.47 rain. (ESI) CiiHjgNiOeSi: [M+H] ^ 563; found 563. |0040S] 3.4 (S)-(3-(((Tert-butyldimethylsilyl)oxy)methyl)-3,4-dihydroisoquinolin- 2(lH)-yl)(4-hydroxy-5-methoxy-2-nitrophenyl)methanone (12).
[00406] To a solution of (5)-(4-(benzyloxy)-5-methoxy-2-nitrophenyl)(3-(((tert- butyldimethylsilyl)oxy)methyl)-3,4-dihydroisoquinolin-2( lH)-yi)methanone (11) (14.0 g, 24.9 mmol) in EtOAc (500 mL), vacuum purged with Ar (3x), added Pd(OH)2/C (710 mg). The reaction mixture was then vacuum, purged with Ar (3X), followed by Hi (3x). Tlie mixture was stirred at 22 °C under Hi for 2.5 hr, with vigorous agitation. The mixture was then vacuum purged with Ar, and the mixture filtered through C elite . washed with EtOAc and the filtrate was concentrated. The residue was purified via column chromatography (10→100% EtOAc in hexane) to afford 12 ( 1 1.3 g, 97% yield) as a yellow foam, containing -6% overreduction (aniline) impurity.
[00407] ¾ NMR (500 MHz; CDCb)(contains rotamers and aniline impurity): δ 7.86-7,81 (m, 1H), 7.24-7.21 (m, 2H), 7.17-7.1 1 (m, 0.7H), 6.93-6.89 (m, 0.2H), 6.86-6.85 (m, 0.7H), 6.82 (dt, J ------ 1.8, 0.8 Hz, 0,21 1). 6,69 (t, ./ 0.9 Hz, 0.21 1 ). 5.90 (s, i l l ). 5.43 (bs, 0.4H), 5.09
(s, 0.3H), 5.05-5.00 (m, 0.3H), 4.42. (dd, J = 17.1, 0.7 Hz, 0.5H), 4.32 (t, J= 13 ,2. Hz, 0.5H), 4.25-4.2 ! (m, 0.6H), 4.05 (dd, ,7 = 2.1, 1.5 Hz, 0.8H), 4.02 (s, 1 .7H), 3.95 (d, J = 0.5 Hz, 1H), 3.90-3.83 (m, 0.8H), 3.77-3.66 (rn, 1H), 3.55-3.48 (m, 0.4H), 3.41-3.38 (rn, 0.1H), 3.22 (d, J = 16.1 Hz, 0.5H), 3.13-2.99 (m, 0.8H), 0.92 (s, 2H), 0.87 id. ./ 7.0 Hz, 4H), 0.81 (s, 4H), 0,07-0,03 (m, 41 1). -0.10 (s, 3H).
[00408] LC/MS: retention time 4.42 mm. (ESI) C · ι! ί < <N 'O.-.Sr [M+H] * 473; found 473 , [00409] 3.5 Ethyl (.S)-4-(4-(3-(((tert-butyldimethylsilyl)oxy)methyl)-l ,2,3,4- tetrahydroisoquinoline-2-carbonyl)-2-methoxy-5-nitrophenoxy)butanoate (13).
[00410] To a solution of (5)-(3-(((tert-butyldimethylsilyl)ox methyl)-3,4- dihydroisoquinolin-2(lH)-yl)(4-hydroxy-5-methoxy-2-nitrophenyl)methanone (12) (2,57 g, 5.44 mmol) and CsiCCb (5.32 g, 16.3 mmol) in DMF (27 mL) added ethyl 4-bromobutanoate (2.34 mL 16.3 mmol). The reaction mixture was stirred at 22 °C for 2.5 hr, then quenched with Η2Ο ( 100 mL) and extracted with EtOAc (3 x 100 rnL). The combined organics were washed with Η2Ο (3 x 50 mL), dried over MgS04, filtered, and concentrated. The residue was purified via column chromatography (0→50% EtOAc in hexane) to afford 13 (2.68 g, 84% yield).
[00411] Ή NMR (500 MHz; CDCb)(contains retainers): δ 7.79-7.74 (m, 1H), 7.25-7.20 (m, 2H), 7.14 (did. ./ 4.5, 1.9, 0.9 Hz, 0.5! i). 6.89-6.84 (m, 0.6H), 6.80 (d, ./ 0.9 Hz, 0.1H), 6.66 (s, 0.2H), 5 ,42-5 ,39 (m, 0.3H), 5.10 (bs, 0.2H), 5.01 (bs, 0.3H), 4.44-4.40 (m, 0.5H), 4.34-4.29 (m, 0.6H), 4.22-4.1 8 (m, 5H), 3.99-3.96 (m, 2H), 3.89 (s, III), 3 ,78-3 ,74 (m, 0.5H), 3.66 (bs, 0.2H), 3.51-3.48 (m, 0.4H), 3.38 (bs, 0.2H), 3.22 (dd, J = 17.0, 1.8 Hz, 0.5H ), 3.13-3.09 (m, 0.3H), 3.01-2.98 (m, 0.6H), 2,79 (bt, J= 2.1 Hz, 0.2H), 2.60-2.57 (m, 2H), 2,26-2,23 (m, 2H), 1 .29 (dd, J = 14.3, 9.9 Hz, 3H), 0.92 (s, 2H), 0.86 (s, 3H), 0,81-0.78 (m, 4H), 0.05 (t, J ------- 8.5 Hz, 3H), -0.1 1(bs, 2H).
[00412] I . (VMS: retention time 4.24 min. (ESI) C =,..! ! p S OaSi : [M+H] ÷ 587; found 587.
[00413] 3.6 Ethyl (S)-4-(5-amino-4-(3-(((tert-butyldimethylsilyl)oxy)methyl)-l,2,3,4- tetrahydroisoquinoline-2-carbonyl)-2-methoxyphenoxy)butanoate (14).
[00414] To a solution of ethyl (5)-4-(4-(3-(((tert-butyldimethylsilyl)oxy)methyl)-l,2,3,4- tetraliydroisoquino3ine-2-carbonyl)-2-methoxy-5-nitrophenoxy)butanoate (13) (2.68 g, 4.57 mmol) in THF (91 mL) and H2O (9.1 mL) added NHiCl (4.89 g, 91.4 mmol) and Zn dust (2.99 g, 45.7 mmol). The resulting mixture was stirred at 22 °C for 2.5 hr, then filtered through Celite®, washed with EtOAc and the filtrate was concentrated. The residue was purified via column chromatography (0-→75% EtOAc in hexane) to afford 14 (2.14 g, 84% yield).
[00415] ¾ NMR(500 MHz; CDCb): δ 7.21-7.16 (m, 4H), 7.09-7.07 (m, 1H), 6,79 (s, 1H), 6.33 (s, 1H), 4,49 (bs, IH), 4.18 (q, J = 7.1 Hz, 2H), 4.07 (t, J = 6,3 Hz, 2H), 3.79 (s, 3H), 3.68 (bs, 2H), 3.18 (dd, ./ 16.2, 5.9 Hz, IH), 2.86-2.82 (rn, 1H), 2.56 (t, J = 7.3 Hz, 2H), 2.21-2.16 (m, 2H), 1.57 (bs, 3H) 1.29 i t. ./ 7.1 Hz, 3H), 0.87 (s, 9H), 0.01 (s, 6H). [00416] LC/MS: retention time 3.94 min. (ESI) C offcNiOeSi: [M+H] + 557; found 557.
[00417] 3.7 Ethyl 4-(S-((((4-((A 2-((5)-2-(((allyloxy)carbonyl)amino)-3- methylbutanamido)-propanamido)-benzyl)-oxy)-carbonyl)-amino)-4-((S)-3-(((tert- butyldimethylsilyl)oxy)methyl)-l,2,3,4-tetrahydroisoquinoline-2-carbonyl)-2- methoxyphenoxy)butanoate (15).
[00418] To a solution of ethyl (S)-4-(5-amino-4-(3-(((tBrt-butyldimethylsilyl)oxy)methyl)- l,2,3,4-tetrahydroisoquinoline-2-carbonyl)-2-methoxyphenoxy)butanoate (14) (545 mg, 0.978 mmol) in THF (1 .5 mL) added a solution of ally] ({S)~3 -methyl- 1-oxo-I -(((<S)- 1 -oxo-l - ((4-((((perfluorophenoxy)carbonyl)-oxy)-methyl)-phenyl)-amino)-propan-2-yl)-amino)- butan-2-yl)carbamate (4) (442 mg, 0.752 mmol) in THF (0.5 mL). The reaction vessel was purged with Ar, sealed, and the reaction mixture was stirred at 22 °C for 4 days. The mixture was then concentrated, and the residue was purified via re verse phase chromatography (0→T00 % ACN in H2O, each containing 0.05% AcOH). The desired fractions were lyophilized and impure product was purified via column chromatography (0→100% EtOAc in hexane) to afford 15 (520 mg, 72% yield).
[00419] 1H NMR(500 MHz; CDCb, 50°C): δ 8 ,25-8,23 (m, II I). 7.81 (bs, 1H), 7.51 (d, J = 8.0 Hz, 2H), 7.31 (d, J= 8.3 Hz, 2H), 7.19-7.18 (m, 2H), 7.14 (ddd, J = 4.4, 2.2, 1.0 Hz, i l l ). 7.07-7.04 (m, IH), 6.82 (s, 1H), 6.29 id. ./ 7.8 Hz, 1H), 5.94-5.88 (m, IH), 5.31 id. ./ 17.7 Hz, IH), 5.22 (d, ./ 10.5 Hz, IH), 5.14-5.04 (m, 3H), 4.62 (dt, ./ 16.7, 7.6 Hz, 3H), 4.38 (d, J= 16.9 Hz, IH), 4.16 (q, J = 7.1 Hz, 2H), 4.1 1 (t, J = 6.0 Hz, 2H), 3.98 (t, J = 6.5 Hz, IH), 3.81 (s, 3H), 3 ,65 (bs, 2H), 3.1 1 (dd, J = 16.1, 6.4 Hz, I H), 2.82 (bd, J = 15.1 Hz, IH), 2.53 ( i. J 7.5 Hz, 2H), 2.18 idq. ./ 13.0, 6.2 Hz, 3H), 1.27 (L ./ 7.1 Hz, 3H), 0.97 (dd, ·/ 18.8, 6.8 Hz, 6H), 0.82 (s, 9H), -0.03 {0. .J 4.7 Hz, 6H).
[00420] LC MS: retention time 4.27 min. (ESI) CsoifeNsOuSiNa: [M+Na] + 982; found 982.
[00421] 3.8 Ethyl 4-(5-((((4-((S)-2-((S)-2-(((allyloxy)carbonyl)amino)-3- methylbutanamido)-propanamido)-benzyl)-oxy)-carbonyl)-amino)-4-((S)-3- (hydroxymethyl)-l ,2,3,4-tetrahydroisoquinoline-2-carbonyl)-2- methoxyphenoxy)butanoate (16),
[00422] To a solution of ethyl 4-(5-((((4-((5)-2-((5)-2-(((allyloxy)carbonyl)amino)-3- methylbut^amido)-propanamido)-benz>d)-oxy)-carbonyl)-ainino)-4-((5)-3-(((tert- butyldimemylsily])oxy)methyl)-l,2,3,4-tetrahydroisoquinolme-2-carbonyl)-2- methoxyphenoxy)butanoate (15) (457 mg, 0.476 mmol), under Ar, in anhydrous THF (4.2 mL), added AcOH (55 μΕ, 0.952 mmol) then TBAF (0.83 mL of a 1.0 M solution in THF, 0.83 mmol) and the reaction was stirred at 22 °C for 22 hr. The reaction mixture was diluted with EtOAc ( 10 ml.) and the organics were washed with H2O, NaHCCh (sat), and brine (each, 1 x 5 mL), then dried over MgS04, filtered and concentrated. The residue was purified via column chromatography (20→100% EtOAc in hexane) to afford 16 (385 mg, 96% yield).
[00423] Tl MR iSOO MHz; CDCb): δ 8.42 (bs, 1H), 8.05 (bs, 1H), 7.67 (bs, 1H), 7.51 (d, ./ 7.6 Hz, 21 1 ). 7.29 (d, J= 8.0 Hz, 2H), 7.19 (i. ./ 3.2 Hz, 2H), 7.14 (bs, lH), 7.04 (bs, 1H), 6.76 (s, 1H), 6.46 (bs, 1H), 5.90 (bs, 1H), 5.31 id. ./ 17.5 Hz, 1H), 5.23 (d. ./ 10.7 Hz, 2H), 5.08 (s, 2H), 4 ,65-4,56 (m, 3H), 4.36 (d. ./ 16.4 Hz, 1H), 4. 15 (q . ./ 7.1 Hz, 2H), 4.10 (s, 2H), 3.99 (t, J= 6.3 Hz, 1H), 3 ,79 (s, 3H), 3.63 (t, J= 8.8 Hz, 1H), 3.17-3.12 (m, I I I ). 2.72 (bs, 1H), 2.53 (t, ./ 7.4 Hz, 2H), 2, 17 U. ./ 6.3 Hz, 3H), 1.45 (d,■/ 6.9 Hz, 3H), 1.27 (t, J ----- 7.1 Hz, 3H), 0.95 (dd, J ------ 22.0, 6.8 Hz, 6H).
[00424] LC/MS: retention time 3.05 min. (ESI) iH.v.VO:.- : [M+H] + 846; found 846.
[00425] 3.10 4-((iy)-2-((iST)-2-(((aSl Soxy)carbo5i S)amino)-3- niethy!butananiido)propanamido)benzyI (6aS)-3-(4-ethoxy-4-oxobutoxy)-6-hydroxy-2- methoxy-14-oxo-6,6a,7,12-tetrahydrobenzo[5,6J [l,4]diazepino[l,2-6]isoquinoline- 5(14H)-carboxylate (17).
[00426] To a solution of ethyl 4-(5-((((4-((^>2-((¾-2-(((allyloxy)carbonyl)animo)-3- methylbutanamido)-propanamido)-benzy^
l,2,3,4-tetrahydroisoquino.line-2-carbonyl.)-2-methoxyphenoxy)butanoate (16) (253 mg, 0,299 mmol) in DCM (3.0 mL), under Ar, added Dess-Martin periodinane ( 190 mg, 0.449 mmol). The resulting mixture was stirred at 22 °C for 3 hr, then quenched with 3 rnL of 0.5 M Na2S2i¾, diluting with DCM (5 mL), The mixture was stiired for 5 min, then added 3 mL of aqueous NaHCC (sat) and stirred for an additional 5 min before extracting w ith DCM (3 x 5 mL). The combined organics were dried over MgS04, filtered and concentrated. The residue was purified via column chromatography (0→10% MeOH in DCM) to afford 17 (222 mg, 88% yield).
[00427] ¾ NMR(500 MHz; CDCb): δ 8.48 (bs, 1H), 7.55-7.53 (m, 2H), 7.28 (s, 3H), 7.19-7.18 (m, 3H), 6.82-6.79 (m, 1H), 6.32 (bs, 1H), 5.90 (bs, 1H), 5.41 id. ./ 10.9 Hz, 1H), 5.33-5.19 (m, 4H), 4,83 (d, ./ = 15.7 Hz, i l l ). 4.69-4.59 (m, 3H), 4.55 (d, ./ 15.9 Hz, 2H), 4.15 (q, J ----- 7.1 Hz, 11 1 ). 4.02 (dd, ./ 6.6, 5.9 Hz, 1H), 3.87 (s, 3H), 3.73-3.70 (m, 2H), 3.32 (bs, 1 H), 3.16 (dd, ,/ = 15.1, 2.6 Hz, ! H), 3.07 (dd, J= 15.0, 5.4 Hz, 1H), 2.44-2.38 (m, 2H), 2.24-2.20 (m, 1H), 1.97 (bs, 2H), 1.46 (d, ./ 6.8 Hz, 3H), 1.27 (i. J 7.1 Hz, 3H), 0.98 (dd, J = 27.7, 6.8 Hz, 6H).
[00428] I .(VMS: retention time 2.97 mm. (ESI) C i iH« iVO: > : [M+H] + 844; found 844.
[00429] 3.11 4-(((6aA>S-(((4-((^)-2-((5)-2-(((allyloxy)carbonyl)amino)-3- methylbutanamido)-propanamido)-benzyl)-oxy)-carbonyl)-6-hydroxy-2-methoxy-14- oxo-5,6,6a,7,12,14-hexahydrobenzo[5,6] [l,4]diazepino[l,2-b]isoquinolin-3- yI)oxy)butanoic acid (18).
[00430] To a solution of 4-((.¾-2-((5)-2-(((allyloxy)carbonyl)amino)-3- methylbutanamido)propanamido)benzyl (6aS)-3-(4-ethoxy-4-oxobutoxy)6-h}'droxy-2- methoxy- 14~oxo-6,6a,7, 12-tetrahydrobenzo[5,6] [ l,4]diazepino[l ,2-6]isoquinoline-5( 14H)- carboxylate (17) (222 mg, 0.263mmol) in 3 : 1 : 1 THF/MeOH/ftO (2.2 mL) added LiOH (3 1.6 mg, 1.32 mmol). The resulting mixture was stirred at 22 °C for 1 hr, then quenched with 5% citric acid(aq) (5 mL) and extracted with 2-MeTHF (3 x 5 mL). Combined organics were concentrated and purified via column chromatography (0→10% Me OH, containing 0.1% HO Ac, in DCM) to afford 18 (162 mg, 76% yield),
[00431 ] 1H NMR (500 MHz; CDsOD): δ 7.49 (d, J= 8.2 Hz, 2H), 7,26 (d, J= 7. 1 Hz, 4H), 7.15-7.10 (in. 2H), 6.99-6.75 (rn, 1H), 6.63 (s, i l l). 5.90 (ddt, J= 16.7, 10.9, 5.5 Hz, 1H), 5.29-5.25 (m, 2H), 5.14 (d. ./ 10.4 Hz, 2H), 4.77-4.72 (m, 2H), 4.52-4.45 (m, 4H), 4.03 (s, 1H), 3.92, (d, J= 5 ,8 Hz, 2H), 3 ,84 (s, 3H), 3 ,74 (bs, 1H), 3 ,60 (bs, 1H), 3 ,09 (d, J = 3.2 Hz, 2H), 2,48-2.38 (m, 2H), 2.00 (bd, ,/ = 42.2 Hz, 3H), 1 .40 (d, J= 4,9 Hz, 3H), 0,94 (dd, J = 17.7, 6.2 Hz, 6H).
[00432] LC./MS: retention time 2.67 mm. (ESI) C42HS0N5O12: [M+H] + 816; found 816.
[00433] 3.12 4-((-S)-2-((5)-2-(((allylozy)carbonyl)aniino)-3- methylbutanamido)propananiido)benzyI (6aS)-3-(4-((S)-5-
((bis(allyloxy)phosphoryl)oxy)-l-(chloromethyl)-l,2-dihydro-3H-benzo[e]indol-3-yl)-4- oxobutoxy)-6-hydroxy-2-methoxy-14-oxo-6,6a,7,12- tetrahydrobenzo[5,6] [l,4] diazepino[l,2-b]isoquinoline-5(14H)-carboxylate (19a).
[00434] Crude 7a (0.05 mmol), 18 (0.02 mmol) and DIEA (0.035 rnL, 0.1 mmol) were dissolved in anhydrous DMF (0.2 mL). HATU (30 mg, 0.08 mmol) was added and the mixture was stirred overnight. The reaction mixture was not worked up and used as s in the next step. [00435] 3.13 4-((iST)-2-{(iy)-2~am!5io~3-met ySbiitanamido)propanam!do)benzyI (6a5)-3-
(4-((S)-l-(chloromethyl)-5-(phosphonooxy)-l,2-dihydro-3H-benzo[e]indol-3-yl)-4- oxobutoxy)-6-hydroxy-2-methoxy-14-oxo-6,6a,7,12- tetrahydrobenzo[5,6] [l,4] diazepino l,2-b]isoqin5ioliBe~S(14H)"Carboxykte (20a).
[00436] Reaction mixture of 19a was diluted with DMF (1 mL) and pyrrolidine (0.008 mL, 0.1 mmol) was added followed by palladium tetrakis triphenylphosphine (5.6 mg, 0.005 m mol ) After 30 minutes reaction mixture was purified on EZ Prep (Gemini 30 x 150 mm column) (5→95% ACN in H20, each containing 0.05% TFA) to afford 20a (20.5 mg, 99% yield), contains unknown impurities. Used as is in the next step.
[00437] LC/MS: retention time 2.56 mm. (ESI) CsiHsTCiNeOisP: [M+H] + 1027; found 1027.
[00438] 3.14 4-((2S,5S)-37-(2,5-dioxo-2,5-dihydro-l H-pyrrol-l-yl)-5-isopropyl-2- methyl-4,7,35-trioxo-10,13,16,19,22,25,28,31-octaoxa-3,6,34- triazaheptatriacootaoamido)beozy! (6aR)-3-(4-((S)-l-(chloromethyl)-5-(phosphonooxy)- l,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-6-hydroxy-2-methoxy- 1.3-oxo- 6,6a,7,12,12a,13-hexahydro-5H-benzo[b]naphtho[2,3-e] azepine-5-carboxylate
(21a D826).
[00439] Crude 20a (20,5 mg, 0.02 mmol) was dissolved DMF (0.4 mL) and DIEA (0.01 mL, 0.06 mmol) was added followed by MAL-dPEG®8-NHS ester (20.7 mg, 0.03 mmol). After 2 hr, the reaction mixture was directly loaded and purified on EZ Prep (Gemini 30 x 150 mm column) (5→95% ACN in H2O, each containing 0.05% TFA) to afford 21a (3.9 mg, 12% yield),
[00440] LC/MS: retention time 2.42 mm. (ESI)
Figure imgf000083_0001
[M+Na] + 1624; found 1624.
[00441] 3.15 -((-S)-2-((5)-2-(((allylozy)carbonyl)aniino)-3- methylbutanamido)propanamido)benzyl (6aS)-3-(4-((S)-l -(chloromethyl)-5- ((methoxycarbonyl)oxy)-l,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-6-hydroxy-2- methoxy-14-oxo-6,6a,7,12-tetrahydrobenzo[5,6J [l,4]diazepino[l,2-b]isoquinoline- 5(14H)-carboxylate (19b).
[00442] Crude 7b (0.04 mmol), 18 (0.03 mmol) and DIEA (0.027 mL, 0.16 mmol) were dissolved in anhydrous DMF (0.2 mL). HATU (60 mg, 0.16 mmol) was added and the mixture was stirred overnight. The reaction mixture was directly loaded and purified via reverse phase chromatography (0--> 100 % ACN in H2O, each containing 0,05% HO Ac) to afford 19b (16.4 mg, 48% yield).
[00443] I .('MS: retention time 3.38 min. (ESI) CH Lv i l Ni-O: sNa: [M+Na] + 11 1 1 ; found 1 1 1 1.
[00444] 3.16 4~(( )-2-((iST)-2-aniino-3-niethy!butananiido)propanamido)benzyI (6aS)-3-
(4-((»S)-l-(chloromethyl)-5-((methoxycarbonyl)oxy)-l,2-dihydro-3H-benzo[e]indol-3-yl)-
4-oxobutoxy)-6-hydroxy-2-methoxy-14-oxo-6,6a,7,12- tetrahydrobenzo[5,6] [l,4] diazepino[l,2-b]isoquinoline-5(14H)-carboxj'late (20b).
[00445] To a solution of 19b in DCM (2 mL), under Ar, Bu3SnH (0.005 mL, 0.02 mmol) was added followed by palladium tetrakis triphenylphosphine (8 mg, 0.007 mmol). After 30 minutes reaction mixture was concentrated, dissolved in DMSO (1 mL) and purified via reverse phase chromatography (0— > 1Q0% ACN in H2O, each containing 0.05% HO Ac) to afford 20b (7.7 mg, 52% yield).
[00446] LC/MS: retention time 2.53 min. (ESI) C -i ,.OVO: ,> [M+H] + 1005; found 1005.
[00447] 3.17 4-((2S,5S)-37-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)-5-isopropyl-2- methyl-4,7,35-trioxo-10,13,16,19,22,25,28,31-octaoxa-3,6,34- triazaheptatriacontanamido)benzyl (6aS)-6-hydroxy-3-(4-((S)-5-hydroxy-l-
(hydroxymethyl)-l,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-2-methoxy-14-oxo-
6,6a,7,12-tetrahydrobenzo[5,6] [l,4] diazepino[l,2-b]isoquinoline-5(14H)-carboxylate
(21b D824).
[00448] To a solution of 20b (7.2 mg, 0,007 mmol) in DMF (0.1 mL) added DIEA (0.003 mL, 0.02 mmol) then MAL-dPEG®8-NHS ester (9.9 mg, 0.014 mmol). After 3 hr, the reaction mixture was directly loaded and purified via reverse phase chromatography
(0→100% ACN in H2O, each containing 0.05% HOAc) to afford 21b ( 1.6 mg, 14% yield), with an additional less pure fraction of 21b (containing 1 % 20b) (2.3 mg, 20% yield).
[00449] LC/M S : retention time 3.05 rain . (ESI) ('-·:·ί !^C!X^ :X;i: [M+Na j + 1601 ; found 1601.
[00450] 3.18 4-((5)-2-((-S)-2-(((allyloxy)carbonyl)amino)-3- methylbutanamido)propanamido)benzyl (6a5)-3-(4-((S)-l-(chloromethyI)-5-((4- methylpiperazine-l-carbonyl)oxy)-l,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-6- hydroxy-2-methoxy-14-oxo-6,6a,7,12-tetrahydrobenzo[5,6] [l ,4] diazepino l,2~
b]isoquinoline-5(14H)-carboxylate (19c).
[00451] Crude 7e (0.04 mmol), 18 (0.03 mmol) and DIEA (0.028 mL, 0.16 mmol) were dissolved in anhydrous DMF (0,2 mL). HATU (61 mg, 0. 16 mmol) was added and the mixture was stirred overnight. The reaction mixture was directly loaded and purified via reverse phase chromatography (0→100% ACN in Hj.0, each containing 0.05% HO Ac) to afford 19c (16.0 mg, 40% yield), contaminated with acid 18.
[00452] I .( /MS: retention time 2.63 min. (ESI) I KC!NxO : [M+H] 1 157; found 1 157.
[00453] 3.19 4-((S)-2-((/¥)-2-amino-3-methylbutanamido)propanamido)benzyl (6aS)-3- (4-((S)-l-(chloromethyl)-5-((4-methylpiperazine-l-carbonyl)oxy)-l,2-dihydro-3H- benzo[e]indol-3-yl)-4-oxobutoxy)-6-hydroxy-2-methoxy-14-oxo-6,6a,7,12- tetrahydrobenzo[5,6] [l,4] diazepino[l,2-b]isoquinoline-5(14H)-carboxylate (20c).
[00454] To a solution of impure 19c ( 16 mg, 0.15 mmol) in Dioxane/THF/ bO (0.4 mL), added successively EtjN (0.014 mL, 0.096 mmol), formic acid (0.014 mL, 0.36 mmol), PPb.3 (1 .3 mg, 0.0048 rnmo) and palladium tetrakis triphenylphosphine (1.3 mg, 0.001 mmol). After 16 hr, added additional palladium tetrakis triphenylphosphine (2 mg, 0.002 mmol) and stirred an additional 3 hr. The reaction mixture was concentrated, dissolved in DMSO (1 mL) and purified EZ Prep (Gemini 30 x 150 mm column) (5— ->95% ACN in H2O, each containing 0.05% HOAc) to afford 20c (16 mg) containing unknown amount of impurity.
[00455] LC/MS: retention time 2.16 min. (ESI) CsTHesClNgOi iNa: [M+Na] 1095; found 1095.
[00456] 3.20 4-((2S,5S)-37-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)-5-isopropyl-2- methyl-4,7,35-trioxo-10,13,16,19,22,25,28,31-octaoxa-3,6,34- triazaheptatriacontanamido)benzyl (6aS)-3-(4-((»S)-l-(chloromethyl)-5-((4- methylpiperazine-l-carbonyl)oxy)-l ,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-6- hydroxy-2-methoxy-14-oxo-6,6a,7,12-tetrahydrobenzo[5,6] [l,4] diazepino[l ,2- b]isoquinoline-5(14H)-carboxylate (21c/D828).
[00457] Crude 20c (16 mg, 0.015 mmol) was dissolved DMF (0.2 mL) and pyridine (0.003 mL, 0.04 mmol) was added followed by a solution of MAL-dPEG®8-NHS ester (20.5 mg, 0.03 mmol) in DMF (0.05 mL). After 45 min, the reaction was stored in freezer for 18 hr, then directly loaded and purified on EZ Prep (Gemini 30 x 150 mm column) (30→60 % ACN in H2O, each containing 0.05% HOAc) to afford 21c (4.8 mg, 20% yield).
[00458] I .('MS: retention time 2.41 min. (ESI) Ce-HioeClNioOa: [M+H] + 1647: found
1647.
[00459] 3.21 4~(( )-2-((iST)-2-aniino-3-niethy!butanainido)propanainido)benzyI (6aS)-3- (4-((S)-l-(chloromethyl)-5-hydroxy-l,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-6- hydroxy-2-methoxy-14-oxo-6,6a,7,12-tetrahydrobenzo[5,6] [l,4]diazepino[l,2- b]isoquinoline-5(14H)-carboxylate (20d).
[00460] To a solution of 19b (10.3 mg, 0.0095mmol) in DCM (0.5 mL), under Ar, pyrrolidine (0.001 mL, 0.014 mmol) was added followed by palladium tetrakis
triphenylphosphine (0.6 mg, 0.0005 mmol). After 30 minutes, the reaction mixture was concentrated, dissolved in DMSO (0.5 mL) and purified via reverse phase chromatography (0→100% ACN in Η2Ο, each containing 0.05% HOAc). Desired fractions were iyophilized to afford 20d (5 ,8 mg, 65% yield).
[00461] I .( /MS: retention time 2.59 min. (ESI) CsiHseClNeOio: [M+H] + 947; found 947.
[00462] 3.22 4-((2S,5S)-37-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)-5-isopropyl-2- methyl-4,7,35-trioxo-10,13,16,19,22,25,28,31-octaoxa-3,6,34- triazaheptatriacontanamido)benzyl (6aS)-6-hydroxy-3-(4-((S)-5-hydroxy-l-
(hydroxymethyl)-l,2-dihydro-3H-benzo[e]indol-3-yl)-4-oxobutoxy)-2-methoxy-14-oxo-
6,6a,7,12-tetrahydrobenzo[5,6] [l,4]diazepino[l,2-b]isoquinoline-5(14H)-carboxylate
(21d D822).
[00463] To a solution of 20d (5.4 mg, 0,006 mmol) in DMF (0.1 mL) added pyridine (0.0012 mL, 0.014 mmol) then MAL-dPEG®8-NHS ester (7.9 mg, 0.01 1 mmol). After 3 hr, the reaction mixture was directly loaded and purified via reverse phase chromatography (0→100% ACN in H2O, each containing 0.05% HOAc) to afford 21d (0.5 mg, 6% yield, 93%J pure @. 254 nm), with an additional less pure fraction of 21d (1.6 mg, 18% yield, 89% pure @ 254 nm).
[00464] I. (VMS: retention time 2.99 min. (ESI) ( ί k-(T\x0.v\a: [M+Na] 1543: found 1543.
[00465] Example 5 - Preparation of 3G7-(IQB-CBI) (Antibody-drug conjugate). Chi3G7/hu3G?-S256C
Figure imgf000087_0001
[00466] Chimeric and humanized, cys-substituted (S156C), anti-ILlRAP antibody
("Chi3G7/hu3G7-IQB-CBI") (5.0 mg, 1.68 mg/mL, PBS) was exchanged into borate buffer (50 mM, pH 8.5, ImM diethylene triamine pentaacetic acid (DTP A)) via 2 cycles of molecular weight cut-off filtration (MWCO) using a Millipore, 15 mL, 30 kDa de vice. To the new solution of the 3G7-S156C-CYSMAB antibody (5.0 mg/mL, borate buffer (50 mM, pH 8,5, ImM DTPA)) was added a solution of Dithiothreitol (DTT) (33 μΐ,, 50,0 equiv., 50 mM) and the resultant solution was shaken gently overnight. Antibody 3G7 has amino acid sequences as described herein.
[00467] Complete reduction of the interchain disulfide bridges and removal of the S156C cysteine/glutathione adducts was confirmed by rp-LCMS as described earlier (Junutula et al., 2008, Nature Biotech, 26, 925-932). DTT was then removed from the solution via 3 cycles of molecular weight cut-off filtration (MWCO) using a Millipore, 15mL, 30 kDa device, using PBS as the exchange buffer. To a 5 mg/ml solution of the fully reduced 3G7-S156C - CYSMAB antibody was added a solution of dehydro ascorbic acid (dhAA) (33 μί,, 50.0 equiv., 50 mM). The resultant soiution was shaken gently for 3 hrs. The re-oxidation was monitored via rp-LCMS. Once the re-oxidation was deemed complete, the reaction mixture was diluted up to 50% v/v with propylene glycol and IQB-CBI was added as a solution in DMSO (10.0 equiv., 10 mM in DMSO). The reaction was allowed to stir at ambient temperature for 1 hr. The mixture was then treated with activated charcoal for 1 hr at ambient temperature. The activated charcoal was then removed via filtration. The conjugate was then exchanged into PBS via multiple cycles of molecular weight cut-off filtration (MWCO) using Millipore, 15mL, 30 kDa devices. The solution was then subjected to a sterile filtration to yield the desired conjugate (0.974 mL, 2.16 mg/mL). Volume: 0.974 mL. Concentration: 2.16 mg/mL (A280 =: 0.145, 20-fold dilution). Drug to Antibody Ratio (DAR) is in the range of 1.7-2.0 (determined by rp-LCMS). The monomelic form of ADC is confirmed by size exclusion chromatography (SEC): 96%. Characterization data is provided in Table II, below.
Table II.
Figure imgf000088_0001
[00468] Example 6 - Binding of 3G7-(IQB-CBI ADCs to Cells: D8 6, D818, D820, D822, D826, D824, D828
[00469] Figures 15 and 16 show binding, as a function of mean fluorescent intensity, of humanized (hu3G7) or chimeric (Chi3G7) anti-ILlRAP antibody to various cell Sines. HL- 60 cells (human promyelocytic leukemia cells), EOLl cells (human eosinophilic leukemia cells) and SK-MEL-5 cells (human melanoma cell line) express IL1RAP, and EOL l cells do so with high expression. CO antibody is a non-binding control IgGl . D212 is a composition having the formula:
Figure imgf000088_0002
[00470] The cells were resuspended in binding buffer (PBS, 2% FBS)) containing 5% NHS (normal human s x 106 cells/mL. To 50 μL· of cells, 50 μL· of primary antibody /ADC was added and incubated at 4° for 30 min. After incubation, cells were wasked with binding buffer 2 times and then resuspended and incubated with second antibody (anti-human APC, 1 :400 in the binding buffer) at 4° for 30 min. Cells were washed with binding buffer and resuspended in 200 uL of binding buffer with propidium iodide. Cells were immediately applied to flow cytometry for analysis. Mean fluorescence intensity (MFI) of the stained sample was measured. [00471] Example 7 - Chi3G7-(IQB-CBI) ADC Selective Cytotoxicity: D816, D818, D820, D822, D826, D824, D828
[00472] The selectivity of ADCs comprising Chi3G7 anti-ILlRAP chimeric antibody (human constant domain, mouse variable domain) and various TQB-CBI dimer linker- pay loads (D816, D818, D820, D822, D826, D824, D828) is shown in FIGs. 17-23. HL-60 ceils, , EOL1 cells and SK-MEL-5 cells (human melanoma cell line) were treated with the ILIRAP -selective cytotoxic antibody-drag conjugate, Chi3G7-(IQB-CBI) ADC and the control antibody -drug conjugate, CO-(IQB-CBT) ADC or C0-D212 ADC, at varying concentrations at 37° C for five days.
[00473] FIG. 17 shows target dependent cell killing by Chi3G7-D816 ADC, hu3G7-D816 (humanized), compared with control C0-D212 and C6-D212 ADC.
[00474] FIG. 18 shows target dependent cell killing by Chi3G7-D818 ADC and hu3G7- D818 (humanized 3G7) compared with C0-D212 and C6-D212.
[00475] FIG. 1 shows target dependent cell killing by Chi3G7-D820 ADC compared with C0-D212 and Chi3G7~D212
[00476] Example 8 - Chi3G7-CLT-(IQB-CBl) ADC or Hu3G7-CLT-(IQB-CBl) ADC
Target Dependent Cytotoxicity
[00477] Cy otoxicity of Chi3G7-CLT-(IQB-CBI) or Hu3G7-CLT-(IQB-CBI) ADC and a non-binding control ADC were tested in cell lines expressing or not expressing ILIRAP. Results are shown in FIGs. 17-23. EOLlcells express high copy number of ILIRAP, whereas HL60 and SK-MEL-5 cells express low copy number of ILIRAP. FIGs. 17-23 show that Chi3G7-CLT-(IQB-CBI) or Hu3G7-CLT-(IQB-CBI) ADC displayed target dependent killing compared to a non-binding C0-D212 or CO-CLT-(IQB-CBI) control ADC. .
[00478] All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
[00479] While certain embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.

Claims

Figure imgf000091_0001
wherem:
* the dotted bond shown between -C(Ra)- and -N(Rb)- is independently a single bond or a double bond;
o when a double bond is present between -C(Ra)- and -N(Rb)-, the -C(Ra)- is olefime and has a substituent Ra, and Rb of the -N(Rb)- is not present; o when a single bond is present between -C(R3)~ and -N(Rb)-, the -C(Ra)- is saturated and has a hydrogen substituent in addition to the Ra substituent and Rb of the -N(Rb)- is present;
* R3 is independently H, or OH;
* if present, Rb is H, -L-Rx or -L-Sc;
* -L-Rx is a linker L attached to a reactive moiety Rx, and -L-Sc is a linker L attached to a substance Sc; where L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N, O, S, or halogen, and optionally incorporates ether, oxo, carboxamidvl, urethanyi, heterocyclic, aromatic, or lieteroaromatic moieties; Rx is a reactive moiety; Sc is a target binding agent selected from a protein, a portion of a protein, a peptide or a nucleic acid;
* R2 is selected from H, OH, Ci-Cio alkyl, Ci-Cio alkenyl or C2-C10 alkyn i;
* R3, R , R4, R4', R6' and R6 are each independently selected from H, OH, Ci- C10 alkyl, C2-C10 alkenyl or C2-C10 alkynyl, or, if Y is N, is not present; * each of R5 or R5' is independently NH2, CO2H, H, OH, C1-C10 alkyl, C2-C10 alkenyl. C2-C10 alkynyl, -L-Rx or -L-Sc, or, if Y is N, is not present;
• R7 is H;
• G'-Rb' is OH, O-L, O-L-Rx, O-L-Sc, L, NH-L-Rx, or NH-L-Sc;
• each Y is, independently, N or C;
* each D is, independently, (CHijn where n = 0-4, provided that at least one D is (CH )n where n = 1-4;
• XI is a spacer selected from the group consisting of the following:
Figure imgf000092_0001
Figure imgf000092_0002
-
2, The compound according to claim 1, wherein the compound of Formula Ϊ has S,S sterochemistry.
3, The compound according to claim 1, wherein Rb is -L-Rx or -L-Sc.
4, The compound according to claim 1, wlierem G'-Rb' is O-L, O-L-Rx, O-L-Sc, NH-L, NH-L-Rx, or NH-L-Sc.
5, The compound according to claim 1, wherein
* R2, R3, R3 ', R4, R4', R5, R5', R6, and R6' are each H.
6, The compound according to claim 1, wherein the compound has any of the following chemical structures:
Figure imgf000094_0001
Linker
Figure imgf000094_0002
Figure imgf000095_0001
Cathepsin cleavabie AA-PEG
Figure imgf000095_0002
Figure imgf000096_0001
Figure imgf000096_0002
Figure imgf000096_0003
Figure imgf000096_0004
Figure imgf000096_0005
„94„
Figure imgf000097_0001
Figure imgf000098_0001
Figure imgf000098_0002
Figure imgf000098_0003
Figure imgf000099_0001
Figure imgf000099_0002
Figure imgf000099_0003
Figure imgf000100_0001
Figure imgf000100_0002
Figure imgf000100_0003
Figure imgf000100_0004
Figure imgf000100_0005
-98-
Figure imgf000101_0001
Figure imgf000101_0002
Figure imgf000101_0003
Figure imgf000101_0004
-99-
Figure imgf000102_0001
Figure imgf000102_0002
Figure imgf000102_0003
Figure imgf000102_0004
Figure imgf000103_0001
~101.
7. The compound according to claim 1, wherein the compound has the chemical structure of Formula IV:
Figure imgf000104_0001
8. The compound according to claim 7, wherein the compound has a chemical structure formula selected from:
Figure imgf000104_0002
D805
9. The compound according to claim 1, wherein the compound has a chemical structure of Formula V:
Figure imgf000105_0001
Formula V.
10. The compound according to claim 9, wherein the compound has a chemical structure formula selected from:
Figure imgf000105_0002
D811 D813
11. The compound according to claim 1, wherein the compound is selected from the
Figure imgf000105_0003
12. The compound according to claim 1, wherein L is a linker having the structure:
Figure imgf000105_0004
wherein:
YL is a spacer molecue that links an amino acid unit of XAA to the IQB unit; X AA IS an amino acid sequence having From I to 12 amino acids; and PEG is a polyeiiiylenegiyco! moiety having the structure:
-(CH2CH20)x- wherein x is 1-50.
13. The compound according to claim 12, wherein YL is a spacer molecule selected from the group consisting of |_ HN-CH2-CO-i
Figure imgf000106_0001
0j—NHCH2C(O)-NHCH2C(O)
14. The compound according to claim 13, wherein YL has the following structure:
Figure imgf000106_0002
15, The compound according to claim 12, wherein X a dipeptide, a tripeptide, a tetrapeptide, a peniapeptide, a liexapeptide, a heptapeptide, an octapeptide, a nonapeptide, a decapeptide, a undecapeptide, or a dodecapeptide sequence,
16, The compound according to claim 15, wherein X a dipeptide.
17, The compound according to claim 12, wherein each amino acid in the X unit is independently selected from the group consisting of arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, giutamine, cysteine, selenocysetein, glycine, proline, alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, try tophan, or citrulline (Ctt).
18, The compound according to claim 12, wherein X selected from the group consisting of Ala-Val, Val-Ala, and Val-Cit.
19, The compound according to claim 12, wherein PEG is a polyethyleneglycol moiety having a structure selected from the group consisting of -(CH2CH20)x- -HN-(CH2CH20)x-C(0)- or-HN-
Figure imgf000106_0003
wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15.
20, The compound according to claim 12, wherein PEG is a polyethyleneglycol moiety having a structure selected from the group consisting of --(CH2CH20),--, -H -(CH.2CH20)«-C(0)~ or-HN- (CH2CH20)x-CH2CH2-C(0)--, wherein x is 8.
21. The compound according to claim 1, wherein the compound is selected from tht following chemical structures:
Figure imgf000107_0001
i mm
Figure imgf000107_0002
Figure imgf000108_0001
19a-b
19a, R=H DS20b 19b, R=O e D820
Figure imgf000108_0002
The compound according to claim 1, wherein G'-R ' is selected from;
Figure imgf000109_0001
Figure imgf000109_0002
? R~H
1 b< R«O e
23. An antibody-drug conjugate having a structure of Formula Π:
Figure imgf000109_0003
wherem:
Figure imgf000110_0001
antibody or antibody fragment;
W-RM is a linking moiety formed by W and Rx, wherein W is a moiety attached a natural or unnatural amino acid residue of the antibody/antibody fragment and Rx is a succinimidyl, maleimidyl, cylooctynyl, aminooxy, bisulfonyi, sulfonyl, or isothiocyanate moiety, such that W-RM is a disulfide, a thioiated succinimidyl, an amino substituted succinimidyl, a (cyclooctyl)-l, 4 triazoiyl, oxime substituted N- glycan, oxime, a substituted bis-sulfopropyl, a sulfonamidyl, an amide, or a thiocarbamate moiety;
L is a Linker L, wherein the Linker L is a bond or is a moiety having 1-200 nonhydrogen atoms selected from C, N , O, S, or halogen, and optionally incorporates ether, oxo, carboxamidyl, urethanyl, amino acid, heterocyclic, aromatic or heteroaromatic moieties;
IQB-CBI is a compound having a structure of Formula I:
Figure imgf000110_0002
wherein:
• the dotted bond shown between -C(RA)- and -N(RB)- is independently a single bond or a double bond;
o when a double bond is present between -C(RA)- and -N(RB)-, the -C(RA)- is olefinic and has a substituent Ra, and Rb of the -N(RB)- is not present; o when a single bond is present between -C(R3)~ and -N(RB)-, the -C(Ra)~ is saturated and has a hydrogen substituent in addition to the RA substituent and Rb of the -N(Rb)- is present; ® Ra is independently H, or OH;
* if present, Rb is H or is a bond to the Linker L;
* R2 is selected from H, OH, Ci-Cio alkyl, Ci-Cio alkenyl or C2-C10 alkynvi;
* R3, R3', R4, R4', R6' and R6 are each independently selected from H, OH, Ci- C10 alkyl, C2-C10 alkenyl or C2~Cio alkvnyl, or, if Y is N, is not present;
* each of R5 or R5 is independently NH2 , CO2H, H, OH, C1-C10 alkyl, C2-C10 alkenyl, C2-C10 alkvnyl, is a bond to the Linker L, or, if Y is N, is not present;
* R is H;
* G'-Rb' is selected from OH, O-L, NH2, or NH-L, wherein L is the Linker L;
* each Y is, independently, N or C;
* each D is, independently, where n = 0-4, provided that at least one D is (CH2)n where n = 1-4;
* XI is a spacer selected from the group consisting of the following:
Figure imgf000111_0001
Figure imgf000111_0002
wherem at least one of Rb, R5, R5 and G-Rb is a bond linked to Linker L or comprises Linker L.
24. The antibody -drug conjugate of claim 23, wherein the antibody is a cysteine substituted antibody,
25. The antibody-drug conjugate of claim 23, wherein the antibody specifically binds a cancer marker.
26. The antibody-drag conjugate of claim 25, v, herein the cancer marker is GPR114, CLL-1 , TLI RAP, TIM-3, CD 19, CD20, CD22, ROR! , mesothelm, CD33, CD123/IL3Ra, c- Met, PSMA, prostatic acid phosphatase (PAP), CEA, CA-125, Muc-1, AFP, Glycolipid F77, EGFRvIll, GD-2, NY-ESO-1 TCR, tyrosinase, TRPI/gp75, gpl00/pmel-17, Melan- A/MART-1, Her2/neu, WTl, EphA3, telomerase, HPV E6, HPV E7, EBNAl, BAGE, GAGE and MAGE A3 TCRSLITRK6, ENPP3, Nectin-4, CD27, SLC44A4, CAIX, Cripto, CD30, MUC16, GPNMB, BCMA, Trop-2, Tissue Factor (TF), CanAg, EGFR, av-integrin, CD37, Folate Receptor, CD138, CEACAM5, CD56, CD70, CD74, GCC, 5T4, CD79b, Steapl, Napi2b, Lewis Y Antigen, LTV c-RET, DLL3, EFNA4 or Endosialin/CD248, Ly6e (RIG-e), CD79a, CD274 (PD-L1), CD38, DLL4, CD319 (SLAM7).
27. The antibody -drug conjugate of claim 26, wherein the cancer marker is TLIRAP or CLL-1.
28. The antibody-drug conjugate of claim 23, wherein the antibody or antibody fragment is anti-ILlRAP or anti-CLLl .
29. The antibody -drug conjugate of claim 23, wherein the IQB-CB1 compound has S,S stereochemistry.
30. The antibody-drag conjugate according to claim 23, wherein L is a linker having the structure:
Figure imgf000112_0001
wherein:
-no- YL is a spacer molecue that links an amino acid unit of XAA to the IQB unit;
XAA is an amino acid sequence having from 1 to 12 amino acids;
PEG is a poly ethylenegly col moiety having the structure
ίΠ Ί ΙΌΚ . wherem x is 1 -50.
31. The antibody-drag conjugate according to claim 30, wherein YL is a spacer molecule selected from the group consisting of
Figure imgf000113_0001
J — HN— CH2-CO— I j— NHCH2C(0)-NHCH2C(0)
32. The antibody-drug conjugate according to claim 31, wherein YL has the following structure:
Figure imgf000113_0002
33. The antibody-drag conjugate according to claim 30, wherein XAA is a dipeptide, a tripeptide, a tetrapeptide, a pentapeptide, a hexapeptide, a heptapeptide, an octapeptide, a nonapeptide, a decapeptide, a undecapeptide, or a dodecapeptide sequence.
34. The antibody-drug conjugate according to claim 33, wherein XAA is a dipeptide.
35. The antibody-drug conjugate according to claim 30, wherein each amino acid in the XAA unit is independently selected from the group consisting of arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, glutamine, cysteine,
selenocysetein, glycine, proline, alanine, valine, isoleucine, leucine, methionine,
phenylalanine, tyrosine, tryptophan, or citrulline (Cit).
-I l l-
36. The antibody-drug conjugate according to claim 30, wherein XAA is selected from the group consisting of Ala-Val, Val-Ala, and Val-Cit.
37. The antibody-drug conjugate according to claim 30, wherein PEG is a
polyethyleneglycol moiety having the structure -(CthCHbOjx-, wherein x is 1, 2, 3, 4, 5, 6,
7, 8, 9, 10, 1 1, 12, 13, 14, or 15.
38. The antibody-drag conjugate according to claim 30, wherein PEG is a
polyethyleneglycol moiety having the structure selected from the group consisting of -HN- «Ή 'ί H >()K ('(OS or I IN (CI ! <( ! ϋ.ΌΚ (Ί Ή < < '(()) . wherein x is 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, or 15.
39. The antibody-drug conjugate according to claim 38, wherein PEG is a
polyethyleneglycol moiety having the structure -HN-(CH2CH20)x-C(0)-, wherein x is 8.
40. The antibody -drug conjugate according to claim 23, wherein RM is a linking group having the structure:
Figure imgf000114_0001
wherein: Z is selected from the group consisting of -C1-C 10 alkylene-, -C3-C8 cycloalkyi-, - 0-(Cl -C8 alkyl)-,
Figure imgf000114_0002
and -(CftCTiOjr-Cffc-; and r is an integer ranging from 1- 10.
41. The antibody-drug conjugate according to claim 23, wherein RM has a structure selected from the group consisting of the following:
Figure imgf000114_0003
42. The antibody-drug conjugate according to claim 23, wherein L is a linker comprising polyethylene glycol and 1-10 amino acids.
43. The antibody-drug conjugate of claim 23, wherein
* W-RM is a thiolated succinimidyl ,
44. A pharmaceutical composition comprising the compound of claim 1 or the conjugate of claim 23, and a pharmaceutically acceptable carrier or excipient.
45. Use of a compound of claim 1 or the conjugate of claim 23 in the manufacture of a medicament.
46. A method of treating cancer comprising administering to a subject with cancer a therapeutically effective amount of a compound of claim 1 or a conjugate of claim claim 23.
47. The method of claim 46, wherein the cancer treated is a leukemia, lymphoma or a solid tumor.
48. The method of claim 46, wherein the cancer treated is a myeloproliferative cancer,
49. The method of claim 48, wherein the myeloproliferative cancer is selected from the group consisting of acute myeloid leukemia, myelodysplastic syndrome, chronic myeloid leukemia, chronic myelomonocytic leukemia, multiple myeloma, plasmacytoma and myelofibrosis.
50. The method of claim 46, wherein the conjugate comprises an antibody that specifically binds a tumor-associated antigen or a cancer-stem-cell associated antigen.
51. The method of claim. 46, wherein the cancer treated is a melanoma,
52. A method of inhibiting cell division comprising contacting a cell with a compound of claim I or a conjugate of claim 23.
53. A kit containing a first container containing a plurality of second containers, each second container containing a unit dose of a composition of claim 23.
PCT/US2017/055994 2016-10-10 2017-10-10 Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers Ceased WO2018071455A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
EP17860656.2A EP3522932A4 (en) 2016-10-10 2017-10-10 Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers
KR1020197013402A KR20190075084A (en) 2016-10-10 2017-10-10 (IQB) -1- (chloromethyl) -2,3-dihydro-1H-benzo [E] indole (CBI) dimer
CN201780076266.6A CN110049780A (en) 2016-10-10 2017-10-10 Isoquinoline benzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[E]indole (CBI) dimer
JP2019519254A JP2019530707A (en) 2016-10-10 2017-10-10 Isoquinolidinobenzodiazepine (IQB) -1 (chloromethyl) -2,3-dihydro-1H-benzo [E] indole (CBI) dimer
AU2017343565A AU2017343565A1 (en) 2016-10-10 2017-10-10 Isoquinolidinobenzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers
US16/342,176 US11359025B2 (en) 2016-10-16 2017-10-16 Anti-IL1-RAP antibodies
PCT/US2017/056808 WO2018071910A2 (en) 2016-10-16 2017-10-16 Anti-il1-rap antibodies
AU2017343784A AU2017343784A1 (en) 2016-10-16 2017-10-16 Anti-IL1-RAP antibodies
CA3084459A CA3084459A1 (en) 2016-10-16 2017-10-16 Anti-il1-rap antibodies
JP2019520368A JP7032394B2 (en) 2016-10-16 2017-10-16 Anti-IL1-RAP antibody
CN201780075197.7A CN110036028B (en) 2016-10-16 2017-10-16 anti-IL1-RAP antibody
EP17860212.4A EP3526247A4 (en) 2016-10-16 2017-10-16 ANTI-IL1-RAP ANTIBODIES
US15/904,265 US10350218B2 (en) 2016-10-10 2018-02-23 Isoquinolidinobenzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers
US16/455,269 US20200061079A1 (en) 2016-10-10 2019-06-27 Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers
JP2022026299A JP7235904B2 (en) 2016-10-16 2022-02-24 Anti-IL1-RAP antibody

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662406077P 2016-10-10 2016-10-10
US62/406,077 2016-10-10
US201762451658P 2017-01-27 2017-01-27
US62/451,658 2017-01-27

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/904,265 Continuation US10350218B2 (en) 2016-10-10 2018-02-23 Isoquinolidinobenzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers

Publications (1)

Publication Number Publication Date
WO2018071455A1 true WO2018071455A1 (en) 2018-04-19

Family

ID=61906453

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/055994 Ceased WO2018071455A1 (en) 2016-10-10 2017-10-10 Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers

Country Status (7)

Country Link
US (2) US10350218B2 (en)
EP (1) EP3522932A4 (en)
JP (1) JP2019530707A (en)
KR (1) KR20190075084A (en)
CN (1) CN110049780A (en)
AU (1) AU2017343565A1 (en)
WO (1) WO2018071455A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10350218B2 (en) 2016-10-10 2019-07-16 Cellerant Therapeutics, Inc. Isoquinolidinobenzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers
US11359025B2 (en) 2016-10-16 2022-06-14 Cantargia Ab Anti-IL1-RAP antibodies
WO2024005123A1 (en) 2022-06-30 2024-01-04 東レ株式会社 Pharmaceutical composition for treating and/or preventing cancer
US12274898B2 (en) 2018-10-31 2025-04-15 Intocell, Inc. Substituted benzodiazepines as antibody-drug conjugates
WO2025126157A1 (en) * 2023-12-15 2025-06-19 Advesya Anti-il-1rap binding domains and antibody-drug conjugates thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3066918A1 (en) 2017-06-12 2018-12-20 Bluefin Biomedicine, Inc. Anti-il1rap antibodies and antibody drug conjugates
EP4467143B1 (en) 2017-07-10 2026-03-11 Celgene Corporation Method for preparing 4-(4-(4-(((2-(2,6-dioxopiperidin-3-yl)-l-oxoisoindolin-4-yl)oxy)methyl)benzyl)piperazin-l-yl)-3-fluorobenzonitrile

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4811845A (en) * 1987-10-06 1989-03-14 Baggett Jobeth Medication compliance packaging system and procedure
US20150165063A1 (en) * 2013-08-12 2015-06-18 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US20160271142A1 (en) * 2015-03-19 2016-09-22 Cellerant Therapeutics, Inc. Isoquinolidinobenzodiazepines

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9205051D0 (en) 1992-03-09 1992-04-22 Cancer Res Campaign Tech Pyrrolobenzodiazepine derivatives,their preparation,and compositions containing them
US6417324B1 (en) 2000-04-21 2002-07-09 Tripep Ab Synthetic peptides that bind to the hepatitis B virus core and e antigens
US20030007976A1 (en) 1997-12-23 2003-01-09 Watson James D. Methods and compounds for the treatment of immunologically-mediated skin disorders
WO2005085260A1 (en) 2004-03-09 2005-09-15 Spirogen Limited Pyrrolobenzodiazepines
US7612062B2 (en) 2005-04-21 2009-11-03 Spirogen Limited Pyrrolobenzodiazepines
ES2708988T3 (en) 2007-02-23 2019-04-12 Merck Sharp & Dohme Anti-IL-23p19 antibodies obtained by genetic engineering
US8552154B2 (en) 2008-09-26 2013-10-08 Emory University Anti-PD-L1 antibodies and uses therefor
RU2683325C2 (en) 2009-02-05 2019-03-28 Иммьюноджен, Инк. New benzodiazepine derivatives
JP5875083B2 (en) 2010-04-15 2016-03-02 メディミューン リミテッド Pyrrolobenzodiazepine for the treatment of proliferative diseases
SG11201400770SA (en) 2011-09-20 2014-04-28 Spirogen Sarl Pyrrolobenzodiazepines as unsymmetrical dimeric pbd compounds for inclusion in targeted conjugates
CA2850373C (en) 2011-10-14 2019-07-16 Seattle Genetics, Inc. Pyrrolobenzodiazepines and targeted conjugates
CN103997893B (en) 2011-10-14 2019-04-12 西雅图基因公司 Pyrrolobenzodiazepines and targeted conjugates
MX338711B (en) 2012-10-12 2016-04-28 Medimmune Ltd Pyrrolobenzodiazepines and conjugates thereof.
WO2014100772A1 (en) 2012-12-21 2014-06-26 Cellerant Therapeutics, Inc. Antibodies that bind membrane-bound il1rap
MX2017009145A (en) * 2015-01-14 2017-11-22 Bristol Myers Squibb Co Benzodiazepine dimers, conjugates thereof, and methods of making and using.
BR112017014937A2 (en) * 2015-01-14 2018-03-13 Bristol-Myers Squibb Company heteroarylene bridged benzodiazepine dimers, conjugates thereof, and methods of preparation and use
WO2017194960A1 (en) * 2016-05-13 2017-11-16 Femtogenix Limited Asymmetric conjugate compounds
JP2019530707A (en) 2016-10-10 2019-10-24 セレラント セラピューティクス インコーポレイテッド Isoquinolidinobenzodiazepine (IQB) -1 (chloromethyl) -2,3-dihydro-1H-benzo [E] indole (CBI) dimer
WO2018071910A2 (en) 2016-10-16 2018-04-19 Cellerant Therapeutics, Inc. Anti-il1-rap antibodies

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4811845A (en) * 1987-10-06 1989-03-14 Baggett Jobeth Medication compliance packaging system and procedure
US20150165063A1 (en) * 2013-08-12 2015-06-18 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US20160271142A1 (en) * 2015-03-19 2016-09-22 Cellerant Therapeutics, Inc. Isoquinolidinobenzodiazepines

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
CIPOLLA, L ET AL.: "Pyrrolo[2,1c][1,4]benzodiazepine as a Scaffold for the Design and Synthesis of Anti-Tumour Drugs", ANTI-CANCER AGENTS IN MEDICINAL CHEMISTRY, vol. 9, no. 1, January 2009 (2009-01-01), pages 1 - 31, XP008139847, Retrieved from the Internet <URL:doi:10.2174/187152009787047743> *
See also references of EP3522932A4 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10350218B2 (en) 2016-10-10 2019-07-16 Cellerant Therapeutics, Inc. Isoquinolidinobenzodiazepine (IQB)-1(chloromethyl)-2,3-dihydro-1H-benzo[e]indole (CBI) dimers
US11359025B2 (en) 2016-10-16 2022-06-14 Cantargia Ab Anti-IL1-RAP antibodies
US12274898B2 (en) 2018-10-31 2025-04-15 Intocell, Inc. Substituted benzodiazepines as antibody-drug conjugates
WO2024005123A1 (en) 2022-06-30 2024-01-04 東レ株式会社 Pharmaceutical composition for treating and/or preventing cancer
WO2025126157A1 (en) * 2023-12-15 2025-06-19 Advesya Anti-il-1rap binding domains and antibody-drug conjugates thereof

Also Published As

Publication number Publication date
EP3522932A4 (en) 2020-06-24
EP3522932A1 (en) 2019-08-14
JP2019530707A (en) 2019-10-24
US20180177795A1 (en) 2018-06-28
AU2017343565A1 (en) 2019-05-30
CN110049780A (en) 2019-07-23
US20200061079A1 (en) 2020-02-27
KR20190075084A (en) 2019-06-28
US10350218B2 (en) 2019-07-16

Similar Documents

Publication Publication Date Title
US10898580B2 (en) Isoquinolidinobenzodiazepines
EP3522932A1 (en) Isoquinolidinobenzodiazepine (iqb)-1(chloromethyl)-2,3-dihydro-1h-benzo[e]indole (cbi) dimers
JP7132311B2 (en) Cytotoxic benzodiazepine derivatives
KR101871088B1 (en) Bifunctional cytotoxic agents
TW202400137A (en) Camptothecin conjugates
WO2018053552A9 (en) Isoquinolidinobenzodiazepines
CN115955980A (en) charge variable joint
KR20240015670A (en) Anthracycline antibody conjugate
JP2017527562A (en) Cytotoxic benzodiazepine derivatives
KR20230133331A (en) Immunomodulatory Antibody-Drug Conjugates
JP2024511088A (en) 2-amino-4-carboxamide-benzazepine immunoconjugate and uses thereof
KR20240139086A (en) Antibody-conjugated 8-sulfonyl-benzazepine compounds and uses thereof
HK40119840A (en) Immunostimulatory anti-pd-l1-drug conjugates
HK40106962A (en) Anthracycline antibody conjugates
TW202506691A (en) Sting agonist compounds and conjugates thereof
WO2026050214A1 (en) Anti-claudin, tlr agonist immunoconjugates and uses thereof
CN116829551A (en) Immunomodulatory antibody drug conjugates
HK1233252A1 (en) Bifunctional cytotoxic agents

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17860656

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019519254

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197013402

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017860656

Country of ref document: EP

Effective date: 20190510

ENP Entry into the national phase

Ref document number: 2017343565

Country of ref document: AU

Date of ref document: 20171010

Kind code of ref document: A