WO2018031531A1 - Engineered bacteria for non-invasive imaging and therapeutic applications - Google Patents

Engineered bacteria for non-invasive imaging and therapeutic applications Download PDF

Info

Publication number
WO2018031531A1
WO2018031531A1 PCT/US2017/045869 US2017045869W WO2018031531A1 WO 2018031531 A1 WO2018031531 A1 WO 2018031531A1 US 2017045869 W US2017045869 W US 2017045869W WO 2018031531 A1 WO2018031531 A1 WO 2018031531A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
engineered bacterium
amino acid
subject
reactive functional
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/045869
Other languages
French (fr)
Other versions
WO2018031531A4 (en
Inventor
Noemie-Manuelle Dorval Courchesne
Neel Satish JOSHI
Chaochen LU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Harvard University
Original Assignee
Harvard University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Harvard University filed Critical Harvard University
Publication of WO2018031531A1 publication Critical patent/WO2018031531A1/en
Publication of WO2018031531A4 publication Critical patent/WO2018031531A4/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/74Bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/0019Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
    • A61K49/0021Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent group being a small organic molecule
    • A61K49/0032Methine dyes, e.g. cyanine dyes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/005Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0052Small organic molecules
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/67General methods for enhancing the expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93Ligases (6)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/02Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
    • C12Q1/04Determining presence or kind of microorganism; Use of selective media for testing antibiotics or bacteriocides; Compositions containing a chemical indicator therefor
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the technology described herein relates to engineered bacteria comprising proteins that are capable of being labeled in vivo and methods for using the bacteria for diagnostic and therapeutic purposes.
  • Embodiments of the present disclosure are directed to engineered or genetically altered microbes, such as Escherichia coli, that produce proteins comprising a nonstandard amino acid.
  • the nonstandard amino acid can be labeled with a detectable substance before or after administration to the subject which allows for monitoring of the microbe over a prolonged period of time.
  • the present invention provides an engineered bacterium comprising an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid comprising a labeling codon, wherein the heterologous nucleic acid comprises a heterologous gene encoding a protein selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with a nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid at the residue corresponding to the labeling codon during translation.
  • the heterologous nucleic acid further encodes a polypeptide linker sequence.
  • the polypeptide linker sequence is flexible.
  • the heterologous nucleic acid further encodes a polypeptide tag.
  • the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
  • the heterologous nucleic acid comprises 2, 3, 4, 5, 6, 7, or 8 labeling codons.
  • the present invention provides an engineered bacterium comprising an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid encoding a protein, wherein the protein comprises a nonstandard amino acid, and wherein the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
  • the protein further comprises a polypeptide linker.
  • the polypeptide linker is flexible.
  • the protein further comprises a polypeptide tag.
  • the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
  • the protein comprises 2, 3, 4, 5, 6, 7, or 8 nonstandard amino acids.
  • the bacterial extracellular matrix protein is a fiber protein, a flagellar protein, or a pilin protein.
  • the protein is selected from the group consisting of InaV, Trat, and CsgA. In some embodiments, the protein is CsgA. In some embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA. In some embodiments, the protein is InaV and the
  • nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
  • the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
  • the labeling codon is TAG.
  • the orthogonal tRNA comprises an anticodon loop that specifically recognizes the codon UAG.
  • the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, or a norbornene moiety.
  • the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), irans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra).
  • the nonstandard amino acid is selected from the group consisting of
  • the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is of the species Escherichia coli. In some embodiments, the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp. In some embodiments, the engineered bacterium is of the Escherichia coli Nissle 1917 strain. [0021] In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon. In some embodiments, the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium further comprises a prfA gene deletion.
  • the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some embodiments, the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene.
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri,
  • Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene was produced by the chromosome.
  • the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the plasmid is pEVOL-pAzF.
  • the expression of the heterologous nucleic acid is under the control of a constitutive promoter. In some embodiments, the expression of the heterologous nucleic acid is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline. In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of a constitutive promoter.
  • the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of an inducible promoter.
  • the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
  • the present invention provides a bio film comprising an engineered bacterium described herein.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising an engineered bacterium described herein and a pharmaceutically-acceptable excipient.
  • the composition is formulated for oral administration to a subject.
  • the composition is formulated for rectal administration to a subject.
  • the pharmaceutical composition is formulated as a pill, a capsule, a lozenge, or a suppository.
  • the subject is a mammalian subject. In some embodiments, the mammalian subject is a human subject.
  • the present invention provides a method for labeling of an engineered bacterium in a subject in vivo, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; and (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein, thereby labeling the engineered bacterium in the subject in vivo.
  • step (a) is performed concurrently with step (b).
  • step (a) is performed before step (b).
  • the present invention provides a method for detecting the distribution of an engineered bacterium in a subject in vivo, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the present invention provides a method for diagnosing a gastrointestinal disease in a subject, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and (c) detecting the distribution of the detectable compound in the gastrointestinal tract of the subject, thereby diagnosing a gastrointestinal disease in the subject.
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the present invention provides a method for detecting the distribution of a bio film produced by an engineered bacterium in a subject, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid to a subject, and wherein the nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the present invention provides a method for delivering a drug to a subject in need thereof, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid, thereby delivering the drug to the subject in need thereof.
  • step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
  • the drug is delivered to the gastrointestinal tract of the subject. In some embodiments, the drug is delivered to the mouth, esophagus, stomach, large intestine, small intestine, rectum, colon, or anal canal of the subject. In some embodiments, the drug is delivered to the heart, lung, hair, or skin of the subject.
  • the engineered bacterium comprises an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid encoding the protein having the at least one nonstandard amino acid; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
  • the methods further comprise administering a nonstandard amino acid to the subject.
  • the nonstandard amino acid is administered to the subject prior to administering the detectable compound or the drug to the subject.
  • the first bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, and a norbornene moiety.
  • the second bioorthogonal reactive functional group is selected from the group consisting of a hydrazine moiety, a hydroxylamine moiety, an alkyne moiety, an azide moiety, a tetrazine moiety, and a norbornene moiety.
  • the first bioorthogonal reactive functional group is a ketone moiety
  • the second bioorthogonal reactive functional group is either a hydrazine moiety or a hydroxylamine moiety.
  • the first bioorthogonal reactive functional group is an azide moiety
  • the second bioorthogonal reactive functional group is an alkyne moiety.
  • the first bioorthogonal reactive functional group is an alkyne moiety
  • the second bioorthogonal reactive functional group is an azide moiety.
  • the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group via a click chemistry reaction.
  • the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group requires a catalytic agent. In some embodiments, the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group does not require a catalytic agent. In some embodiments, the methods further comprise administering a catalytic agent to the subject. In some embodiments, the catalytic agent is copper or nickel.
  • the detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent.
  • the protein further comprises a polypeptide linker.
  • the polypeptide linker is flexible.
  • the protein further comprises a polypeptide tag.
  • the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
  • the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein.
  • the bacterial extracellular matrix protein is a curli fiber protein, a flagellar protein, or a pilin protein.
  • the protein is selected from the group consisting of InaV, Trat, and CsgA. In some embodiments, the protein is CsgA. In some embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA. In some embodiments, the protein is InaV and the
  • nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
  • the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
  • the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra).
  • the nonstandard amino acid is selected from the group consisting of /?
  • the detectable compound is DBCO-Cy5.
  • the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is of the species Escherichia coli. In some embodiments, the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp. In some embodiments, the engineered bacterium is of the Escherichia coli Nissle 1917 strain.
  • the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon. In some embodiments, the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium further comprises a prfA gene deletion.
  • the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some embodiments, the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene.
  • the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri,
  • Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene was produced by the chromosome.
  • the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the plasmid is pEVOL-pAzF.
  • the expression of the heterologous nucleic acid is under the control of a constitutive promoter. In some embodiments, the expression of the heterologous nucleic acid is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline. In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of a constitutive promoter.
  • the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of an inducible promoter.
  • the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
  • the methods further comprise administering to the subject an inducer that regulates the inducible promoter.
  • the inducer is administered to the subject prior to administering the detectable compound or the drug to the subject.
  • the inducer is comprised in a pharmaceutical composition.
  • the engineered bacterium is administered to the subject orally or rectally. In some embodiments, the engineered bacterium is comprised in a
  • the detectable compound or the drug is administered to the subject orally, subcutaneously, intravenously, rectally, or transdermally.
  • the detectable compound or the drug is comprised in a pharmaceutical composition.
  • the detectable compound or the drug further comprises a drug delivery vehicle selected from the group consisting of a nanocarrier, a nanoparticle, a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein.
  • FIG. 1A is a schematic showing plasmid maps indicating exemplary locations of a labeling codon (UAG) in mRNA transcribed from the open reading frames of the modified genes encoding the maltose-binding protein (MBP) (position 67), CsgA (position 89), the ice nucleation protein (InaV) (position 174), or the TraT protein (position 200).
  • MBP maltose-binding protein
  • CsgA position 89
  • InaV ice nucleation protein
  • TraT protein position 200
  • FIG. IB is a schematic showing plasmid maps indicating exemplary locations of a labeling codon (UAG) in mRNA transcribed from open reading of the genes encoding the maltose-binding protein (MBP), CsgA, the ice nucleation protein (InaV), or the TraT protein appended to a flexible linker and affinity tags.
  • Affinity tags i.e., a myc tag and a poly-his tag
  • FIG. 2A depicts the structure of two nonstandard amino acids, p-acetylphenylalanine and p-azidophenylalanine.
  • FIGs. 2B and 2C are two schematics showing exemplary recombinant bacteria engineered for bioorthogonal reactions that may be used to attach a detectable moiety or drug to a protein comprising a nonstandard amino acid.
  • FIG. 3 shows an SDS-PAGE gel stained with Coomassie Blue showing the Ni NTA affinity purification of maltose-binding protein (MBP) expressed in E. coli Nissle that has not been recoded to remove TAG codons.
  • MBP maltose-binding protein
  • FIG. 4A depicts the structure of DBCO-Cy5.
  • FIGs. 4B and 4C show an SDS-PAGE gel stained with Coomassie Blue (FIG. 4B), and the corresponding fluorescence detection image (FIG. 4C) of eluates from a Ni NTA affinity purification of maltose-binding protein (MBP) comprising the nonstandard amino acid /?-AzF, that were reacted with DBCO-Cy5.
  • MBP maltose-binding protein
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • Concentrated 500 mM eluates of purified MBP were incubated with DBCO-Cy5 at increasing molar ratios ranging from 1: 10 to 10: 1 MBP:DBCO-Cy5.
  • FIG. 5 shows an SDS-PAGE gel stained with Coomassie Blue showing the Ni NTA affinity purification of CsgA expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • FIGs. 6A and 6B show an SDS-PAGE gel stained with Coomassie Blue (FIG. 6A), and the corresponding fluorescence detection image (FIG. 6B), of eluates from a Ni NTA affinity purification of CsgA comprising the nonstandard amino acid AzF, that were reacted with DBCO-Cy5.
  • CsgA was expressed in E.
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • Concentrated 500 mM eluates of purified CsgA protein were incubated with DBCO-Cy5.
  • FIG. 7 shows fluorescence detection imaging of cell pellets from E. coli Nissle cells under three different transformation conditions: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS”).
  • DBCO-Cy5 After exposure to DBCO-Cy5, cell pellets were washed three times with phosphate buffer. MBP is soluble and was washed away from the cell pellets, and low specific binding of DBCO-Cy5 to other proteins was observed.
  • FIG. 8 shows Congo Red dye-monitoring of the expression of CsgA comprising p- AzF at different concentrations of arabinose to induce the expression of the orthogonal translation system that incorporates /?-AzF into the expressed protein.
  • Congo Red dye binding to curli fiber was determined using spectrophotometry at OD490/OD600, a measure of bound Congo Red dye over cell density. Increased Congo Red binding signifies increased curli fiber (CsgA) production.
  • Optimal expression of CsgA comprising p-AzP was observed at 0.05% arabinose induction. E. coli Nissle having a deletion in the endogenous curli operons were used.
  • FIG. 9 shows scanning electron microscopy images of curli (CsgA) expression in E. coli Nissle expressing either MBP or CsgA as indicated.
  • the protein of interest (MBP or CsgA) was expressed in E.
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • FIGs. 10A and 10B show bacterial growth curves of E. coli Nissle cells either:
  • FIG. 10A shows growth curves in the absence of an inducer for the orthogonal translation system (arabinose).
  • FIG. 10B shows growth curves in the presence of 1 mM /?-AzF.
  • FIGs. 11A and 11B shows bacterial growth curves of E. coli Nissle cells either:
  • FIG. 11A shows growth curves in the presence of 0.05% arabinose, the inducer for the orthogonal translation system and the MBP protein.
  • FIG. 11B shows growth curves in the presence of in the presence of 0.05% arabinose and 1 mM /?-AzF.
  • FIG. 12 shows an SDS-PAGE gel stained with Coomassie Blue
  • FIG. 13 shows a fluorescence detection image of an SDS-PAGE gel of purified CsgA comprising p-AzF that was reacted with DBCO-Cy5.
  • Cells were grown in media containing varying concentrations of the nonstandard amino acid (p-AzF; labeled "NSAA").
  • NSAA nonstandard amino acid
  • coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild- type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • FIGs. 14A and 14B shows an SDS-PAGE gel stained with Coomassie Blue (FIG. 14A), and a Western Blot (FIG. 14B) using anti-His antibody to detect the expression of TraT surface protein having a poly-His tag in cell lysates from Escherichia coli Nissle.
  • FIGs. 15A, 15B, 15C, and 15D show the expression of wild-type and mutant TraT in lysates from cells lacking or having an orthogonal translation system (OTS) in the presence or absence of the NSAA pAzF.
  • FIG. 15A and 15B each show a Western Blot using anti-His antibody (FIG. 15A) or anti-myc antibody (FIG.
  • FIG. 15C is a bar graph quantitatively depicting the percentage of TraT protein detected with anti-His antibody corresponding to the approximately 37 kDa full length TraT protein in each of the lanes of the Western Blot shown in FIG. 15A.
  • FIG. 15D is a bar graph quantitatively depicting the intensity (in absolute intensity units) of the approximately 37 kDa full length TraT protein in each of the lanes of the Western Blot shown in FIG. 15A.
  • FIG. 16 shows an SDS-PAGE of either wild-type TraT, mutant TraT comprising pAzF, wild-type CsgA or mutant TraT comprising pAzF, labelled with DBCO-Cy5.
  • FIGs. 17A, 17B and 17C show the optimization of labeling of mutant TraT comprising pAzF with DBCO-Cy5.
  • FIG. 17A shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells ("sham”), grown in the presence of 5 mM pAzF.
  • FIG. 17B shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF.
  • FIG. 17C shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF.
  • FIGs. 18A, 18B, 18C, and 18D show the optimization of labeling of mutant TraT comprising pAzF or mutant CsgA comprising pAzF with DBCO-Cy5.
  • FIG. 18A shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and either mutant CsgA comprising pAzF ("CsgA") or untransformed PBP8 cells ("sham”), grown in the presence of 5 mM pAzF. Cells were incubated with increasing concentrations (200 ⁇ - 400 ⁇ ) of DBCO-Cy5 for labelling.
  • FIG. 18B shows the fluorescence intensity of the E.
  • FIG. 18C shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant CsgA comprising pAzF ("CsgA”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF. Cells were incubated with 200 ⁇ DBCO-Cy5 at 37°C for 1-4 hours.
  • FIG. 18D shows the fluorescence intensity of the E.
  • coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT”) or untransformed PBP8 cells (“sham”), grown in the presence of 5 mM pAzF. Cells were incubated with 200 ⁇ DBCO- Cy5 at 37°C for 1-4 hours. N 5 for all experiments.
  • FIG. 19 depicts flow cytometry data for E. coli PBP8 cells alone (“Control cells”), cells transformed to express wild-type CsgA ("Wild-type fibers”), cells transformed to wild- type CsgA and the orthogonal translation system (OTS) ("Wild-type fibers with OTS”), cells transformed to express mutant CsgA comprising pAzF and the OTS in the absence of the expression inducer arabinose (“Mutant fibers with OTS, no induction”), or cells transformed to express mutant CsgA comprising pAzF and the OTS in the presence of the expression inducer arabinose (“Mutant fibers with OTS”). Cells were labelled with 300 ⁇ DBCO-Cy5 for 2 hours at 37°C.
  • FIG. 20 depicts flow cytometry data for untransformed E. coli PBP8 cells (“sham”), cells transformed to express wild-type TraT (“wt TraT”), cells transformed to wild-type TraT and the orthogonal translation system (OTS) ("wt TraT + OTS + NSAA”), cells transformed to express mutant TraT comprising pAzF and the OTS grown in the absence of the expression inducer arabinose (“mut TraT + OTS + NSAA (non induction)”), or cells transformed to express mutant TraT comprising pAzF and the OTS grown in the presence of the expression inducer arabinose (“mut TraT + OTS + NSAA”).
  • Cells were labelled with 300 ⁇ DBCO-Cy5 for 2 hours at 37°C.
  • FIGS. 21A, 21B, 21C, and 21D show confocal microscopy images of E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS, or mutant TraT comprising pAzF and the OTS. Cells were labeled with Cy5-DBCO and Hoechst dye.
  • FIG. 21A shows a confocal microscopy image of cells expressing mutant CsgA comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 21B shows a confocal microscopy image of single cells expressing mutant CsgA comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 21A, 21B, 21C, and 21D show confocal microscopy images of E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS, or mutant TraT comprising pAzF and the
  • FIG. 21C shows confocal microscopy images of cells expressing mutant TraT comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 21D shows a confocal microscopy image of single cells expressing mutant TraT comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
  • FIG. 22 show fluorescence detection images of Cy5-DBCO labelled bacteria in mice administered either no bacteria (control), or either 1 x 10 6 or 1 x 10 9 PBP8 cells expressing mutant CsgA comprising pAzF and the OTS labeled in vitro with Cy5-DBCO. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER).
  • FIG. 23 shows fluorescence detection images of Cy5-DBCO in mice administered either 5 ⁇ , 50 ⁇ , 100 ⁇ , or 200 ⁇ of Cy5-DBCO. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER).
  • FIG. 24 shows fluorescence detection images of mice administered either Cy5-DBCO alone or mice administered E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS and labeled with Cy5-DBCO at -1 hour (prior to
  • FIG. 25 is a line graph depicting the normalized radiant efficiency analysis of the fluorescence detected in the mice depicted in FIG. 24. Normalized total radiant efficiency of subtracted imaged detected according to the following equation:
  • FIGs. 26A and 26B show the detection of mutant CsgA comprising pAzF in cells lysates from two bacterial colonies isolated from fecal samples of mice administered E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS.
  • FIG. 26A shows a fluorescence image of an SDS-PAGE gel stained with Cy5-DBCO of either His-tag purified or unpurified cell lysates from bacterial cultures derived from two separate bacterial colonies that were either grown in the absence of pAzF ("Mut w/o NSAA"), presence of pAzF ("Mut with NSAA").
  • FIG. 26B shows a Coomassie Blue stain of the SDS- PAGE gel shown in FIG. 26A.
  • FIGs. 27A and 27B show fluorescence detection images of Cy5-DBCO-labelled bacteria in the gastrointestinal tracts of mice administered either untransformed PBP8 cells ("control") or PBP8 cells transformed to express mutant CsgA comprising pAzF and the OTS, and Cy5-DBCO.
  • FIG. 27C are bar graphs depicting the normalized radiant efficiency analysis of the fluorescence detected in FIGs. 27A and 27B.
  • FIG. 28 shows ex vivo fluorescence detection imaging of the gastrointestinal tract of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("(+) NSAA, inducer Mutant EcN”) or untreated mice ("control”), 24 hours after treatment with Cy5-DBCO.
  • FIG. 29 shows ex vivo fluorescence detection imaging of the gastrointestinal tract of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("(+) NSAA, inducer Mutant EcN”) or untreated mice ("control”), 36 hours after treatment with Cy5-DBCO.
  • FIG. 30A shows fluorescence detection images of the cecum of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("Mutant”) or untreated mice (“(-)”), 36 hours after treatment with Cy5-DBCO.
  • FIGs. 30B and 30C depict fluorescence detection images of extracted supernatants and pellets, respectively, derived from the cecum of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics (“Mutant”) or untreated mice (“(-)”), 36 hours after treatment with Cy5-DBCO.
  • FIGs. 31A and 31B are images of SDS-PAGE gels from soluble fraction
  • FIG. 31A shows the Coomassie Blue-stained SDS-PAGE gel of the soluble fractions (supernatant) before (“Supl”) and after ("Sup2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
  • 31B the left panel, shows the Coomassie Blue-stained SDS-PAGE gel with the pellet fractions before (“Pell”) and after ("Pel2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
  • FIGs. 32A and 32B are images of SDS-PAGE gels from soluble fraction
  • FIG. 32A shows the Coomassie Blue-stained SDS-PAGE gel of the soluble fractions (supernatant) before (“Supl”) and after (“Sup2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength. Samples are at a 1:20 dilution of the samples run in the SDS-PAGE gels of FIGs.
  • FIG. 32B the left panel, shows the Coomassie Blue-stained SDS- PAGE gel with the pellet fractions before (“Pell”) and after ("Pel2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
  • the disclosure includes engineered bacteria, pharmaceutical compositions thereof, methods of labeling an engineered bacterial cell, and methods of using engineered bacteria for the diagnosis and treatment of a disease or disorder.
  • the engineered bacterium has been genetically modified to comprise an orthogonal translation system.
  • the orthogonal translation system allows the engineered bacterium to incorporate one or more nonstandard amino acids into a protein encoded by a nucleic acid having a labeling codon, and being expressed by the bacterium.
  • the orthogonal translational system can be designed to particularly target specific codons (i.e., labeling codons) present in a gene encoding a protein of interest in order to incorporate one or more nonstandard amino acids into the protein during translation.
  • Proteins having a nonstandard amino acid bearing a bioorthogonal reactive functional group can be reacted with detectable moiety which allow for the tracking, labeling and/or visualization of the protein.
  • bacterial cells comprising proteins having a nonstandard amino acid bearing a bioorthogonal reactive functional group can also be labeled with a detectable moiety, after being administered to a subject, which allows for the tracking, labeling and/or visualization of the bacterium in the subject.
  • the genetic modification of a bacterium to include an orthogonal translation system allows for the incorporation of nonstandard amino acids into any protein expressed by the bacterium, a concept known as genetic code expansion (see, e.g., Young et al. (2010) J. Mol. Biol. 395: 361-374).
  • Genetic code expansion includes the genetic modification of a microorganism to express an orthogonal aminoacyl tRNA synthetase/tRNA (aaRS/tRNA) pair that is specific for a particular nonstandard amino acid and that does not function with standard amino acids, endogenous tRNAs or endogenous aminoacyl tRNA synthetases.
  • genetic code expansion requires the use of both an orthogonal aminoacyl aaRS/tRNA pair, as well as a labeling codon that can be decoded by the tRNA of the aaRS/tRNA pair, providing a mechanism for incorporating a nonstandard amino acid into any protein of interest.
  • the amber stop codon TAG UAG on mRNA
  • Multiple aaRS/tRNA pairs have been developed thus far, allowing for the incorporation of over 100 nonstandard amino acids into proteins (see, e.g., Liu et al. (2010) Annu. Rev. Biochem. 79: 413-444).
  • nonstandard amino acids having a variety of different chemical structures (e.g., bioorthogonal reactive functional groups, metal chelation moieties, photo-crosslinking side chains, photo-caged side chains, post-translational modifications, redox reactive agents, and infrared, NMR and fluorescent probes) have also been developed (see, e.g., Wang, et al. (2006) Annu. Rev. Biomol. Struct. 35: 225-249).
  • bacteria can be genetically modified to be able to express a protein having a nonstandard amino acid and can be used for in vivo diagnostic and therapeutic methods which allow for the prolonged monitoring of the bacteria, as well as for the use of the bacteria in multiple therapeutic and diagnostic methods.
  • the engineered bacteria described herein are capable of expressing a protein of interest having at least one non-standard amino acid comprises a bioorthogonal reactive functional group.
  • the engineered bacteria can be safely administered to a subject, allowed to colonize and/or engraft in the subject, and subsequently be triggered (e.g., with an inducer) to express a protein having a nonstandard amino acid bearing a bioorthogonal reactive functional group.
  • proteins can then be reacted with a variety of molecular entities (e.g., detectable probes and/or drugs) for a multitude of clinical applications in a non- invasive manner.
  • molecular entities e.g., detectable probes and/or drugs
  • multiple nonstandard amino acids having distinct bioorthogonal reactive functional groups have been developed and may be used in the present invention (see, e.g., Lang and Chin (2014) Chem. Rev.
  • the engineered bacteria described herein are labeled by reacting the bioorthogonal reactive functional group of the nonstandard amino acid with a bioorthogonal reactive functional group of a detectable moiety, such as a dye or MRI contrast agent.
  • a detectable moiety such as a dye or MRI contrast agent.
  • the engineered bacteria described herein can be administered to a subject, modified to comprise a detectable moiety and/or drug and be used for variety of diagnostic and/or therapeutic methods to, for example, image tissues and organs of a subject.
  • engineered bacterium or “engineered bacterial cell” refers to a bacterial cell that has been genetically modified from their native state.
  • an engineered bacterial cell may have nucleotide insertions, nucleotide deletions, nucleotide rearrangements, and nucleotide modifications introduced into their DNA. These genetic modifications may be present in the chromosome of the bacteria or bacterial cell, or on a plasmid in the bacteria or bacterial cell.
  • Engineered bacterial cells of the disclosure may comprise exogenous nucleotide sequences on plasmids.
  • recombinant bacterial cells may comprise exogenous nucleotide sequences stably incorporated into their
  • the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is pathogenic.
  • Probiotic refers to a live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism.
  • the host organism is a mammal.
  • the host organism is a human.
  • Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic bacteria.
  • probiotic bacteria include, but are not limited to, Bifidobacteria, Escherichia coli, Lactobacillus, and Saccharomyces, e.g., Bifidobacterium bifidum,
  • Lactobacillus bulgaricus Lactobacillus paracasei, and Lactobacillus plantarum.
  • the probiotic may be a variant or a mutant strain of bacterium.
  • Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g.,
  • Non-pathogenic bacteria may be genetically engineered to provide probiotic properties.
  • Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
  • the term “gene” refers to a nucleic acid fragment that encodes a protein or fragment thereof, optionally including regulatory sequences preceding (5' non- coding sequences) and following (3' non-coding sequences) the coding sequence. In one embodiment, a “gene” does not include regulatory sequences preceding and following the coding sequence.
  • heterologous gene refers to a nucleotide sequence that is not normally found in a given cell in nature.
  • a heterologous sequence encompasses a nucleic acid sequence that is exogenously introduced into a given cell.
  • Heterologous gene includes a native gene, or fragment thereof, that has been introduced into the host cell in a form that is different from the corresponding native gene.
  • a heterologous gene may include a native gene, or fragment thereof, introduced into a non-native host cell.
  • a heterologous gene may be foreign or native to the recipient cell; a nucleic acid sequence that is naturally found in a given cell but expresses an unnatural amount of the nucleic acid and/or the polypeptide which it encodes; and/or two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
  • the term “endogenous gene” refers to a native gene in its natural location in the genome of an organism.
  • transgene refers to a gene that has been introduced into the host organism, e.g., host bacterial cell's genome.
  • a "labeling codon”, as used herein in reference to DNA, refers to an assembly of three or more nucleotides in a deoxyribonucleic acid molecule which are transcribed to three or more nucleosides of a ribonucleic acid molecule that are specifically recognized and/or decoded by an orthogonal tRNA, but are not recognized and/or decoded by an endogenous tRNA.
  • RNA e.g., mRNA
  • a "promoter” as used herein refers to a nucleotide sequence that is capable of controlling the expression of a coding sequence or gene. Promoters are generally located 5' of the sequence that they regulate. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from promoters found in nature, and/or comprise synthetic nucleotide segments. Those skilled in the art will readily ascertain that different promoters may regulate expression of a coding sequence or gene in response to a particular stimulus, e.g., in a cell-specific or tissue- specific manner, in response to different environmental or physiological conditions, or in response to specific compounds.
  • Prokaryotic promoters are typically classified into two classes: inducible and constitutive.
  • Constant promoter refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked.
  • Constitutive promoters and variants are well known in the art and include, but are not limited to, a constitutive Escherichia coli ⁇ promoter, a constitutive Escherichia coli ⁇ 32 promoter, a consti ⁇ tuti ⁇ ve Escherichia coli ⁇ 70 promoter, a constitutive Bacillus subtilis ⁇ promoter, a constitutive Bacillus subtilis ⁇ promoter, and a bacteriophage T7 promoter.
  • an “inducible promoter” refers to a promoter that initiates increased levels of transcription of the coding sequence or gene under its control in response to a stimulus or an exogenous environmental condition.
  • a “directly inducible promoter” refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a protein or polypeptide, where, in the presence of an inducer of said regulatory region, the protein or polypeptide is expressed.
  • an “indirectly inducible promoter” refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a first gene encoding a first protein, polypeptide, or factor, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a second gene, the second regulatory region may be activated or repressed, thereby activating or repressing expression of the second gene.
  • bioorthogonal reactive functional group refers to a chemical moiety that mediates a chemical reaction with another chemical moiety, whereby the chemical reaction can occur inside of a living system with minimal interference of native biochemical processes.
  • a “bioorthogonal reaction”, as used herein, is a reaction between two bioorthogonal reactive functional groups typically proceed under physiological conditions that results in a covalent bond that is stable under physiological conditions.
  • click chemistry reaction refers to a chemical reaction occurring between a pair of terminal reactive moieties that rapidly and selectively react (“click") with each other to form a targeting or effector moiety conjugated binding polypeptide.
  • Click chemistry reactions can be categorized into two separate groups: copper (Cu(I))-catalyzed and copper-free.
  • Cu(I)-catalyzed azide-alkyne click chemistry reaction relies on the presence of Cu(I) ions whereas the copper-free reactions proceed without metal catalysis (e.g. , the Staudinger Ligation or the azide-phosphine reaction).
  • a “nonstandard amino acid”, as used herein refers to any amino acid, other than the standard amino acids that are the building blocks of polypeptides of most organisms, including alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
  • the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • nonstandard biorthogonal functional amino acid refers to any nonstandard amino acid which comprises a bioorthogonal reactive functional group.
  • the term "expression” refers to the transcription and stable accumulation of sense (mRNA) or anti-sense RNA derived from a nucleic acid, and/or to translation of an mRNA into a polypeptide
  • mRNA sense
  • anti-sense RNA derived from a nucleic acid
  • gene modification refers to any genetic change.
  • Exemplary genetic modifications include those that increase, decrease, or abolish the expression of a gene, including, for example, modifications of native chromosomal or extrachromosomal genetic material.
  • Exemplary genetic modifications also include the introduction of at least one plasmid, modification, mutation, base deletion, base addition, and/or codon modification of chromosomal or extrachromosomal genetic sequence(s), gene over-expression, gene amplification, gene suppression, promoter modification or substitution, gene addition (either single or multi-copy), antisense expression or suppression, or any other change to the genetic elements of a host cell, whether the change produces a change in phenotype or not.
  • Genetic modification can include the introduction of a plasmid, e.g.
  • a plasmid comprising at least one amino acid catabolism enzyme operably linked to a promoter into a bacterial cell.
  • Genetic modification can also involve a targeted replacement in the chromosome, e.g. , to replace a native gene promoter with an inducible promoter, regulated promoter, strong promoter, or constitutive promoter.
  • Genetic modification can also involve gene amplification, e.g. , introduction of at least one additional copy of a native gene into the chromosome of the cell.
  • chromosomal genetic modification can involve a genetic mutation.
  • a "pharmaceutical composition,” as used herein, refers to a composition comprising an active ingredient (e.g., a bacterial cell, an inducer, a drug, or a detectable compound) with other components such as a physiologically suitable carrier and/or excipient.
  • an active ingredient e.g., a bacterial cell, an inducer, a drug, or a detectable compound
  • other components such as a physiologically suitable carrier and/or excipient.
  • the term "pharmaceutically acceptable” or “pharmacologically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable or “pharmacologically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • animal e.g. , human
  • compositions should meet sterility, pyrogenicity, general safety and purity standards as required by the FDA Office of Biological Standards.
  • the term "pharmaceutically acceptable excipient” means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g. , lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • manufacturing aid e.g. , lubricant, talc magnesium, calcium or zinc stearate, or steric acid
  • solvent encapsulating material involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl
  • wetting agents coloring agents, release agents, coating agents, disintegrating agents, binders, sweetening agents, flavoring agents, perfuming agents, protease inhibitors, plasticizers, emulsifiers, stabilizing agents, viscosity increasing agents, film forming agents, solubilizing agents, surfactants,
  • preservative and antioxidants can also be present in the formulation.
  • excipient can also be present in the formulation.
  • carrier can also be present in the formulation.
  • pharmaceutically acceptable excipient can also be present in the formulation.
  • heterologous when referring to a heterologous translation system, or to a heterologous component of the translation system (e.g. , a heterologous amino acyl synthetase), refers to the ability of an aminoacyl synthetase and/or tRNA to function independently of the aminoacyl synthetases and tRNAs endogenous to the host bacterium.
  • orthogonal aminoacyl tRNA synthetase refers to an enzyme that does not specifically aminoacylate endogenous tRNAs of the host bacterium, but specifically aminoacylates its cognate orthogonal tRNA.
  • orthogonal tRNA refers to a tRNA that is not a substrate for the endogenous aminoacyl tRNA synthetases of a host bacterium, but specifically interacts with an orthogonal aminoacyl tRNA synthetase.
  • the orthogonal tRNA directs the translation incorporation of a nonstandard amino acid of an orthogonal aminoacyl tRNA synthetase in response to a specific codon (e.g. , the UAG codon, also known as the amber stop codon).
  • a "plasmid” or “vector” includes a nucleic acid construct designed for delivery to a host cell or transfer between different host cell.
  • An "expression plasmid” or “expression vector” can be a plasmid that has the ability to incorporate and express heterologous nucleic acid fragments in a cell.
  • An expression plasmid may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms.
  • the nucleic acid incorporated into the plasmid can be operatively linked to an expression control sequence when the expression control sequence controls and regulates the transcription and translation of that
  • a biofilm refers to a mass of microorganisms which can adhere or is adhering to a surface.
  • a biofilm comprises a matrix of extracellular polymeric substances, including, but not limited to extracellular DNA, proteins, glycopeptides, and polysaccharides.
  • the nature of a biofilm, such as its structure and composition, can depend on the particular species of bacteria present in the biofilm. Bacteria present in a biofilm are commonly genetically or phenotypically different than corresponding bacteria not in a biofilm, such as isolated bacteria or bacteria in a colony.
  • Conditions suitable for the production of a biofilm can include, but are not limited to, conditions under which the microbial cell is capable of logarithmic growth and/or polypeptide synthesis. Conditions may vary depending upon the species and strain of microbial cell selected. Conditions for the culture of microbial cells are well known in the art. Biofilm production can also be induced and/or enhanced by methods well known in the art, e.g. contacting cells with subinhibitory concentrations of beta- lactam or aminoglycoside antibiotics, exposing cells to fluid flow, contacting cells with exogenous poly-N-acetylglucosamine (PNAG), or contacting cells with quorum sensing signal molecules. In some embodiments, conditions suitable for the production of a biofilm can also include conditions which increase the expression and secretion of CsgA, e.g. by exogenously expressing CsgD.
  • PNAG poly-N-acetylglucosamine
  • protein and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function.
  • modified amino acids e.g., phosphorylated, glycated, glycosylated, etc.
  • amino acid analogs regardless of its size or function.
  • Protein and polypeptide are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps.
  • protein and
  • polypeptide are used interchangeably herein when referring to a gene product and fragments thereof.
  • exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
  • a "nucleic acid” or “nucleic acid sequence” may be any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof.
  • the nucleic acid can be either single- stranded or double-stranded.
  • a single- stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single- stranded nucleic acid not derived from any double- stranded DNA.
  • the nucleic acid can be DNA.
  • the nucleic acid can be RNA.
  • Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
  • non-pathogenic refers to bacteria that are not capable of causing disease or harmful responses in a host.
  • non-pathogenic bacteria are commensal bacteria. Examples of non-pathogenic bacteria include, but are not limited to Bacillus, Bacteroides, Bifidobacterium, Brevibacteria,
  • Lactobacillus Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyri m. Enterococcus faecium, Lactobacillus acidophilus,
  • Naturally pathogenic bacteria may be genetically engineered to provide reduce or eliminate pathogenicity.
  • a heterologous gene encoding an amino acid catabolism enzyme should be understood to mean “at least one heterologous gene encoding at least one amino acid catabolism enzyme.”
  • a heterologous gene encoding an amino acid importer should be understood to mean “at least one heterologous gene encoding at least one amino acid importer.”
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • the engineered bacterium has been genetically modified to comprise an orthogonal translation system.
  • the orthogonal translation system is composed of a heterologous gene encoding an orthogonal aminoacyl synthetase and a heterologous gene encoding an orthogonal tRNA.
  • the orthogonal translation system allows the engineered bacterium to incorporate one or more nonstandard amino acids into a protein expressed by the bacterium.
  • the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the orthogonal translation system is located in plasmid pEVOL-pAzF (described, e.g., in Chin et al. (2002) J. Am. Chem. Soc. 124(31): 9026-7; Rovner et al. (2015) Nature 518(7537): 89-93, which are incorporated herein by reference). In some embodiments, the heterologous gene encoding a component of the orthogonal translation system is located in the bacterial genome. In some embodiments, the
  • heterologous gene encoding a component of the orthogonal translation system is located in a plasmid.
  • the heterologous gene encoding an orthogonal aminoacyl synthetase is located in the bacterial genome.
  • the heterologous gene encoding an orthogonal aminoacyl synthetase is located in a plasmid.
  • the heterologous gene encoding an orthogonal tRNA is located in the bacterial genome.
  • the heterologous gene encoding an orthogonal tRNA is located in a plasmid.
  • the orthogonal translation system includes a tRNA that decodes or recognizes a specific codon (i.e., a labeling codon) that is not decoded and/or recognized by any endogenous tRNA, and as aminoacyl tRNA synthetase that preferentially aminoacylates a cognate tRNA with a specific nonstandard amino acid.
  • a specific codon i.e., a labeling codon
  • aminoacyl tRNA synthetase that preferentially aminoacylates a cognate tRNA with a specific nonstandard amino acid.
  • the orthogonal translation system will comprise an aminoacyl tRNA synthetase that does not preferentially aminoacylate endogenous L. lactis tRNAs.
  • the orthogonal translation system will further comprise an orthogonal tRNA that is minimally, or not at all, aminoacylated by an endogenous L. lactis aminoacyl tRNA synthetase.
  • the orthogonal translation system is from, or is derived from, an Archea translational system. In some embodiments, the orthogonal translation system is from, or is derived from, an bacterial translation system. In some embodiments, the orthogonal translations system is an engineered translation system. In some embodiments, the orthogonal translation system is a naturally-occurring translation system. In some embodiments, the orthogonal translations system is from, or is derived from, a
  • the orthogonal translation system is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii translation system.
  • the orthogonal aminoacyl synthetase is from, or is derived from, an Archea aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, an bacterial aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is an engineered aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is a naturally-occurring aminoacyl synthetase.
  • the orthogonal aminoacyl synthetase is from, or is derived from, a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl synthetase.
  • the orthogonal tRNA is from, or is derived from, an
  • the orthogonal tRNA is from, or is derived from, a bacterial tRNA. In some embodiments, the orthogonal tRNA is an engineered tRNA. In some embodiments, the orthogonal tRNA is a naturally-occurring tRNA. In some
  • the orthogonal tRNA is from, or is derived from, a Methanosarcina
  • the orthogonal tRNA is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii tRNA.
  • Orthogonal translation systems, orthogonal aminoacyl synthetases and/or an orthogonal tRNAs for use in the present invention may be selected based on their ability to incorporate a specific nonstandard amino acid and/or based on their ability to recognize a specific labeling codon.
  • the orthogonal aminoacyl synthetase and the orthogonal tRNA are from, or are derived from, the same organism.
  • the orthogonal aminoacyl synthetase and the orthogonal tRNA are from, or are derived from, different organisms.
  • the orthogonal aminoacyl synthetase and/or orthogonal tRNA is from, or is derived from, an organism selected from the group consisting of
  • Methanosarcina mazei, Methanosarcina acetovorans, Methanosarcina barken,
  • Methanosarcina frisia Methanosarcina thermophila
  • Methanosarcina vacolata Methanosarcina vacolata
  • thermoautotrophicum Haloferax volcanii, Archaeo globus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, Methanococcus maripaludis, Methanopyrus kandleri, Methanosarcina mazei, Pyrobaculum aerophilum, Pyrococcus abyssi, Sulfolobus solfataricus, Sulfolobus tokodaii, Thermoplasma acidophilum, and Thermoplasma volcanium.
  • orthogonal translation systems and methods for producing orthogonal translation systems, are known in the art and can be used as described herein (see, e.g., PCT Publication Numbers WO 2005/007624; WO 2002/086075; WO 2002/085923; WO 2004/094593; WO 2005/019415; WO 2005/007870; WO 2006/110182; and WO 2007/103490; which are all incorporated by reference herein in their entireties).
  • the engineered bacterium comprises more than one orthogonal translation system, thus allowing for the incorporation of more than one type of nonstandard amino acid into a protein of interest.
  • each of the orthogonal translation systems may recognize the same and/or different labeling codons.
  • one or more than one labeling codon(s) may be used as described herein. Thus, multiple same or different nonstandard amino acid may be incorporated into a protein of interest by using different labeling codons.
  • the engineered bacterium described herein comprises a heterologous nucleic acid comprising a labeling codon.
  • a labeling codon that is not recognized by the endogenous translation machinery of a bacterial cell results in a blockade of the translation of the polypeptide being produced.
  • the aminoacyl tRNA synthetase/tRNA pair of the system recognizes the labeling codon and loads an amino acid (e.g. , a nonstandard amino acid) in response to the labeling codon, thereby suppressing the blockade of translation.
  • Labeling codons for use in the present invention expand the genetic codon framework of the bacterium.
  • the labeling codon is a three base codon.
  • the labeling codon is a nonsense codon.
  • the labeling codon is a stop codon (e.g. , an amber codon (TAG), an ochre codon (TAA), or an opal codon (TGA)).
  • the labeling codon is an unnatural codon.
  • the labeling codon is an extended codon (e.g., a codon comprising four or more bases).
  • the labeling codon comprises four bases (e.g. , CTAG, AGGA, TAGA, CCCT).
  • the labeling codon comprises five bases (e.g. , AGGAC, CCCCT, CCCTC, CTAGA, CTACT, TAGGC).
  • the labeling codon comprises six bases.
  • the labeling codon comprises seven or more bases.
  • the labeling codon is a three base codon that is not used by the bacterium' s translational machinery. In some embodiments, the labeling codon is a three base codon that is rarely used by the bacterium' s translational machinery. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce the abundance of the labeling codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to remove the labeling codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce the abundance of the labeling codon TAG. In some embodiments, the engineered bacterium comprises a genome that has been recoded to remove the labeling codon TAG.
  • the engineered bacterium comprises more than one orthogonal translation system such that more labeling codons may be used as described herein.
  • more labeling codons may be used as described herein.
  • multiple same or different nonstandard amino acid may be incorporated into a polypeptide of interest by using different labeling codons.
  • the engineered bacterium described herein comprises a heterologous nucleic acid comprising a labeling codon.
  • the heterologous nucleic acid is located in the bacterial genome.
  • the heterologous gene is located in a plasmid.
  • the expression of the heterologous nucleic acid is under the control of a constitutive promoter (e.g. , a constitutive promoter disclosed herein).
  • the heterologous nucleic acid is under the control of an inducible promoter (e.g. , an inducible promoter disclosed herein).
  • the heterologous nucleic acid comprises one labeling codon.
  • the heterologous nucleic acid comprises more than one labeling codon. In some embodiments, the heterologous nucleic acid comprises one, two, three, four, five, six, seven, eight or more labeling codons. Labeling codons may be introduced into the heterologous nucleic acid using methods known in the art, including, e.g., site-directed mutagenesis).
  • the heterologous nucleic acid comprises a labeling codon and a heterologous gene encoding a protein.
  • the heterologous nucleic acid further encodes a polypeptide linker sequence.
  • the polypeptide linker sequence is flexible.
  • the heterologous nucleic acid further encodes a polypeptide tag.
  • the labeling codon is located at a nucleic acid position corresponding to the open reading frame of the protein. In some embodiments, the labeling codon is not located at a nucleic acid position corresponding to the open reading frame of the protein.
  • the labeling codon is located at a nucleic acid position corresponding to the open reading frame of the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
  • the engineered bacterium described herein comprises a protein having a nonstandard amino acid.
  • the protein comprises one nonstandard amino acid.
  • the non standard amino acid does not interfere with the structural fold, function, enzymatic activity and/or location of the protein.
  • the non standard amino acid interferes with the structural fold, function, enzymatic activity and/or location of the protein.
  • the protein comprises more than one nonstandard amino acid. In some embodiments where the protein comprises multiple nonstandard amino acids, one or more of the nonstandard amino acids does not interfere with the structural fold, function, enzymatic activity and/or location of the protein.
  • the protein comprises multiple nonstandard amino acids
  • one or more of the nonstandard amino acids interfere with the structural fold, function, enzymatic activity and/or location of the protein.
  • the protein comprises two, three, four five, six, seven, eight, or more nonstandard amino acids. Multiple nonstandard amino acids are know in the art and can be used as described herein (see, e.g., Lang and Chin (2014) Chem. Rev. 114: 4764-806, which is incorporated herein by reference in its entirety).
  • the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-lF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa),
  • the non-standard amino acid comprises a bioorthogonal reactive functional group.
  • the detectable moiety comprises a bioorthogonal reactive functional group.
  • Multiple bioorthogonal reactive functional groups are known in the art and can be used in the methods described herein (see, e.g. , Lang and Chin (2014)).
  • the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkene moiety, an alkyne moiety, a tetrazine moiety, and a norbornene moiety.
  • the detectable moiety comprises a bioorthogonal reactive functional group.
  • multiple bioorthogonal reactive functional groups are known in the art and can be used in the methods described herein (see, e.g. , Lang and Chin (2014)).
  • the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkene moiety, an alkyne
  • bioorthogonal reactive functional group is able to participate in a click chemistry reaction with a second bioorthogonal reactive functional group (e.g. , a bioorthogonal reactive functional group present on a drug or detectable compound).
  • a second bioorthogonal reactive functional group e.g. , a bioorthogonal reactive functional group present on a drug or detectable compound.
  • Multiple click chemistry reactions are known in the art (see, e.g., Lang and Chin (2014)).
  • any protein can be expressed in the engineered bacterium described herein to incorporate a nonstandard amino acid.
  • the protein is a secreted protein.
  • the protein is a non-secreted protein.
  • the protein is a membrane protein.
  • the protein is a cytosolic protein.
  • the protein is a nuclear protein.
  • the protein is an enzyme.
  • the protein is an extracellular matrix protein.
  • the protein is a bio film protein.
  • the protein is a fiber protein (e.g., a curli fiber protein).
  • the protein is a pilin protein.
  • the protein is CsgA.
  • CsgA is the major structural subunit of curli.
  • the sequences of CsgA and its homologs are known in a number of species, e.g., E. coli (NCBI Gene ID NO: 949055; NCBI Ref Seq: NP_415560).
  • E. coli NCBI Gene ID NO: 949055; NCBI Ref Seq: NP_415560.
  • the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA.
  • the protein is Trat.
  • TraT is an outer membrane lipoprotein encoded by the tra operon.
  • the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type TraT.
  • the protein is InaV. In some embodiments, the protein is InaV and the nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
  • the protein is maltose binding protein (MBP).
  • MBP maltose binding protein
  • the protein is MBP and the nonstandard amino acid is located at an amino acid residue corresponding to residue 67 of wild-type MBP.
  • the protein expressed by the engineered bacterium described herein comprises a polypeptide tag.
  • the protein comprises more than one polypeptide tag.
  • the protein comprises two, three, four, or more polypeptide tags. Multiple polypeptide tags are known in the art and can be used as described herein. Exemplary polypeptide tags for use in the methods described herein include, but are not limited to, the polypeptide tags shown in Table 1.
  • the polypeptide tag is at the N-terminus of the protein.
  • the polypeptide tag is at the C-terminus of the protein.
  • the polypeptide tag is located between two domains of the protein.
  • V5 G PIPNPLLGLDST (SEQ ID NO: 1 1 )
  • the protein expressed by the engineered bacterium described herein comprises a polypeptide linker.
  • the polypeptide linker is one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, twenty-five, thirty, thirty- five, forty, forty-five, fifty, or more amino acids in length.
  • the polypeptide linker is twelve, twenty-four, thirty-six, forty-eight, sixty, seventy-two, eighty- four, or ninety-six amino acids in length.
  • the polypeptide linker is N- terminus of the protein.
  • the polypeptide linker is C-terminus of the protein. In some embodiments, the polypeptide linker is located between a domain of the protein and a polypeptide tag. In some embodiments, the polypeptide linker is located between two domains of the protein. In some embodiments, the polypeptide linker is flexible. In some embodiments, the polypeptide linker is rigid. In some embodiment, the polypeptide linker comprises a nonstandard amino acid.
  • Plasmids for use as described herein can include, but are not limited to, pEVOL (see Young et al.
  • the promoter is a constitutive promoter. In some embodiments, the promoter is an inducible promoter.
  • An “inducible promoter” may be one that is characterized by initiating or enhancing transcriptional activity when in the presence of, influenced by, or contacted by an inducer or inducing agent than when not in the presence of, under the influence of, or in contact with the inducer or inducing agent.
  • An “inducer” or “inducing agent” may be endogenous, or a normally exogenous compound or protein that is
  • the inducer or inducing agent e.g., a chemical, a compound or a protein
  • the inducer or inducing agent can itself be the result of transcription or expression of a nucleic acid sequence (e.g., an inducer can be a transcriptional repressor protein), which itself may be under the control or an inducible promoter.
  • Non-limiting examples of inducible promoters include but are not limited to, the lac operon promoter, a nitrogen- sensitive promoter, an IPTG-inducible promoter, a salt-inducible promoter, tetracycline-inducible promoter, the lambda phage pL promoter, steroid-responsive promoters, rapamycin responsive promoters and the like.
  • Inducible promoters for use in prokaryotic systems are well known in the art, see, e.g. the ⁇ -lactamase and lactose promoter systems (Chang et al. (1978) Nature 275: 615, which is incorporated herein by reference; Goeddel et al.
  • An inducible promoter useful in the methods and systems as disclosed herein can be induced by one or more physiological conditions, such as changes in pH, temperature, radiation, osmotic pressure, saline gradients, cell surface binding, and the concentration of one or more extrinsic or intrinsic inducing agents.
  • the extrinsic inducer or inducing agent may comprise amino acids and amino acid analogs, saccharides and polysaccharides, nucleic acids, protein transcriptional activators and repressors, cytokines, toxins, petroleum-based compounds, metal containing compounds, salts, ions, enzyme substrate analogs, hormones, and combinations thereof.
  • the inducible promoter is activated or repressed in response to a change of an environmental condition, such as the change in concentration of a chemical, metal, temperature, radiation, nutrient or change in pH.
  • an inducible promoter useful in the methods and systems as disclosed herein can be a phage inducible promoter, nutrient inducible promoter, temperature inducible promoter, radiation inducible promoter, metal inducible promoter, hormone inducible promoter, steroid inducible promoter, and/or hybrids and combinations thereof.
  • Appropriate environmental inducers can include, but are not limited to, exposure to heat (i.e., thermal pulses or constant heat exposure), various steroidal compounds, divalent cations (including Cu 2+ , Ca 2+ , and Zn 2+ ), galactose, arabinose, anhydrotetracycline (ATc), tetracycline, IPTG (isopropyl-P-D thiogalactoside), as well as other naturally occurring and synthetic inducing agents and gratuitous inducers.
  • heat i.e., thermal pulses or constant heat exposure
  • various steroidal compounds including Cu 2+ , Ca 2+ , and Zn 2+
  • galactose including Cu 2+ , Ca 2+ , and Zn 2+
  • galactose arabinose
  • tetracycline tetracycline
  • IPTG isopropyl-P-D thiogalactoside
  • Inducible promoters useful in the methods and systems as disclosed herein also include those that are repressed by "transcriptional repressors” that are subject to inactivation by the action of environmental, external agents, or the product of another gene. Such inducible promoters may also be termed “repressible promoters” where it is required to distinguish between other types of promoters in a given module or component of the biological switch converters described herein. Preferred repressors for use in the present invention are sensitive to inactivation by physiologically benign agent.
  • a lac repressor protein is used to control the expression of a promoter sequence that has been engineered to contain a lacO operator sequence
  • treatment of the host cell with IPTG will cause the dissociation of the lac repressor from the engineered promoter containing a lacO operator sequence and allow transcription to occur.
  • tet repressor is used to control the expression of a promoter sequence that has been engineered to contain a tetO operator sequence
  • treatment of the host cell with tetracycline, or the tetracycline analog anhydrotetracycline (ATc) will cause the dissociation of the tet repressor from the engineered promoter and allow transcription of the sequence downstream of the engineered promoter to occur.
  • Bacteria for use in the methods and compositions described herein can be of any species.
  • the bacteria are of a species and/or strain which is amenable to culture and genetic manipulation.
  • the bacterium is a gram-positive bacterium.
  • the bacterium is a gram-negative bacterium.
  • the bacterium is a probiotic.
  • the bacterium is Generally Recognized as Safe (GRAS) by a regulatory authority.
  • the bacterium is pathogenic.
  • the bacterium is non-pathogenic.
  • the bacterium is an attenuated pathogenic bacterium.
  • the parental strain of the bacterium used herein is of a strain optimized for protein expression.
  • Non- limiting examples of bacterial species and strains suitable for use in the present technologies include Escherichia coli, E. coli BL21, E. coli Tuner, E. coli Rosetta, E. coli JMlOl, and derivatives of any of the foregoing.
  • the bacterium is of the E. coli Nissle 1917 strain.
  • Other non-pathogenic bacterial strains known to those of skill in the art such as MG1655, K12-derived strains, and the like, may also be used.
  • the parental strains of the bacterium described herein is optimized for use with an orthogonal translation system.
  • the bacterium is genetically modified (e.g., recoded) to reduce or eliminate a codon that is specifically recognized by the orthogonal translation system. Any codon may be reduced or eliminated from the genome of a bacterium described herein using methods known in the art.
  • the bacterium is genetically modified (e.g., recoded) to reduce or eliminate the TGA codon (see, e.g., Lajoie et al. (2013) Science 342(6156):357-60.
  • the bacterium is genetically modified (e.g., recoded) to reduce the codon TGA in the bacterial genome. In some embodiments, the bacterium is genetically modified (e.g., recoded) to eliminate the codon TGA in the bacterial genome. In some embodiments, the bacterium for use in the present invention comprise a deletion in the gene encoding peptide chain release factor 1 or a homo log thereof. In some embodiments, the bacterium for use in the present invention comprise a deletion of the prfA gene (see, e.g., Lajoie et al. (2013)). In some embodiments, the bacterium is of the Escherichia coli strain C321 (Addgene bacterial strain #48999).
  • the bacterium is of the Escherichia coli strain C321.AA (Addgene bacterial strain #48998). In some embodiments, the bacterium is of the Escherichia coli strain C321.AA.exp (Addgene bacterial strain #49018). [00157] In some embodiments, the bacterium for use in the present invention comprise a deletion of the endogenous gene encoding the protein in which a nonstandard amino acid is being incorporated. In some embodiments, the bacterium comprises a deletion in the csgA gene. In some embodiment, the bacterium comprises a deletion of a curli operon. In some embodiments, the bacterium comprises a deletion of one or more endogenous Csg genes.
  • the bacterium comprises a deletion of csgA. In some embodiments, the bacterium comprises a deletion of csgB. In some embodiments, the bacterium comprises a deletion of csgC. In some embodiments, the bacterium comprises a deletion of csgD. In some embodiments, the bacterium comprises a deletion of csgE. In some embodiments, the bacterium comprises a deletion of csgF. In some embodiments, the bacterium comprises a deletion of csgG. In some embodiments, the bacterium comprises a deletion of the csgBAC operon. In some embodiments, the bacterium comprises a deletion of the csgDEFG operon.
  • the bacterium comprises a deletion of the csgBAC and csgDEFG operons. In some embodiments, the bacterium comprises a deletion in the inaV gene. In some embodiments, the bacterium comprises a deletion in the traT gene. In some embodiments, the bacterium comprise a deletion in the malE gene.
  • biofilms comprising the engineered bacterium described herein are also provided.
  • the bio film comprises an engineered bacterium described herein and a protein comprising a nonstandard amino acid expressed by an engineered bacterium described herein.
  • the bio film comprises a protein comprising a nonstandard amino acid expressed by an engineered bacterium described herein.
  • the bio film comprises a bacterium ⁇ e.g., an engineered bacterial cell described herein).
  • the bio film does not comprise a bacterium ⁇ e.g., an engineered bacterial cell described herein).
  • the bio film comprises a curli fiber composed of bacterial extracellular matrix protein having a nonstandard amino acid. In some embodiments, the biofilm comprises curli fiber comprising CsgA protein having a nonstandard amino acid. In some embodiments, the nonstandard amino acid has been reacted with a detectable compound or drug as described herein.
  • compositions comprising the engineered bacterium described herein may be used to diagnose, treat, manage, ameliorate, and/or prevent a disease or disorder, as described herein
  • Pharmaceutical compositions comprising one or more engineered bacteria, alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided.
  • the pharmaceutical composition comprises one species, strain, or subtype of bacteria that are engineered to comprise the genetic modifications described herein, e.g. , to express at least one orthogonal translation system and at least one protein comprising a nonstandard amino acid.
  • the pharmaceutical composition comprises two or more species, strains, and/or subtypes of bacteria that are each engineered to comprise the genetic modifications described herein, e.g. , to express at least one orthogonal translation system and at least one protein comprising a nonstandard amino acid.
  • compositions described herein may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into
  • compositions for pharmaceutical use are known in the art (see, e.g., "Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, PA).
  • the pharmaceutical compositions are subjected to tableting, lyophilizing, direct compression, conventional mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping, or spray drying to form tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated.
  • Appropriate formulation depends on the route of
  • the engineered bacteria described herein may be formulated into pharmaceutical compositions in any suitable dosage form (e.g. , liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration) and for any suitable type of administration (e.g. , oral, topical, injectable, immediate-release, pulsatile-release, delayed-release, or sustained release).
  • suitable dosage amounts for the engineered bacteria may range from about 10 5 to 10 12 bacteria, e.g. , approximately 10 5 bacteria, approximately 10 6 bacteria, approximately 10 7 bacteria, approximately 10 8 bacteria, approximately 10 9 bacteria, approximately 10 10 bacteria,
  • the composition may be administered once or more daily, weekly, or monthly.
  • the engineered bacterium may be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, nanoparticles, liposomes, penetration enhancers, carrier compounds, and other
  • any one of the detectable compound, inducer, and/or nonstandard amino acid may also be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, nanoparticles, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents.
  • the pharmaceutical composition may include, but is not limited to, the addition of calcium bicarbonate, sodium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
  • the engineered bacterium may be administered and formulated as neutral or salt forms.
  • Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • the engineered bacterium disclosed herein may be administered topically and formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well-known to one of skill in the art. See, e.g.,
  • viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity greater than water are employed.
  • suitable formulations include, but are not limited to, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, etc., which may be sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, e.g. , osmotic pressure.
  • Suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g. , a gaseous propellant, such as freon) or in a squeeze bottle.
  • a pressurized volatile e.g. , a gaseous propellant, such as freon
  • Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms. Examples of such additional ingredients are well known in the art.
  • compositions disclosed herein may be administered orally and formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc.
  • Pharmacological compositions for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores.
  • Suitable excipients include, but are not limited to, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol;
  • cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium
  • carbomethylcellulose and/or physiologically acceptable polymers such as
  • PVP polyvinylpyrrolidone
  • PEG polyethylene glycol
  • Disintegrating agents may also be added, such as cross-linked polyvinylpyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate.
  • Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g. , pregelatinised maize starch,
  • polyvinylpyrrolidone hydroxypropyl methylcellulose, carboxymethylcellulose, polyethylene glycol, sucrose, glucose, sorbitol, starch, gum, kaolin, and tragacanth
  • fillers e.g. , lactose, microcrystalline cellulose, or calcium hydrogen phosphate
  • lubricants e.g.
  • the tablets may be coated by methods well known in the art.
  • a coating shell may be present, and common membranes include, but are not limited to, polylactide, polyglycolic acid, polyanhydride, other biodegradable polymers, alginate- polylysine-alginate (APA), alginate-polymethylene-co-guanidine-alginate (A-PMCG-A), hydro ymethylacry late- methyl methacrylate (HEMA-MMA), multilayered HEMA-MMA- MAA, polyacrylonitrilevinylchloride (PAN-PVC), acrylonitrile/sodium methallylsulfonate (AN-69), polyethylene glycol/poly pentamethylcyclopentasiloxane/polydimethylsiloxane (PEG/PD5/PDMS), poly N,N- dimethyl acrylamide (PDMAAm), siliceous encapsulates, cellulose sulphate/sodium alginate/polymethylene-co-guanidine (CS/A/PMCG),
  • polymethacrylates polyamino acids, and enteric coating polymers.
  • the pharmaceutical compositions may be enterically coated for release into the gut or a particular region of the gut, for example, the large intestine.
  • the typical pH profile from the stomach to the colon is about 1-4 (stomach), 5.5-6 (duodenum), 7.3-8.0 (ileum), and 5.5-6.5 (colon).
  • the pH profile may be modified.
  • the coating is degraded in specific pH environments in order to specify the site of release. In some embodiments, at least two coatings are used. In some
  • the outside coating and the inside coating are degraded at different pH levels.
  • Liquid preparations for oral administration may take the form of solutions, syrups, suspensions, or a dry product for constitution with water or other suitable vehicle before use.
  • Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable agents such as suspending agents (e.g. , sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid).
  • the preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate.
  • Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of the engineered bacterium described herein.
  • the pharmaceutical composition is formulated for intraintestinal administration, intrajejunal administration, intraduodenal administration, intraileal administration, gastric shunt administration, or intracolic administration, via nanoparticles, nanocapsules, microcapsules, or microtablets, which are enterically coated or uncoated.
  • the pharmaceutical compositions may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g. , conventional suppository bases such as cocoa butter or other glycerides.
  • the compositions may be suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain suspending, stabilizing and/or dispersing agents.
  • compositions described herein may be administered intranasally, formulated in an aerosol form, spray, mist, or in the form of drops, and conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant (e.g. , dichlorodifluoromethane,
  • Pressurized aerosol dosage units may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges e.g. , of gelatin
  • suitable powder base such as lactose or starch.
  • the pharmaceutical compositions may be administered and formulated as depot preparations. Such long acting formulations may be administered by implantation or by injection, including intravenous injection, subcutaneous injection, local injection, direct injection, or infusion.
  • compositions may be formulated with suitable polymeric or hydrophobic materials (e.g. , as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (e.g., as a sparingly soluble salt).
  • suitable polymeric or hydrophobic materials e.g. , as an emulsion in an acceptable oil
  • ion exchange resins e.g., as an emulsion in an acceptable oil
  • sparingly soluble derivatives e.g., as a sparingly soluble salt
  • Single dosage forms may be in a liquid or a solid form.
  • Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration.
  • a single dosage form may be administered in bolus form, e.g. , single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, lozenge, etc.
  • bolus form e.g. , single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, lozenge, etc.
  • a single dosage form may be administered over a period of time, e.g. , by infusion.
  • Single dosage forms of the pharmaceutical composition may be prepared by portioning the pharmaceutical composition into smaller aliquots, single dose containers, single dose liquid forms, or single dose solid forms, such as tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated.
  • a single dose in a solid form may be reconstituted by adding liquid, typically sterile water or saline solution, prior to administration to a patient.
  • the composition can be delivered in a controlled release or sustained release system.
  • a pump may be used to achieve controlled or sustained release.
  • polymeric materials can be used to achieve controlled or sustained release of the therapies of the present disclosure (see e.g. , U.S. Patent No. 5,989,463).
  • polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly( methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N- vinyl pyrrolidone), poly( vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters.
  • the polymer used in a sustained release formulation may be inert, free of leachable impurities, stable on storage, sterile, and biodegradable.
  • a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose. Any suitable technique known to one of skill in the art may be used.
  • an engineered bacterium disclosed herein comprising a protein having a nonstandard amino acid.
  • the engineered bacterium described herein comprise a protein having a nonstandard amino acid, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the engineered bacterium can be exposed to a labeling reagent or detectable compound also having a bioorthogonal reactive functional group that will react the bioorthogonal reactive functional group of the nonstandard amino acid.
  • methods for labeling a protein having a nonstandard amino acid expressed by an engineered bacterium described herein are provided.
  • the protein comprises a nonstandard amino acid, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group.
  • the protein can be reacted with a labeling reagent or detectable compound having a bioorthogonal reactive functional group to attach the labeling reagent or detectable compound to the bioorthogonal reactive functional group of the nonstandard amino acid.
  • the method is performed in vitro. In some embodiments, the method is performed in vivo.
  • the method comprises administering to the subject an engineered bacterium having a protein comprising at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein, thereby labeling the engineered bacterium in the subject in vivo.
  • the labeling reagent or detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, or a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent.
  • the labeling reagent or detectable compound comprises a drug delivery vehicle selected from the group consisting of a nanocarrier (e.g., a polymer), a nanoparticle (e.g., a metal gold, silver, or iron
  • the labeling reagent or detectable compound comprises a bioorthogonal reactive functional group selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a hydrazine moiety, a tetrazine moiety, a norbornene moiety and a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a ketone moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a hydrazine moiety or a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises an azide moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises an alkyne moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises an alkyne moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises an azide moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a tetrazine moiety
  • the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a norbornene moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a norbornene moiety
  • the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a tetrazine moiety.
  • the labeling reagent or detectable compound is a detectable or traceable compound.
  • the labeling reagent or detectable compound is selected from the group consisting of a fluorescent moiety, a radioactive moiety, a
  • labeling reagents or detectable compounds include, but are not limited to, radioisotopes, dyes, enzymes, contrast agents, fluorescent compounds or molecules such as a fluorescent dye, MRI contrast agents (e.g. , paramagnetic ions such as Gadolinium(III)-based MRI contrast agents, , superparamagnetic iron oxide (SPIO) and ultrasmall
  • F-based contrast agents such as [ F] maltose, [ F]-maltohexaose and [ F]2- fluorodeoxysorbitol (FDS) and 64 Cu-based contrast agents
  • CT contrast agents e.g., iodine- based contrast agents
  • ultrasound contrast agents and small molecules including both inorganic and organic small molecules.
  • the labeling reagent or detectable compound may include any suitable label or detectable group detectable by optical, spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means including but not limited to biotin, dyes, fluorophores, antigens, porphyrins, chromophores, and radioactive isotopes. Diagnostic agents include, but are not limited to, radiolabels
  • radioacoustic labels e.g., S, 1, P, H, C
  • enzyme labels e.g. , horseradish peroxidase, alkaline phosphatase
  • gold beads e.g., gold beads
  • chemiluminescence labels e.g. , ligands (e.g. , biotin, digoxin) and/or fluorescence labels (e.g.
  • rhodamine phycoerythrin, fluorescein, fluorescent proteins
  • a fluorescent protein including, but not limited to, a green fluorescent protein or one of its many modified forms, energy absorbing and energy emitting agents, fluorescent dyes (e.g., fluorescein, fluorescein-isothiocyanate (FITC), Texas red, rhodamine, green fluorescent protein, enhanced green fluorescent protein, lissamine, phycoerythrin, near-IR dye, Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX (Amersham), and SyBR Green I & II (Molecular Probes)), chemiluminescent groups, and chromogenic agents.
  • fluorescent dyes e.g., fluorescein, fluorescein-isothiocyanate (FITC), Texas red, rhodamine, green fluorescent protein, enhanced green fluorescent protein, lissamine, phycoerythrin, near-IR dye, Cy2, Cy3, Cy3.5, Cy5, Cy
  • the labeling reagent or detectable compound comprises a dibenzocyclooctyne group (DBCO).
  • the labeling reagent or detectable compound is selected from the group consisting of BDP-FL-PEG4-DBCO, DBCO-PEG4-5/6-FAM, DBCO-PEG4-ATTO-488, DBCO-PEG4-5/6-Carboxyrhodamine 110, DBCO-PEG4-5/6-TAMRA, DBCO-Sulfo-Cy3, DBCO-5/6-Sulforhodamine B, DBCO-PEG4-5/6-Sulforhodamine B, DBCO-5/6-Texas Red, DBCO-PEG4-5/6-Texas Red, DBCO-Sulfo-Cy5, DBCO-Cy5.5, DBCO-Cy7.
  • BDP-FL-PEG4-DBCO DBCO-PEG4-5/6-FAM
  • DBCO-PEG4-ATTO-488
  • the labeling reagent or detectable compound is dibenzyl cyclooctyne- conjugated Cy5 (DBCO-Cy5). In some embodiments, the labeling reagent or detectable compound is dibenzyl cyclooctyne-conjugated Cy3 (DBCO-Cy3).
  • Methods for detection of the detectable compound include, for example, microscopy (e.g., confocal microscopy), x-rays, ultrasound, X-ray computed tomography (CT), magnetic resonance imaging (MRI), positron emission tomography (PET) scan, ultrasound imaging (tomography), optical imaging, scintigraphy (including PET scintigraphy and gamma scintigraphy), and near infrared imaging.
  • microscopy e.g., confocal microscopy
  • CT computed tomography
  • MRI magnetic resonance imaging
  • PET positron emission tomography
  • PET positron emission tomography
  • optical imaging e.g., positron emission tomography
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby detecting the distribution of the engineered bacterium in the subject.
  • the engineered bacterium is administered to the gastrointestinal tract of the subject. In some embodiments, the engineered bacterium is administered to the respiratory tract of the subject. In some embodiments, the engineered bacterium is administered to the circulatory system of the subject. In some embodiments, the engineered bacterium is administered to an organ or tissue selected from the group consisting of mouth, esophagus, heart, lung, stomach, small intestine, large intestine, rectum, anal canal, hair, and skin. In some embodiments, the engineered bacterium is administered to specifically target a lesion in the subject. In some embodiments, the engineered bacterium senses changes in the local gut environment that indicates a disease or disorder.
  • the biofilm comprises a protein having a nonstandard amino acid that is secreted by the engineered bacterium.
  • the biofilm comprises an engineered bacterium disclosed herein.
  • the biofilm comprises a protein having a nonstandard amino acid produced by the engineered bacterium disclosed herein (e.g., CsgA).
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby determining the distribution of the biofilm produced by the engineered bacterium in the subject.
  • the biofilm is present in the gastrointestinal tract of the subject.
  • the biofilm is present in the respiratory tract of the subject. In some embodiments, the biofilm is present in the circulatory system of the subject. In some embodiments, the biofilm is present in an organ or tissue selected from the group consisting of mouth, esophagus, lung, heart, stomach, small intestine, large intestine, rectum, anal canal, hair, and skin.
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid, thereby delivering the drug to the subject.
  • any drug comprising a bioorthogonal reactive functional group that reacts with a bioorthogonal reactive functional group of the nonstandard amino acid may be used.
  • the drug comprises a drug delivery vehicle selected from the group consisting of a nanocarrier (e.g., a polymer), a nanoparticle (e.g. , a metal gold, silver, or iron nanoparticle), a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein.
  • the bioorthogonal reactive functional group may be present on the drug delivery vehicle.
  • the drug comprises a bioorthogonal reactive functional group selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a hydrazine moiety, a tetrazine moiety, a norbornene moiety and a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a ketone moiety
  • the bioorthogonal reactive functional group of the drug comprises a hydrazine moiety or a hydroxylamine moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises an azide moiety, and the bioorthogonal reactive functional group of the drug comprises an alkyne moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises an alkyne moiety, and the bioorthogonal reactive functional group of the drug comprises an azide moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a tetrazine moiety, and the bioorthogonal reactive functional group of the drug comprises a norbornene moiety.
  • the bioorthogonal reactive functional group of the nonstandard amino acid comprises a norbornene moiety
  • the bioorthogonal reactive functional group of the drug comprises a tetrazine moiety.
  • the drug is selected from the group consisting of a nonsteroidal ant i- inflammatory drug (NSAID), a steroidal ant i- inflammatory drugs, an antifungal drugs, a detoxifying drug, an analgesics, a bronchodilator, an antibiotic, a monoclonal antibody, a diuretic, an immunosuppressant, a lymphokine, a hormone and a calcium channel blocker.
  • NSAID nonsteroidal ant i- inflammatory drug
  • an antifungal drugs a detoxifying drug
  • an analgesics a bronchodilator
  • an antibiotic a monoclonal antibody
  • a diuretic an immunosuppressant
  • a lymphokine a hormone and a calcium channel blocker.
  • the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby diagnosing the disease or disorder in the subject.
  • the disease or disorder is a gastrointestinal disease or disorder. In some embodiments, the disease or disorder is a respiratory disease or disorder. In some embodiments, the disease or disorder is an autoimmune disease or disorder. In some embodiments, the disease is an infectious disease. In some embodiments, the disease or disorder is a proliferative disease or disorder. In some embodiments, the disease or disorder is cancer. In some embodiments, the disease or disorder is a precancerous lesion. In some embodiments, the disease or disorder is an inflammatory disease or disorder.
  • the disease or disorder is selected from the group consisting of cystic fibrosis, congestive heart failure, benign prostatic hyperplasia, a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, non-ulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction, Crohn's disease, ulcerative colitis, and inflammatory bowel disease.
  • the subject is an animal. In some embodiments, the subject is a mammal. In some embodiments, the subject is a domesticated animal. In some embodiments, the subject is a ruminant. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a human subject.
  • the method may comprise preparing a pharmaceutical composition with at least one genetically engineered species, strain, or subtype of bacteria described herein, and administering the pharmaceutical composition to a subject in a therapeutically effective amount.
  • the engineered bacteria disclosed herein are administered orally, e.g., in a liquid suspension.
  • the engineered bacteria are lyophilized in a gel cap and administered orally.
  • the engineered bacteria are administered via a feeding tube or gastric shunt.
  • the engineered bacteria are administered rectally, e.g., by enema.
  • the engineered bacteria are administered topically, intraintestinally, intrajejunally,
  • intraduodenally intraileally, and/or intracolically.
  • the methods disclosed herein may comprise administration of a composition alone or in combination with one or more additional therapies, e.g., chemotherapy.
  • the pharmaceutical composition may be administered alone or in combination with one or more additional therapeutic agents.
  • An important consideration in the selection of the one or more additional therapeutic agents is that the agent(s) should be compatible with the bacteria, e.g., the agent(s) must not interfere with or kill the bacteria.
  • compositions comprising the engineered bacterium described herein may be administered to a subject, and a period of time is allowed to lapse in order to allow the bacterium to engraft and/or colonize in the subject (e.g., in the subject's gastrointestinal tract, skin and/or respiratory tract). Thereafter, any intervention using the methods described herein may be used.
  • nonstandard amino acid it may be necessary to administer a nonstandard amino acid to the subject that can be used by the orthogonal translation systems described herein to incorporate the nonstandard amino acid into the protein expressed by the engineered bacterium.
  • the nonstandard amino acid is administered in a pharmaceutical composition.
  • the nonstandard amino acid is administered to the subject as part of a nutritional product.
  • the nonstandard amino acid is administered orally, intravenously, intradermally or rectally.
  • the nonstandard amino acid is administered to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group. In some embodiments, the nonstandard amino acid is administered to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
  • an agent i.e., an inducer
  • the inducer will activate the expression of one or more of the orthogonal translation system and the heterologous gene encoding the protein of interest.
  • the inducer is administered in a pharmaceutical composition.
  • the inducer is administered to the subject as part of a nutritional product.
  • the inducer is administered orally, intravenously, intradermally or rectally.
  • the inducer is administered to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group. In some embodiments, the inducer is administered to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
  • both an inducer and a nonstandard amino acid are administered to the subject.
  • the inducer is administered to the subject concurrently with the nonstandard amino acid.
  • the inducer is administered the subject after the nonstandard amino acid is administered to the subject.
  • the inducer is administered before the nonstandard amino acid is administered to the subject.
  • the inducer and the nonstandard amino acid are administered in the same dosage form.
  • the inducer and the nonstandard amino acid are administered in separate dosage forms.
  • the inducer and the nonstandard are administered concurrently to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a
  • the inducer and the nonstandard amino acid are administered concurrently to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
  • an inducer, a nonstandard amino acid and a detectable agent are administered to the subject.
  • the inducer is administered to the subject concurrently with the non standard amino acid, followed by administration of the detectable agent to the subject.
  • the inducer is administered to the subject concurrently with the detectable agent, followed by administration of the nonstandard amino acid.
  • the nonstandard amino acid is administered concurrently with the detectable agent, followed by administration of the inducer.
  • the inducer, the nonstandard amino acid and the detectable agent are administered separately.
  • two or more of the inducer, the nonstandard amino acid and the detectable agent are administered in the same dosage form.
  • the inducer, the nonstandard amino acid and the detectable agent are administered in separate dosage forms.
  • Example 1 Generation of engineered bacteria expressing proteins comprising the nonstandard amino acid ?-AzF
  • Engineered heterologous nucleic acids expressing proteins comprising InaV, Trat, CsgA (as part of a synthetic curli csgBACEFG operon, which excludes the gene encoding the regulatory protein csgD), and MBP were cloned in pBbB8k plasmids, under the control of arabinose-inducible promoters. The proteins were cloned to incorporate a poly-histidine tag that allowed for affinity purification. Plasmid maps of engineered proteins are shown in Figures 1A and IB. Table 2 lists the DNA sequences of engineered proteins. Table 2. Sequences of engineered proteins containing the nonstandard amino acid p- AzF.
  • All proteins contain a poly-His tag (a 12 amino acid flexible linker followed by a 6X His tag).
  • p-AzF inserted in a linker are placed just after the 6 histidine tag, and before a 36 or 48 amino acid flexible linker and a myc Tag. The position of p-AzF amino acid residue(s) is indicated with a " :
  • WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI
  • WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI
  • E. coli Nissle (ECN) 1917 strain comprising a knockout of the csgBAC and csgDEFG operons was developed using the lambda red system.
  • ECN E. coli Nissle
  • pBbB8k plasmids containing the whole synthetic curli operon csgBACEFG operon
  • the knockout of the native curli operons allows for clear assessment of recombinant curli fibers production.
  • the developed curli operons knockout strain was used for all experiments described in Examples 2 - 8 below.
  • Bacterial cells were transformed with a pBbB8k plasmid encoding the engineered proteins above by inserting a TAG codon at the corresponding nucleotide location in the open reading frame of the protein, and with the plasmid pEVOL-pAzF (a gift from Peter Schultz (Addgene plasmid # 31186)) which encodes an orthogonal translation system that incorporates p-AzF into proteins encoded by nucleic acids having the TAG codon.
  • pEVOL-pAzF a gift from Peter Schultz (Addgene plasmid # 31186)
  • Engineered ECN were grown in 3 to 5 mL of Luria broth (LB) with the appropriate antibiotics (kanamycin for pBbB8k plasmids only, or kanamycin and
  • spectinomycin for pBbB8k and pEVOL-pAzF plasmids overnight at 37°C.
  • Fresh cultures were inoculated by diluting the overnight culture 100 times in fresh LB with the appropriate antibiotic, and the cultures were grown at 37° C to an optical density at 600 nm (OD600) of 0.6 to 0.7. The cultures were then induced with 0.01 to 0.2 % arabinose (inducer) overnight.
  • p-AzF was added to the cultures to a final concentration ranging between 0.1 to 5 mM. The cells were then pelleted, resuspended in lysis buffer and sonicated to complete the lysis.
  • Example 2 Maltose-binding protein (MBP) comprising the nonstandard amino acid p- AzF was expressed and purified from E. coli Nissle 1917
  • Example 1 three different bacterial cells were used: cells transformed with a single plasmid to express wild-type MBP (without a nonstandard amino acid), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS”). 0.05% arabinose was added as an inducer to induce the production of the orthogonal translation system and of MBP.
  • p-AzP was not added to the culture media of the bacteria of the first group ⁇ i.e., No mutation/No OTS and UAG mutation/With OTS). However, p-AzF was added at a final concentration of 1 mM to the culture media of the bacteria of the remaining two groups ⁇ i.e., No mutation/With OTS and UAG mutation/With OTS) at the time of induction. As shown in Figure 3, E.
  • coli Nissle comprising an orthogonal translation system encoded by the plasmid pEVOL-pAzF, and a heterologous nucleic acid encoding MBP protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells without needing to recode the bacterial genome to remove the used labeling codon (TAG).
  • TAG used labeling codon
  • Example 3 MBP comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle was labeled with DBCO-Cy5
  • MBP comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle could successfully be reacted with a detectable moiety (DBCO-Cy5).
  • MBP expression and purification was performed as described in Examples 1 and 2.
  • DBCO-Cy5 dye For labeling of proteins with DBCO-Cy5, the purified protein eluates were incubated for 1 hour at room temperature with DBCO-Cy5 dye at molar ratios ranging between 1: 10 to 10: 1 MBP:DBCO-Cy5. Labeling reactions were run on SDS- PAGE gels and Cy5 fluorescence was detected using a FluorChem M System.
  • MBP comprising /?-AzF can be successfully reacted with DBCO-Cy5 to label the protein. Further, very little background incorporation of p-AzP into endogenous E. coli proteins appears to have occurred, as determined by analyzing the background fluorescence in cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("No
  • E. coli Nissle could successfully used to express an operon comprising a heterologous gene encoding CsgA comprising the non-standard amino acid p-Az ⁇ .
  • three different bacterial cells were used: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS”); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS”); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
  • p- zF was not added to the culture media of the bacteria of the first group ⁇ i.e., No mutation/No OTS and UAG mutation/With OTS). However, p- zF was added at a final concentration of 1 mM to the culture media of the bacteria of the remaining two groups ⁇ i.e., No mutation/With OTS and UAG mutation/With OTS) at the time of induction. As shown in Figure 5, E.
  • coli Nissle comprising an orthogonal translation system encoded by the plasmid pEVOL-pAzF, and a heterologous nucleic acid encoding the synthetic curli operon, which encodes the CsgA protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells.
  • a heterologous nucleic acid encoding the synthetic curli operon, which encodes the CsgA protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells.
  • Example 5 CsgA comprising the nonstandard amino acid ⁇ - ⁇ purified from in E. coli Nissle was labeled with DBCO-Cy5
  • CsgA comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle could successfully be reacted with a detectable moiety (DBCO-Cy5).
  • CsgA expression and purification was performed as described in Examples 1 and 2.
  • DBCO-Cy5 concentrated 500 mM eluates of the purified protein were incubated for 1 hour at room temperature with DBCO-Cy5 dye at a molar excess of DBCO-Cy5 to MBP. Labeling reactions were run on SDS-PAGE gels and Cy5 fluorescence was detected using a FluorChem M System.
  • CsgA comprising p-AzP can be successfully reacted with DBCO-Cy5 to label the protein. Further, the apparent higher background staining observed could be due to the low CsgA concentration loaded onto the SDS-PAGE gel.
  • Example 6 CsgA comprising the nonstandard amino acid ?-AzF expressed in E. coli Nissle 1917 forms curli fibers
  • the membranes were then washed in water, and the solvent was gradually exchanged to ethanol with an increasing ethanol 15 minute incubation step gradient (25 %, 50 %, 75 % and 100 % (v/v) ethanol).
  • the membranes were dried in a critical point dryer and sputtered until they were coated in a 5 nm layer of Pt/Pd. Imaging was performed using a Zeiss Ultra 55 Field Emission SEM. As shown in Figure 9, no curli fiber production was observed in cells expressing MBP as expected, since the strain of E. coli Nissle has a deletion of the endogenous curli operons.
  • DBCO-Cy5 could be varied by administering less p-AzP to the cultured cells. As shown in Figure 13, when cells were grown in media containing varying concentrations of the nonstandard amino acid, lower concentrations of p-AzP resulted in a smaller fraction of labeled fibers after incubation with DBCO-Cy5.
  • Example 7 Growth of engineered E. coli Nissle to express proteins having a
  • E. coli Nissle was grown in a deep- well 96 well plate, and arabinose, /?-AzF, or arabinose and /?-AzF were added to the culture media at an OD600 of ⁇ 0.2. Growth curves of E. coli Nissle cells either: lacking plasmid ("No plasmid"); comprising an orthogonal translation system
  • Example 8 TraT was expressed and purified from E. coli Nissle 1917
  • Example 9 In vivo labeling of engineered bacteria
  • the number of recombinant proteins produced per cell is in the order of 10 6 proteins/cells (approximately the same number of available bioorthogonal reactive functional groups (i.e., azide moieties) per cell).
  • concentration of the bioorthogonal reactive functional group azide in the gut of a mouse could range between tens of nM to
  • mice For in vivo studies, 6-8 week old female mice are administered selection marker antibiotics (e.g., kanamycin and spectinomycin; 1 g/L in drinking water), to maintain the plasmids of the engineered bacteria, continuously during the course of the experiment beginning 24 hours prior to administration of the engineered bacteria.
  • selection marker antibiotics e.g., kanamycin and spectinomycin; 1 g/L in drinking water
  • the mice are divided into four separate groups: one experimental group and three control groups.
  • mice of control group 1 are administered engineered bacteria (as described, for example in Example 1 above) and a detectable compound (e.g., DBCO-Cy5), but will not receive inducer (e.g., arabinose, to induce the expression of the protein comprising /?-AzF and the expression of the orthogonal translation system) nor the nonstandard amino acid (e.g. , p-AzF).
  • inducer e.g., arabinose, to induce the expression of the protein comprising /?-AzF and the expression of the orthogonal translation system
  • nonstandard amino acid e.g. p-AzF
  • mice of control group 2 are administered detectable compound, but will not be administered engineered bacteria, inducer, nor nonstandard amino acid.
  • mice of control group 3 do not receive engineered bacteria, inducer, nonstandard amino acid, nor detectable compound.
  • mice the experimental group and of control group 1 are administered a single dose of engineered bacteria by oral gavage (10 9 -10 10 colony forming units (CFUs)).
  • mice of the experimental group and control group 1 are administered inducer (e.g. , arabinose at 10 g/L in drinking water) and nonstandard amino acid (e.g. , p-AzF at 0.25 g/L in drinking water).
  • inducer e.g. , arabinose at 10 g/L in drinking water
  • nonstandard amino acid e.g. , p-AzF at 0.25 g/L in drinking water
  • the mice of the experimental group, control group 1 and control group 2 are administered detectable compound (e.g. , DBCO-Cy5, 100 ⁇ ⁇ at 0.08 mM) by oral gavage.
  • mice Body weight, plasma samples, and fecal samples are taken throughout the duration of the study. In vivo imaging of the mice using the IVIS Spectrum In Vivo Imaging System (PerkinElmer) is performed throughout the study to determine labeling of the engineered bacteria in vivo. Fecal samples are also analyzed by fluorescence microscopy to determine bacterial labeling. Upon conclusion of the study at day 13, the mice can be euthanized, and internal organs (liver, spleen, intestines) collected and assayed.
  • IVIS Spectrum In Vivo Imaging System PerkinElmer
  • Example 10 In vivo labeling and detection of engineered bacteria comprising mutant CsgA or mutant TraT having the non-standard amino acid pAzF
  • Plasmids expressing either wild-type (wt) TraT or a mutant TraT having a labeling codon were transformed into PBP8 cells with or without the pEVOL-pAzF plasmid, which encodes an orthogonal translation system (OTS), and expression was induced. Proteins were purified after cells lysis and detected using Western Blot with either anti-myc or anti-his antibodies. Both wt and mutant TraT proteins have an expected molecular weight of about 27 kDa, each variants having a his-tag before either the stop-codon or the amber-codon (i.e. , labeling codon), respectively (FIG. 15A).
  • a second band having a molecular weight of about 34 kDa was observed in Western Blots of cells expressing the mutant TraT protein using either an anti-His antibody (FIG. 15A) or an anti-myc antibody (FIG. 15B).
  • the 34 kDa band is the expected size of the full length mutant TraT.
  • FIG. 15C in cells lacking the OTS and not grown in the presence of NSAA, about 5% of the protein expressed was the 34 kDa variant. This read-through might be a result of an Amber suppression mutation.
  • about 35% of TraT protein observed in the cells expressing both the mutant TraT, the OTS, and cultured in the presence of NSAA was full length. Premature termination of translation appears to have occurred at the amber codon, perhaps due to inefficiencies of the OTS.
  • Mutant TraT comprising pAzF, mutant CsgA comprising pAzF, wild-type
  • CsgA, and wild-type TraT were purified, incubated with DBCO-Cy5 and analyzed through SDS PAGE.
  • Two bands, each representing TraT or CsgA were visible using red fluorescence imaging (FIG. 16), and solely observed in cells comprising both the plasmid expressing the mutant TraT or mutant CsgA and the plasmid comprising the OTS, when the cells were grown in the presence of the NSAA pAzF. Since no protein bands were observed in the negative controls (i.e., bacterial cells expressing wt CsgA or wt TraT in the presence or absence of both the OTS and NSAA pAzF), both the mutation and OTS are necessary for the incorporation of the NSAA.
  • Cy5 either non-transformed PBP8 cells (control), or PBP8 cells transformed to express mutant TraT and the OTS were incubated with either 100 ⁇ or 200 ⁇ DBCO-Cy5 at either 25°C or 37°C.
  • labeling performed using 200 ⁇ DBCO-Cy5 at 25°C resulted in comparable fluorescence intensity as labeling performed using 100 ⁇ DBCO-Cy5 at 37°C.
  • concentrations of DBCO-Cy5 for labeling demonstrated that fluorescence intensity increased proportionally with higher concentration of DBCO-Cy5, with saturation observed at 300 ⁇ DBCO-Cy5.
  • FIGs. 18C and 18D cells expressing either mutant CsgA or mutant TraT incubated with 200 ⁇ DBCO-Cy5 for labeling between 1-4 hours, showed maximum labeling after 2 hours. Fluorescence intensity decrease after 2 hours, which may be due to protein degradation.
  • Cy5- DBCO labeling was detected in both PBP8 cells expressing either mutant CsgA comprising pAzF or mutant TraT comprising pAzF and the OTS. Further, as shown in FIGs. 19 and 20, a bimodal distribution was observed when flow cytometry was performed on cell
  • mice comprising pAzF labelled with Cy5-DBCO were detectable after passing the gastrointestinal tract, in vivo experiments were designed to label the bacteria in vivo. Briefly, four groups of mice were treated with either (a) Cy5-DBCO dye alone (Group 1); (b) bacteria expressing wild-type CsgA (Group 2); (c) bacteria expressing mutant CsgA comprising pAzF in the absence of arabinose inducer (Group 3); or (d) bacteria expressing mutant CsgA comprising pAzF in the presence of arabinose inducer (Group 4). For the groups of mice receiving bacteria (Groups 2-4), unlabeled bacteria were administered by oral gavage at day 0. Mice were continuously administered pAzF in water.
  • mice from Groups 2 and 4 were also administered the arabinose inducer. Subsequently (day 1), mice in all groups were administered Cy5-DBCO by gavage and no longer administered pAzF and arabinose (as applicable) 2 hours prior to administration of Cy5-DBCO. Mice were imaged using the VIS Lumina II system (PERKIN ELMER) to detect the clearance rate of the dye alone as well as the labeled bacteria. As shown in FIG. 24, a difference in the residence time was observed between mice administed the Cy5-DBCO dye alone (Group 1) and mice administered both Cy5-DBCO and bacteria expressing mutant CsgA comprising pAzF in the presence of arabinose inducer (Group 4).
  • VIS Lumina II system VIS Lumina II system
  • the Cy5-DBCO dye was no longer detectable after about 24 hours in the mice of Group 1, while fluorescence was detectable for an extended period of time (> 35 hours) in the majority of mice of Group 4, indicative of labeling of the the engineered bacteria. The differences in fluorescence residence time was statistically significant (see FIG. 25).
  • mutant CsgA comprising pAzF were detectable in some of the isolated bacteria. Not all of the bacteria retained the ability to express mutant CsgA comprising pAzF which may be due to the loss of the plasmid encoding the mutant CsgA protein, and/or the plasmid encoding the OTS.
  • mice were sacrificed and the gastrointestinal tract was imaged using the IVIS Lumina II system (PERKIN ELMER). As shown in FIGs. 27A and 27B, a significant difference was observed in the level of fluorescence detected in mice receiving the control untransformed PBP8 bacteria and mice receiving bacteria expressing the mutant CsgA comprising pAzF. Non-specific binding of the Cy5-DBCO dye was detected in the gut.
  • mice were administered PBP8 cells expressing either mutant CsgA comprising pAzF and the OTS, arabinose inducer, and pAzF.
  • a group of mice were not treated with bacteria, nor administered pAzF and arabinose.
  • the gastrointestinal tract tissue was collected from the mice and imaged using the IVIS Lumina II system (PERKIN ELMER) (see FIGs. 28 and 29). The cecal tissue was isolated and homogenized.
  • HFIP:TFA to disassemble aggregated curli fibers.
  • Cy5-DBCO-labelled mutant CsgA was detected in the soluble fractions of untreated cecum homogenate of every mouse to which bacteria expressing mutant CsgA comprising pAzF was administered, but not in the cecum homogenate from mice not administered bacteria.
  • a six-histidine tag (HisTag) was added to the C-terminus of CsgA to allow for immunodetection (pBbB8k-WT).
  • a control plasmid was constructed by cloning the malE gene encoding for the maltose binding protein (MBP) from the W3110 genome into the pBbB8k plasmid under the control of the araBp promoter (pBbB8k-MBP).
  • a mutation encoding for the amber stop codon was inserted within the open-reading frame of CsgA (pBbB8k-Mut) or MBP (pBbB8k-MBPMut) using site-directed mutagenesis.
  • the pEVOL-pAzF plasmid was used as orthogonal translation system (OTS).
  • E. coli strain derived from E. coli Nissle 1917 (ECN).
  • PBP8 strain was constructed using the lambda red recombineering method as previously described (see Datsenko and Wanner (2000) Proc. Nat'l. Acad. Set USA 97(12): 6640-5). Briefly, the chloramphenicol acetyltransferase (CAT) cassette was constructed with 500 bp homology arms upstream and downstream of the curli operon using SOEing PCR. The CAT cassette was transformed into electrocompetent EcN with pre-induced lambda red genes from pKD46 plasmid using 0.5% arabinose during the growth step of electrocompetent cell preparation.
  • CAT chloramphenicol acetyltransferase
  • Transformants were expanded using SOC media at 30°C shaking incubator for 3 hours to promote the genomic replacement of the curli operon with the CAT cassette. Transformants were then plated onto LB agar plates containing 25 ⁇ g/mL chloramphenicol and incubated overnight at 37 °C. Colonies that were resistant to chloramphenicol were selected and verified for knockout of the curli operon by colony PCR and genomic DNA sequencing as compared to wild-type EcN.
  • PBP8 cells transformed with a pBbB8k plasmid were streaked onto lysogeny broth (LB) agar plates containing 50 ⁇ g/mL kanamycin.
  • PBP8 cells transformed both with a pBbB8k plasmid and with the OTS plasmid were streaked onto Luria Broth (LB) agar plates containing both 50 ⁇ g/mL kanamycin and 50 ⁇ g/mL spectinomycin. Colonies were picked from the plates and 5 mL cultures were inoculated (in LB containing the appropriate antibiotics). Cultures were grown overnight at 37°C.
  • the overnight cultures were diluted 100-fold in fresh LB medium containing the appropriate antibiotics, and cultured at 37°C until they reached an optical density (OD) at 600 nm of 0.6 to 0.8.
  • Arabinose was added to the bacterial cultures at a final concentration of 0.05 % to induce protein expression.
  • the NSAA 4-azido-L-phenylalanine (pAzF) was also added to the cultures to a final concentration ranging between 1 mM and 5 mM. Higher concentrations of NSAA affected cell growth. Protein expression was allowed to occur at 37°C overnight.
  • Bacterial cells were grown in LB overnight, diluted 1: 100 in fresh LB, and grown in 1 mL-well 96 wells plate at 37 °C and shaken at 900 rpm. Once the culture reached an optical density (OD) of 0.6, measured at 600 nm (optimal for protein expression), the cultures were again diluted 1: 100 in fresh LB in a 250 mL 96 well plate. Half of each cell culture was induced with 0.05% arabinose and incubated with 5 mM NSAA. The other half of the cell culture was used as negative control and were not induced with arabinose nor exposed to NSAA. Bacterial cells expressing either the curli operon, or MBP as control, were used.
  • Samples were dried in a critical point dryer, placed onto SEM sample holders using silver adhesive (Electron Microscopy Sciences), and sputtered until they were coated in a 5 nm layer of Pt/Pd. Imaging was performed using a Zeiss Ultra 55 Field Emission SEM.
  • This wash step was repeated 3 times to remove any unbound dye. Labeling was assessed by spotting 10 ⁇ of labeled cells at OD 1 on a nitrocellulose membrane and detecting the fluorescence of Cy5 using a FluorChemTM M system (Protein Simple). Flow cytometry was used to determine the fraction of cells that were labeled.
  • 33342 (THERMO SCIENTIFIC) in PBS for 1 hour and rinsed 3 times using 1 mL of PBS. Subsequently, the bacterial cells were fixed in 2% paraformaldehyde for 10 minutes at 25 °C and washed 3 times with 1 mL of PBS. 10 ⁇ of cells were deposited on a glass slide for imaging using a Leica SP5 X MP Inverted Confocal Microscope (Leica Microsystems).
  • Pre-labeled bacterial cells were pelleted at 4,000 x g for 20 min, and resuspended in lysis buffer (50 mM phosphate buffer, 100 mM NaCl, 7 M guanidinium hydrochloride). A protease inhibitor cocktail was added, and the suspension was stored at - 20 °C overnight. The suspension was thawed on ice, and sonicated to fully lyse the cells (40% amplitude, 3 x 25 seconds ON, 35 seconds OFF). After centrifugation at 10,000 x g for 30 minutes, the supernatant was applied to a NiNTA column and incubated 2 hours with agitation at room temperature in the presence of 10 mM imidazole.
  • lysis buffer 50 mM phosphate buffer, 100 mM NaCl, 7 M guanidinium hydrochloride.
  • a protease inhibitor cocktail was added, and the suspension was stored at - 20 °C overnight. The suspension was thawed
  • His-tag purification was performed by washing the column 3 times with 40 mM imidazole, and eluting His-tagged CsgA proteins with 500 mM imidazole (both in 50 mM phosphate buffer with 100 mM NaCl). Eluates were concentrated using 3 kDa Amicon ultracentrifugal filters and analyzed by SDS-PAGE using a 4-20% polyacrylamide gel. Prior to staining with Coomassie Blue, Cy5 fluorescence within the SDS-PAGE gel was also detected. Mass spectrometry analysis was used to confirm the presence of CsgA in the Cy5-labeled bands.
  • mice Prior to the experiments, mice were given a non- fluorescent food (alfalfa- free) for at least 5 days to minimize background autofluorescence. At six hours prior to oral gavage with bacteria, mice were fasted and given water containing antibiotics (1 g/L kanamycin (RPI), 1 g/L spectinomycin (RPI)), inducer (10 g/L L-(+)-Arabinose (Sigma)) and NSAA (5 mM) based on their assigned experimental conditions.
  • antibiotics (1 g/L kanamycin (RPI), 1 g/L spectinomycin (RPI)
  • inducer (10 g/L L-(+)-Arabinose (Sigma)
  • NSAA 5 mM
  • the starting culture of PBP8 transformed with pBbB8k-WT was expanded 1: 100 dilution in LB containing 50 ⁇ g/mL kanamycin, while that of PBP8 transformed with pBbB8k-Mut and pEVOL-pAzF was expanded 1: 100 dilution in LB containing 50 ⁇ g/mL kanamycin and spectinomycin to OD of 0.5.
  • Log-phase cultures were centrifuged at 4,000 x g for 15 minutes at 4°C and resuspended in 20% sucrose (OmniPur) in PBS to an OD of 10. Once the mice were fasted for six hours, 100 ⁇ ⁇ of the prepared log-phase bacteria were administered to the mice via oral gavage.
  • mice The alfalfa- free food and water were administered again to the mice to allow for proliferation and protein induction of the engineered bacteria in vivo. Meanwhile, the abdominal hair of the mice was removed to allow for imaging. 40 hours after gavage with the bacteria, pAzF and arabinose-containing water was switched for antibiotic-only- containing water, and the food was briefly remove to prepare the mice for dye administration.
  • IVIS Lumina II PerkinElmer
  • mice experiments were performed in the same manner as the in vivo tracking experiment described above, except that 36 hours after administration of the Cy5- DBCO dye.
  • the mice were euthanized to harvest the whole gastrointestinal (GI) tract for ex vivo fluorescence imaging.
  • the GI tract was placed on the lid of 150x25 mm polystyrene tissue culture plate (Falcon) and imaged using IVIS Lumina II with the same setting as the in vivo imaging. After imaging, the GI tract was kept at -20°C for protein extraction.
  • the GI tract specimens used in the ex vivo fluorescence imaging were further analyzed for curli and Cy5-DBCO interaction.
  • the mouse GI tracts were removed from - 20°C.
  • the cecum from each sample was excised, transferred to a 15-ml falcon tube, and crushed to homogenize.
  • 3 mL of PBS was added to each sample, supplemented with 4 of benzonase nuclease (NOVAGEN) and 8 of 1 M magnesium sulfate (MgS0 4 ) (SIGMA).
  • NOVAGEN benzonase nuclease
  • SIGMA 1 M magnesium sulfate
  • Coomassie Brilliant Blue to detect the presence of proteins and compared the size against standard protein ladder (Bio-Rad).
  • fecal pellets were collected from each mouse in a sterile manner at 24-hour time point after dye administration.
  • the pellets were homogenized using bead mill homogenizer TissueLyser LT (Qiagen) and 5-mm stainless steel beads (Qiagen) with the frequency of 30 Hz for 2 minutes.
  • the fecal homogenates were centrifuged briefly at 1,000 rpm for 1 minute to loosely pellet the large particulates. The supernatant was serially diluted and plated on appropriate antibiotic- selection plates. The colonies were grown, induced, and undergone similar in vitro labeling experiment and analysis mentioned previously.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Mycology (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Analytical Chemistry (AREA)
  • Immunology (AREA)
  • Plant Pathology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Engineered bacteria that express a protein having a nonstandard amino acid, pharmaceutical compositions comprising the bacteria, biofilms comprising a protein having a nonstandard amino acid, and methods for using the bacteria for diagnostic and therapeutic purposes are provided.

Description

ENGINEERED BACTERIA FOR NON-INVASIVE IMAGING AND THERAPEUTIC
APPLICATIONS
RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent Application No.
62/372,148, filed on August 8, 2016, the entire contents of which are expressly incorporated herein by reference.
FIELD
[0002] The technology described herein relates to engineered bacteria comprising proteins that are capable of being labeled in vivo and methods for using the bacteria for diagnostic and therapeutic purposes.
BACKGROUND
[0003] Currently-available methods for diagnosing and or monitoring disease progression, particularly diseases of the gastrointestinal tract are often invasive and do not readily allow for continuous monitoring. Thus there is a need for alternative approaches that would allow for non- invasive continuous monitoring of a subject's gastrointestinal tract.
[0004] Advances in microbiome biology have led to increased interest in the use of live microbes to deliver drugs and treat diseases. The use of engineered microbes for diagnosing and/or monitoring disease state progression represents an alternative non- invasive method that would be of substantial benefit to patient diagnosis and treatment. Attempts to deliver traceable microbes require that the microbes be labeled with labile detectable compound prior to administration to the subject. Unfortunately, over a prolonged period of time, the detectable compounds are no longer traceable rendering the known techniques of little use for prolonged monitoring of a subject. Accordingly, there is a need in the art for methods of producing microbes that are traceable for a prolonged period of time after administration to a subject that can be used for a variety of medical uses (e.g., diagnostics and therapeutics).
SUMMARY
[0005] Embodiments of the present disclosure are directed to engineered or genetically altered microbes, such as Escherichia coli, that produce proteins comprising a nonstandard amino acid. The nonstandard amino acid can be labeled with a detectable substance before or after administration to the subject which allows for monitoring of the microbe over a prolonged period of time.
[0006] In one aspect, the present invention provides an engineered bacterium comprising an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid comprising a labeling codon, wherein the heterologous nucleic acid comprises a heterologous gene encoding a protein selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with a nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid at the residue corresponding to the labeling codon during translation.
[0007] In some embodiments, the heterologous nucleic acid further encodes a polypeptide linker sequence. In some embodiments, the polypeptide linker sequence is flexible. In some embodiments, the heterologous nucleic acid further encodes a polypeptide tag.
[0008] In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
[0009] In some embodiments, the heterologous nucleic acid comprises 2, 3, 4, 5, 6, 7, or 8 labeling codons.
[0010] In one aspect, the present invention provides an engineered bacterium comprising an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid encoding a protein, wherein the protein comprises a nonstandard amino acid, and wherein the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
[0011] In some embodiments, the protein further comprises a polypeptide linker. In some embodiment, the polypeptide linker is flexible. [0012] In some embodiments, the protein further comprises a polypeptide tag. In some embodiments, the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
[0013] In some embodiments, the protein comprises 2, 3, 4, 5, 6, 7, or 8 nonstandard amino acids.
[0014] In some embodiments, the bacterial extracellular matrix protein is a fiber protein, a flagellar protein, or a pilin protein.
[0015] In some embodiments, the protein is selected from the group consisting of InaV, Trat, and CsgA. In some embodiments, the protein is CsgA. In some embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA. In some embodiments, the protein is InaV and the
nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV. In some embodiments, the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
[0016] In some embodiments, the labeling codon is TAG.
[0017] In some embodiments, the orthogonal tRNA comprises an anticodon loop that specifically recognizes the codon UAG.
[0018] In some embodiments, the nonstandard amino acid comprises a bioorthogonal reactive functional group. In some embodiments, the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, or a norbornene moiety.
[0019] In some embodiments, the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), irans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra). In some embodiments, the nonstandard amino acid is p-AzP.
[0020] In some embodiments, the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is of the species Escherichia coli. In some embodiments, the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp. In some embodiments, the engineered bacterium is of the Escherichia coli Nissle 1917 strain. [0021] In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon. In some embodiments, the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium further comprises a prfA gene deletion.
[0022] In some embodiments, the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some
embodiments, the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene. In some embodiments, the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri,
Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene.
[0023] In some embodiments, the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the plasmid is pEVOL-pAzF.
[0024] In some embodiments, the expression of the heterologous nucleic acid is under the control of a constitutive promoter. In some embodiments, the expression of the heterologous nucleic acid is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline. In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of a constitutive promoter.
[0025] In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
[0026] In one aspect the present invention provides a bio film comprising an engineered bacterium described herein.
[0027] In one aspect, the present invention provides a pharmaceutical composition comprising an engineered bacterium described herein and a pharmaceutically-acceptable excipient. In some embodiments, the composition is formulated for oral administration to a subject. In some embodiments, the composition is formulated for rectal administration to a subject. In some embodiments, the pharmaceutical composition is formulated as a pill, a capsule, a lozenge, or a suppository. In some embodiments, the subject is a mammalian subject. In some embodiments, the mammalian subject is a human subject.
[0028] In another aspect, the present invention provides a method for labeling of an engineered bacterium in a subject in vivo, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; and (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein, thereby labeling the engineered bacterium in the subject in vivo. In some embodiments, step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
[0029] In yet another aspect, the present invention provides a method for detecting the distribution of an engineered bacterium in a subject in vivo, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first
bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and (c) detecting the detectable compound in the subject, thereby detecting the distribution of the engineered bacterium in the subject in vivo. In some embodiments, step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
[0030] In another aspect, the present invention provides a method for diagnosing a gastrointestinal disease in a subject, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and (c) detecting the distribution of the detectable compound in the gastrointestinal tract of the subject, thereby diagnosing a gastrointestinal disease in the subject. In some embodiments, step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
[0031] In yet another aspect, the present invention provides a method for detecting the distribution of a bio film produced by an engineered bacterium in a subject, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid to a subject, and wherein the nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second
bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and (c) detecting the detectable compound in the subject, thereby determining the distribution of the bio film produced by the engineered bacterium in the subject. In some embodiments, step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b).
[0032] In another aspect, the present invention provides a method for delivering a drug to a subject in need thereof, the method comprising: (a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; (b) administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid, thereby delivering the drug to the subject in need thereof. In some
embodiments, step (a) is performed concurrently with step (b). In some embodiments, step (a) is performed before step (b). In some embodiments, the drug is delivered to the gastrointestinal tract of the subject. In some embodiments, the drug is delivered to the mouth, esophagus, stomach, large intestine, small intestine, rectum, colon, or anal canal of the subject. In some embodiments, the drug is delivered to the heart, lung, hair, or skin of the subject. [0033] In some embodiments, the engineered bacterium comprises an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and a heterologous nucleic acid encoding the protein having the at least one nonstandard amino acid; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
[0034] In some embodiments, the methods further comprise administering a nonstandard amino acid to the subject. In some embodiments, the nonstandard amino acid is administered to the subject prior to administering the detectable compound or the drug to the subject.
[0035] In some embodiments, the first bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, and a norbornene moiety. In some embodiments, the second bioorthogonal reactive functional group is selected from the group consisting of a hydrazine moiety, a hydroxylamine moiety, an alkyne moiety, an azide moiety, a tetrazine moiety, and a norbornene moiety. In some embodiments, the first bioorthogonal reactive functional group is a ketone moiety, and the second bioorthogonal reactive functional group is either a hydrazine moiety or a hydroxylamine moiety. In some embodiments, the first bioorthogonal reactive functional group is an azide moiety, and the second bioorthogonal reactive functional group is an alkyne moiety. In some embodiments, the first bioorthogonal reactive functional group is an alkyne moiety, and the second bioorthogonal reactive functional group is an azide moiety. In some embodiments, the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group via a click chemistry reaction.
[0036] In some embodiments, the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group requires a catalytic agent. In some embodiments, the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group does not require a catalytic agent. In some embodiments, the methods further comprise administering a catalytic agent to the subject. In some embodiments, the catalytic agent is copper or nickel.
[0037] In some embodiments, the detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent. [0038] In some embodiments, the protein further comprises a polypeptide linker. In some embodiments, the polypeptide linker is flexible. In some embodiments, the protein further comprises a polypeptide tag. In some embodiments, the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
[0039] In some embodiments, the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein. In some
embodiments, the bacterial extracellular matrix protein is a curli fiber protein, a flagellar protein, or a pilin protein.
[0040] In some embodiments, the protein is selected from the group consisting of InaV, Trat, and CsgA. In some embodiments, the protein is CsgA. In some embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA. In some embodiments, the protein is InaV and the
nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV. In some embodiments, the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
[0041] In some embodiments, the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra). In some embodiments, the nonstandard amino acid is p-AzP.
[0042] In some embodiments, the detectable compound is DBCO-Cy5.
[0043] In some embodiments, the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is of the species Escherichia coli. In some embodiments, the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp. In some embodiments, the engineered bacterium is of the Escherichia coli Nissle 1917 strain.
[0044] In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon. In some embodiments, the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon. In some embodiments, the engineered bacterium further comprises a prfA gene deletion.
[0045] In some embodiments, the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase. In some
embodiments, the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene. In some embodiments, the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri,
Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene.
[0046] In some embodiments, the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the plasmid is pEVOL-pAzF.
[0047] In some embodiments, the expression of the heterologous nucleic acid is under the control of a constitutive promoter. In some embodiments, the expression of the heterologous nucleic acid is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline. In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of a constitutive promoter.
[0048] In some embodiments, the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of an inducible promoter. In some embodiments, the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
[0049] In some embodiments, the methods further comprise administering to the subject an inducer that regulates the inducible promoter. In some embodiments, the inducer is administered to the subject prior to administering the detectable compound or the drug to the subject. In some embodiments, the inducer is comprised in a pharmaceutical composition.
[0050] In some embodiments, the engineered bacterium is administered to the subject orally or rectally. In some embodiments, the engineered bacterium is comprised in a
pharmaceutical composition.
[0051] In some embodiments, the detectable compound or the drug is administered to the subject orally, subcutaneously, intravenously, rectally, or transdermally. In some embodiments, the detectable compound or the drug is comprised in a pharmaceutical composition. In some embodiments, the detectable compound or the drug further comprises a drug delivery vehicle selected from the group consisting of a nanocarrier, a nanoparticle, a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein.
[0052] The present invention is further illustrated by the following detailed description and drawings.
BRIEF DESCRIPTION OF THE DRAWINGS
[0053] The foregoing and other features and advantages of the present embodiments will be more fully understood from the following detailed description of illustrative embodiments taken in conjunction with the accompanying drawings in which:
[0054] FIG. 1A is a schematic showing plasmid maps indicating exemplary locations of a labeling codon (UAG) in mRNA transcribed from the open reading frames of the modified genes encoding the maltose-binding protein (MBP) (position 67), CsgA (position 89), the ice nucleation protein (InaV) (position 174), or the TraT protein (position 200).
[0055] FIG. IB is a schematic showing plasmid maps indicating exemplary locations of a labeling codon (UAG) in mRNA transcribed from open reading of the genes encoding the maltose-binding protein (MBP), CsgA, the ice nucleation protein (InaV), or the TraT protein appended to a flexible linker and affinity tags. Affinity tags (i.e., a myc tag and a poly-his tag) were introduced before and after the labeling codon to assess of the incorporation of the nonstandard amino acid or translation termination.
[0056] FIG. 2A depicts the structure of two nonstandard amino acids, p-acetylphenylalanine and p-azidophenylalanine.
[0057] FIGs. 2B and 2C are two schematics showing exemplary recombinant bacteria engineered for bioorthogonal reactions that may be used to attach a detectable moiety or drug to a protein comprising a nonstandard amino acid.
[0058] FIG. 3 shows an SDS-PAGE gel stained with Coomassie Blue showing the Ni NTA affinity purification of maltose-binding protein (MBP) expressed in E. coli Nissle that has not been recoded to remove TAG codons. Purification eluates from three different bacterial strains are shown: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
[0059] FIG. 4A depicts the structure of DBCO-Cy5.
[0060] FIGs. 4B and 4C show an SDS-PAGE gel stained with Coomassie Blue (FIG. 4B), and the corresponding fluorescence detection image (FIG. 4C) of eluates from a Ni NTA affinity purification of maltose-binding protein (MBP) comprising the nonstandard amino acid /?-AzF, that were reacted with DBCO-Cy5. MBP was expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS"). Concentrated 500 mM eluates of purified MBP were incubated with DBCO-Cy5 at increasing molar ratios ranging from 1: 10 to 10: 1 MBP:DBCO-Cy5.
[0061] FIG. 5 shows an SDS-PAGE gel stained with Coomassie Blue showing the Ni NTA affinity purification of CsgA expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
[0062] FIGs. 6A and 6B show an SDS-PAGE gel stained with Coomassie Blue (FIG. 6A), and the corresponding fluorescence detection image (FIG. 6B), of eluates from a Ni NTA affinity purification of CsgA comprising the nonstandard amino acid AzF, that were reacted with DBCO-Cy5. CsgA was expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS"). Concentrated 500 mM eluates of purified CsgA protein were incubated with DBCO-Cy5.
[0063] FIG. 7 shows fluorescence detection imaging of cell pellets from E. coli Nissle cells under three different transformation conditions: cells transformed with a single plasmid to express MBP without a nonstandard amino acid, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express MBP without a nonstandard amino acid expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS"). After exposure to DBCO-Cy5, cell pellets were washed three times with phosphate buffer. MBP is soluble and was washed away from the cell pellets, and low specific binding of DBCO-Cy5 to other proteins was observed.
[0064] FIG. 8 shows Congo Red dye-monitoring of the expression of CsgA comprising p- AzF at different concentrations of arabinose to induce the expression of the orthogonal translation system that incorporates /?-AzF into the expressed protein. Congo Red dye binding to curli fiber (CsgA) was determined using spectrophotometry at OD490/OD600, a measure of bound Congo Red dye over cell density. Increased Congo Red binding signifies increased curli fiber (CsgA) production. Optimal expression of CsgA comprising p-AzP was observed at 0.05% arabinose induction. E. coli Nissle having a deletion in the endogenous curli operons were used. Data for cells expressing a heterologous gene encoding CsgA comprising p-AzP (as part of the synthetic curli operon) are shown in red ("Curli operon"). Data for cells expressing a heterologous gene encoding MBP comprising p-AzP are shown in grey (control; "MBP"). Experiments were performed using three different transformation conditions: cells transformed with a single plasmid to express wild-type protein (CsgA or MBP), where the bacteria lacked an orthogonal translation system (no label); cells transformed with a plasmid to express wild-type protein (CsgA or MBP) and a plasmid comprising an orthogonal translation system ("OTS"); and cells transformed with a plasmid to express protein (CsgA or MBP comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("OTS/mut"). Background signal could be due to Congo Red binding to other extracellular appendages of ECN (cellulose for example). Only background signal was observed for cells expressing MBP.
[0065] FIG. 9 shows scanning electron microscopy images of curli (CsgA) expression in E. coli Nissle expressing either MBP or CsgA as indicated. The protein of interest (MBP or CsgA) was expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon, where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
[0066] FIGs. 10A and 10B show bacterial growth curves of E. coli Nissle cells either:
lacking plasmid ("No plasmid"); comprising an orthogonal translation system (encoded by the pEVOL-pAzF plasmid) ("OTS"); cells transformed with a single plasmid to express wild- type MBP (without a nonstandard amino acid), where the bacteria lacked an orthogonal translation system ("MBP"); cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("MBP + OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("MBP (mutation) + OTS"); cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("Curli operon"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("Curli operon + OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("Curli operon (mutation) + OTS"). E. coli Nissle having a deletion in the endogenous curli operons were used. FIG. 10A shows growth curves in the absence of an inducer for the orthogonal translation system (arabinose). [0067] FIG. 10B shows growth curves in the presence of 1 mM /?-AzF.
[0068] FIGs. 11A and 11B shows bacterial growth curves of E. coli Nissle cells either:
lacking plasmid ("No plasmid"); comprising an orthogonal translation system (encoded by the pEVOL-pAzF plasmid) ("OTS"); cells transformed with a single plasmid to express wild- type MBP (without a nonstandard amino acid), where the bacteria lacked an orthogonal translation system ("MBP"); cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("MBP + OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("MBP (mutation) + OTS"); cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("Curli operon"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("Curli operon + OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthologous translation system ("Curli operon (mutation) + OTS"). E. coli Nissle having a deletion in the endogenous curli operons were used. FIG. 11A shows growth curves in the presence of 0.05% arabinose, the inducer for the orthogonal translation system and the MBP protein. FIG. 11B shows growth curves in the presence of in the presence of 0.05% arabinose and 1 mM /?-AzF.
[0069] FIG. 12 shows an SDS-PAGE gel stained with Coomassie Blue, and the
corresponding fluorescence detection image of purified MBP comprising p-AzF, that was reacted with DBCO-Cy5 at varying molar ratios.
[0070] FIG. 13 shows a fluorescence detection image of an SDS-PAGE gel of purified CsgA comprising p-AzF that was reacted with DBCO-Cy5. Cells were grown in media containing varying concentrations of the nonstandard amino acid (p-AzF; labeled "NSAA"). CsgA was expressed in E. coli Nissle that has not been recoded to remove TAG codons using three different transformation conditions: cells transformed with a single plasmid to express wild- type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS").
[0071] FIGs. 14A and 14B shows an SDS-PAGE gel stained with Coomassie Blue (FIG. 14A), and a Western Blot (FIG. 14B) using anti-His antibody to detect the expression of TraT surface protein having a poly-His tag in cell lysates from Escherichia coli Nissle. Cells were lysed with three different lysing buffers, as indicated (Buffer 1: 50 mM Tris-HCl pH 8.0, 2% Triton X-100; Buffer 2: 50 mM Tris-HCl pH 8.0, 1% Triton X-100, 150 mM NaCl; and Buffer 3: 50 mM Tris-HCl pH 8.0, 1% Triton X-100, 150 mM NaCl, 0.1% SDS, 0.5% sodium deoxycholate). Ladder in FIG. 14A: Precision Plus Protein™ Dual Color Standards; ladder in FIG. 14B: Novex® Sharp Pre-stained Protein Standard.
[0072] FIGs. 15A, 15B, 15C, and 15D show the expression of wild-type and mutant TraT in lysates from cells lacking or having an orthogonal translation system (OTS) in the presence or absence of the NSAA pAzF. FIG. 15A and 15B each show a Western Blot using anti-His antibody (FIG. 15A) or anti-myc antibody (FIG. 15B) from cell lysates of either a) bacterial cells transformed with a plasmid to express wild-type TraT and lacking a plasmid expressing an OTS, grown in the absence of the NSAA pAzF (Mutation OTS "+"; NSAA "-"); b) bacterial cells transformed with a plasmid to express wild-type TraT and a plasmid expressing an OTS, grown in the presence of the NSAA pAzF (Mutation OTS "+"; NSAA "+"); c) bacterial cells transformed with a plasmid to express mutant TraT comprising a NSAA, and lacking a plasmid expressing an OTS, grown in the absence of the NSAA pAzF (Mutation "+"; OTS NSAA "-"); d) bacterial cells transformed with a plasmid to express mutant TraT comprising a NSAA and a plasmid expressing an OTS, grown in the absence of the NSAA pAzF (Mutation "+"; OTS "+"; NSAA "-"); or e) bacterial cells transformed with a plasmid to express mutant TraT comprising a NSAA and a plasmid expressing an OTS, grown in the presence of the NSAA pAzF (Mutation "+"; OTS "+"; NSAA "+"). FIG. 15C is a bar graph quantitatively depicting the percentage of TraT protein detected with anti-His antibody corresponding to the approximately 37 kDa full length TraT protein in each of the lanes of the Western Blot shown in FIG. 15A. FIG. 15D is a bar graph quantitatively depicting the intensity (in absolute intensity units) of the approximately 37 kDa full length TraT protein in each of the lanes of the Western Blot shown in FIG. 15A.
[0073] FIG. 16 shows an SDS-PAGE of either wild-type TraT, mutant TraT comprising pAzF, wild-type CsgA or mutant TraT comprising pAzF, labelled with DBCO-Cy5. [0074] FIGs. 17A, 17B and 17C show the optimization of labeling of mutant TraT comprising pAzF with DBCO-Cy5. FIG. 17A shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with increasing concentrations of DBCO-Cy5 for labelling. FIG. 17B shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with 200 μΜ DBCO-Cy5 at 37°C for 1-4 hours. FIG. 17C shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with 100 μΜ or 200 μΜ DBCO-Cy5 at 25 °C or 37 °C for labelling. N=5 for all experiments.
[0075] FIGs. 18A, 18B, 18C, and 18D show the optimization of labeling of mutant TraT comprising pAzF or mutant CsgA comprising pAzF with DBCO-Cy5. FIG. 18A shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and either mutant CsgA comprising pAzF ("CsgA") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with increasing concentrations (200 μΜ - 400 μΜ) of DBCO-Cy5 for labelling. FIG. 18B shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and either mutant TraT comprising pAzF ("TraT") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with increasing concentrations of DBCO-Cy5 for labelling. FIG. 18C shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant CsgA comprising pAzF ("CsgA") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with 200 μΜ DBCO-Cy5 at 37°C for 1-4 hours. FIG. 18D shows the fluorescence intensity of the E. coli PBP8 strain transformed to express the OTS and mutant TraT comprising pAzF ("TraT") or untransformed PBP8 cells ("sham"), grown in the presence of 5 mM pAzF. Cells were incubated with 200 μΜ DBCO- Cy5 at 37°C for 1-4 hours. N=5 for all experiments.
[0076] FIG. 19 depicts flow cytometry data for E. coli PBP8 cells alone ("Control cells"), cells transformed to express wild-type CsgA ("Wild-type fibers"), cells transformed to wild- type CsgA and the orthogonal translation system (OTS) ("Wild-type fibers with OTS"), cells transformed to express mutant CsgA comprising pAzF and the OTS in the absence of the expression inducer arabinose ("Mutant fibers with OTS, no induction"), or cells transformed to express mutant CsgA comprising pAzF and the OTS in the presence of the expression inducer arabinose ("Mutant fibers with OTS"). Cells were labelled with 300 μΜ DBCO-Cy5 for 2 hours at 37°C.
[0077] FIG. 20 depicts flow cytometry data for untransformed E. coli PBP8 cells ("sham"), cells transformed to express wild-type TraT ("wt TraT"), cells transformed to wild-type TraT and the orthogonal translation system (OTS) ("wt TraT + OTS + NSAA"), cells transformed to express mutant TraT comprising pAzF and the OTS grown in the absence of the expression inducer arabinose ("mut TraT + OTS + NSAA (non induction)"), or cells transformed to express mutant TraT comprising pAzF and the OTS grown in the presence of the expression inducer arabinose ("mut TraT + OTS + NSAA"). Cells were labelled with 300 μΜ DBCO-Cy5 for 2 hours at 37°C.
[0078] Figs. 21A, 21B, 21C, and 21D show confocal microscopy images of E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS, or mutant TraT comprising pAzF and the OTS. Cells were labeled with Cy5-DBCO and Hoechst dye. FIG. 21A shows a confocal microscopy image of cells expressing mutant CsgA comprising pAzF labelled with Cy5-DBCO and Hoechst dye. FIG. 21B shows a confocal microscopy image of single cells expressing mutant CsgA comprising pAzF labelled with Cy5-DBCO and Hoechst dye. FIG. 21C shows confocal microscopy images of cells expressing mutant TraT comprising pAzF labelled with Cy5-DBCO and Hoechst dye. FIG. 21D shows a confocal microscopy image of single cells expressing mutant TraT comprising pAzF labelled with Cy5-DBCO and Hoechst dye.
[0079] FIG. 22 show fluorescence detection images of Cy5-DBCO labelled bacteria in mice administered either no bacteria (control), or either 1 x 106 or 1 x 109 PBP8 cells expressing mutant CsgA comprising pAzF and the OTS labeled in vitro with Cy5-DBCO. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER).
[0080] FIG. 23 shows fluorescence detection images of Cy5-DBCO in mice administered either 5 μΜ, 50 μΜ, 100 μΜ, or 200 μΜ of Cy5-DBCO. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER).
[0081] FIG. 24 shows fluorescence detection images of mice administered either Cy5-DBCO alone or mice administered E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS and labeled with Cy5-DBCO at -1 hour (prior to
administration), 0 hours, 6 hours, 11 hours, 24 hours, 35 hours, 48 hours, 75 hours, and 100 hours. Cy5 fluorescence detected in vivo using a IVIS Lumina II system (PERKIN ELMER). Epifluorescence subtracted images: 675-500 nm excitation, 698 nm emission. Scaled to background: 0% = background at -1 hour, 100%= max. signal after gavage at 0 hours.
[0082] FIG. 25 is a line graph depicting the normalized radiant efficiency analysis of the fluorescence detected in the mice depicted in FIG. 24. Normalized total radiant efficiency of subtracted imaged detected according to the following equation:
Y = TRE(X) - TRE (background)
TRE(0) - TRE (background)
[0083] FIGs. 26A and 26B show the detection of mutant CsgA comprising pAzF in cells lysates from two bacterial colonies isolated from fecal samples of mice administered E. coli PBP8 cells transformed to express either mutant CsgA comprising pAzF and the OTS. FIG. 26A shows a fluorescence image of an SDS-PAGE gel stained with Cy5-DBCO of either His-tag purified or unpurified cell lysates from bacterial cultures derived from two separate bacterial colonies that were either grown in the absence of pAzF ("Mut w/o NSAA"), presence of pAzF ("Mut with NSAA"). FIG. 26B shows a Coomassie Blue stain of the SDS- PAGE gel shown in FIG. 26A.
[0084] FIGs. 27A and 27B show fluorescence detection images of Cy5-DBCO-labelled bacteria in the gastrointestinal tracts of mice administered either untransformed PBP8 cells ("control") or PBP8 cells transformed to express mutant CsgA comprising pAzF and the OTS, and Cy5-DBCO. FIG. 27C are bar graphs depicting the normalized radiant efficiency analysis of the fluorescence detected in FIGs. 27A and 27B.
[0085] FIG. 28 shows ex vivo fluorescence detection imaging of the gastrointestinal tract of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("(+) NSAA, inducer Mutant EcN") or untreated mice ("control"), 24 hours after treatment with Cy5-DBCO.
[0086] FIG. 29 shows ex vivo fluorescence detection imaging of the gastrointestinal tract of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("(+) NSAA, inducer Mutant EcN") or untreated mice ("control"), 36 hours after treatment with Cy5-DBCO.
[0087] FIG. 30A shows fluorescence detection images of the cecum of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("Mutant") or untreated mice ("(-)"), 36 hours after treatment with Cy5-DBCO. [0088] FIGs. 30B and 30C depict fluorescence detection images of extracted supernatants and pellets, respectively, derived from the cecum of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("Mutant") or untreated mice ("(-)"), 36 hours after treatment with Cy5-DBCO.
[0089] FIGs. 31A and 31B are images of SDS-PAGE gels from soluble fraction
(supernatant) and pellets derived from ceca of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("Mutant") or untreated mice ("(-)"), 36 hours after treatment with Cy5-DBCO. FIG. 31A, the left panel, shows the Coomassie Blue-stained SDS-PAGE gel of the soluble fractions (supernatant) before ("Supl") and after ("Sup2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength. FIG. 31B, the left panel, shows the Coomassie Blue-stained SDS-PAGE gel with the pellet fractions before ("Pell") and after ("Pel2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
[0090] FIGs. 32A and 32B are images of SDS-PAGE gels from soluble fraction
(supernatant) and pellets derived from ceca of mice administered either PBP8 bacteria expressing mutant curli fibers supplemented with NSAA, arabinose inducers and appropriate antibiotics ("Mutant") or untreated mice ("(-)"), 36 hours after treatment with Cy5-DBCO. FIG. 32A, the left panel, shows the Coomassie Blue-stained SDS-PAGE gel of the soluble fractions (supernatant) before ("Supl") and after ("Sup2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength. Samples are at a 1:20 dilution of the samples run in the SDS-PAGE gels of FIGs. 31A and 31B. FIG. 32B, the left panel, shows the Coomassie Blue-stained SDS- PAGE gel with the pellet fractions before ("Pell") and after ("Pel2") HFIP/TFA extraction, and the right panel depicts a fluorescent image of the Cy5-DBCO stained gel at a 710 nm excitation wavelength.
DETAILED DESCRIPTION
[0091] The disclosure includes engineered bacteria, pharmaceutical compositions thereof, methods of labeling an engineered bacterial cell, and methods of using engineered bacteria for the diagnosis and treatment of a disease or disorder. [0092] In one aspect, the engineered bacterium has been genetically modified to comprise an orthogonal translation system. The orthogonal translation system allows the engineered bacterium to incorporate one or more nonstandard amino acids into a protein encoded by a nucleic acid having a labeling codon, and being expressed by the bacterium. The orthogonal translational system can be designed to particularly target specific codons (i.e., labeling codons) present in a gene encoding a protein of interest in order to incorporate one or more nonstandard amino acids into the protein during translation. Proteins having a nonstandard amino acid bearing a bioorthogonal reactive functional group can be reacted with detectable moiety which allow for the tracking, labeling and/or visualization of the protein. Further, bacterial cells comprising proteins having a nonstandard amino acid bearing a bioorthogonal reactive functional group can also be labeled with a detectable moiety, after being administered to a subject, which allows for the tracking, labeling and/or visualization of the bacterium in the subject.
[0093] The genetic modification of a bacterium to include an orthogonal translation system allows for the incorporation of nonstandard amino acids into any protein expressed by the bacterium, a concept known as genetic code expansion (see, e.g., Young et al. (2010) J. Mol. Biol. 395: 361-374). Genetic code expansion includes the genetic modification of a microorganism to express an orthogonal aminoacyl tRNA synthetase/tRNA (aaRS/tRNA) pair that is specific for a particular nonstandard amino acid and that does not function with standard amino acids, endogenous tRNAs or endogenous aminoacyl tRNA synthetases.
[0094] At a minimum, genetic code expansion requires the use of both an orthogonal aminoacyl aaRS/tRNA pair, as well as a labeling codon that can be decoded by the tRNA of the aaRS/tRNA pair, providing a mechanism for incorporating a nonstandard amino acid into any protein of interest. In some embodiments, the amber stop codon TAG (UAG on mRNA) is used as the labeling codon. Multiple aaRS/tRNA pairs have been developed thus far, allowing for the incorporation of over 100 nonstandard amino acids into proteins (see, e.g., Liu et al. (2010) Annu. Rev. Biochem. 79: 413-444). Further, many nonstandard amino acids having a variety of different chemical structures (e.g., bioorthogonal reactive functional groups, metal chelation moieties, photo-crosslinking side chains, photo-caged side chains, post-translational modifications, redox reactive agents, and infrared, NMR and fluorescent probes) have also been developed (see, e.g., Wang, et al. (2006) Annu. Rev. Biomol. Struct. 35: 225-249). [0095] It has been surprisingly discovered by the present inventors that bacteria can be genetically modified to be able to express a protein having a nonstandard amino acid and can be used for in vivo diagnostic and therapeutic methods which allow for the prolonged monitoring of the bacteria, as well as for the use of the bacteria in multiple therapeutic and diagnostic methods. The engineered bacteria described herein are capable of expressing a protein of interest having at least one non-standard amino acid comprises a bioorthogonal reactive functional group. By using the engineered bacteria and methods described herein, the engineered bacteria can be safely administered to a subject, allowed to colonize and/or engraft in the subject, and subsequently be triggered (e.g., with an inducer) to express a protein having a nonstandard amino acid bearing a bioorthogonal reactive functional group. These proteins can then be reacted with a variety of molecular entities (e.g., detectable probes and/or drugs) for a multitude of clinical applications in a non- invasive manner. For example, multiple nonstandard amino acids having distinct bioorthogonal reactive functional groups have been developed and may be used in the present invention (see, e.g., Lang and Chin (2014) Chem. Rev. 114: 4764-4806; hereby incorporated by reference in its entirety). In some embodiments, the engineered bacteria described herein are labeled by reacting the bioorthogonal reactive functional group of the nonstandard amino acid with a bioorthogonal reactive functional group of a detectable moiety, such as a dye or MRI contrast agent. Thus, in one embodiment of the present invention the engineered bacteria described herein can be administered to a subject, modified to comprise a detectable moiety and/or drug and be used for variety of diagnostic and/or therapeutic methods to, for example, image tissues and organs of a subject.
[0096] In order that the disclosure may be more readily understood, certain terms are first defined. These definitions should be read in light of the remainder of the disclosure and as understood by a person of ordinary skill in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art. Additional definitions are set forth throughout the detailed description.
Definitions
[0097] As used herein, the term "engineered bacterium" or "engineered bacterial cell" refers to a bacterial cell that has been genetically modified from their native state. For instance, an engineered bacterial cell may have nucleotide insertions, nucleotide deletions, nucleotide rearrangements, and nucleotide modifications introduced into their DNA. These genetic modifications may be present in the chromosome of the bacteria or bacterial cell, or on a plasmid in the bacteria or bacterial cell. Engineered bacterial cells of the disclosure may comprise exogenous nucleotide sequences on plasmids. Alternatively, recombinant bacterial cells may comprise exogenous nucleotide sequences stably incorporated into their
chromosome. In some embodiments, the engineered bacterium is non-pathogenic. In some embodiments, the engineered bacterium is pathogenic.
[0098] "Probiotic", as used herein, refers to a live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism. In some embodiments, the host organism is a mammal. In some embodiments, the host organism is a human. Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic bacteria. Examples of probiotic bacteria include, but are not limited to, Bifidobacteria, Escherichia coli, Lactobacillus, and Saccharomyces, e.g., Bifidobacterium bifidum,
Enterococcus faecium, Escherichia coli strain Nissle, Lactobacillus acidophilus,
Lactobacillus bulgaricus, Lactobacillus paracasei, and Lactobacillus plantarum. The probiotic may be a variant or a mutant strain of bacterium. Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g.,
survivability. Non-pathogenic bacteria may be genetically engineered to provide probiotic properties. Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
[0099] As used herein, the term "gene" refers to a nucleic acid fragment that encodes a protein or fragment thereof, optionally including regulatory sequences preceding (5' non- coding sequences) and following (3' non-coding sequences) the coding sequence. In one embodiment, a "gene" does not include regulatory sequences preceding and following the coding sequence.
[00100] As used herein, a "heterologous" gene or "heterologous sequence" refers to a nucleotide sequence that is not normally found in a given cell in nature. As used herein, a heterologous sequence encompasses a nucleic acid sequence that is exogenously introduced into a given cell. "Heterologous gene" includes a native gene, or fragment thereof, that has been introduced into the host cell in a form that is different from the corresponding native gene. A heterologous gene may include a native gene, or fragment thereof, introduced into a non-native host cell. Thus, a heterologous gene may be foreign or native to the recipient cell; a nucleic acid sequence that is naturally found in a given cell but expresses an unnatural amount of the nucleic acid and/or the polypeptide which it encodes; and/or two or more nucleic acid sequences that are not found in the same relationship to each other in nature. As used herein, the term "endogenous gene" refers to a native gene in its natural location in the genome of an organism. As used herein, the term "transgene" refers to a gene that has been introduced into the host organism, e.g., host bacterial cell's genome.
[00101] A "labeling codon", as used herein in reference to DNA, refers to an assembly of three or more nucleotides in a deoxyribonucleic acid molecule which are transcribed to three or more nucleosides of a ribonucleic acid molecule that are specifically recognized and/or decoded by an orthogonal tRNA, but are not recognized and/or decoded by an endogenous tRNA. A "labeling codon", as used herein in reference to RNA, refers to an assembly of three or more nucleosides in a ribonucleic acid molecule that are specifically recognized and/or decoded by an orthogonal tRNA, but are not recognized and/or decoded by an endogenous tRNA. It will be readily understood to one of skill in the art that when transcribed, the thymine ("T") nucleotides of a DNA molecule are converted to uracil ("U") nucleosides. Thus, a labeling codon in a DNA molecule comprising one or more thymines will comprise uracils at the corresponding position when transcribed to RNA (e.g., mRNA).
[00102] A "promoter" as used herein, refers to a nucleotide sequence that is capable of controlling the expression of a coding sequence or gene. Promoters are generally located 5' of the sequence that they regulate. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from promoters found in nature, and/or comprise synthetic nucleotide segments. Those skilled in the art will readily ascertain that different promoters may regulate expression of a coding sequence or gene in response to a particular stimulus, e.g., in a cell-specific or tissue- specific manner, in response to different environmental or physiological conditions, or in response to specific compounds.
Prokaryotic promoters are typically classified into two classes: inducible and constitutive.
[00103] "Constitutive promoter" refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked. Constitutive promoters and variants are well known in the art and include, but are not limited to, a constitutive Escherichia coli σ promoter, a constitutive Escherichia coli σ 32 promoter, a consti ·tuti ·ve Escherichia coli σ 70 promoter, a constitutive Bacillus subtilis σ promoter, a constitutive Bacillus subtilis σ promoter, and a bacteriophage T7 promoter.
[00104] An "inducible promoter" refers to a promoter that initiates increased levels of transcription of the coding sequence or gene under its control in response to a stimulus or an exogenous environmental condition. A "directly inducible promoter" refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a protein or polypeptide, where, in the presence of an inducer of said regulatory region, the protein or polypeptide is expressed. An "indirectly inducible promoter" refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a first gene encoding a first protein, polypeptide, or factor, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a second gene, the second regulatory region may be activated or repressed, thereby activating or repressing expression of the second gene. Both a directly inducible promoter and an indirectly inducible promoter are encompassed by "inducible promoter." [00105] As used herein the term "bioorthogonal reactive functional group" refers to a chemical moiety that mediates a chemical reaction with another chemical moiety, whereby the chemical reaction can occur inside of a living system with minimal interference of native biochemical processes. A "bioorthogonal reaction", as used herein, is a reaction between two bioorthogonal reactive functional groups typically proceed under physiological conditions that results in a covalent bond that is stable under physiological conditions.
[00106] As used herein, "click chemistry reaction" refers to a chemical reaction occurring between a pair of terminal reactive moieties that rapidly and selectively react ("click") with each other to form a targeting or effector moiety conjugated binding polypeptide. Click chemistry reactions can be categorized into two separate groups: copper (Cu(I))-catalyzed and copper-free. The Cu(I)-catalyzed azide-alkyne click chemistry reaction relies on the presence of Cu(I) ions whereas the copper-free reactions proceed without metal catalysis (e.g. , the Staudinger Ligation or the azide-phosphine reaction).
[00107] A "nonstandard amino acid", as used herein refers to any amino acid, other than the standard amino acids that are the building blocks of polypeptides of most organisms, including alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. In some embodiments, the nonstandard amino acid comprises a bioorthogonal reactive functional group. As used herein, the term
"nonstandard biorthogonal functional amino acid" refers to any nonstandard amino acid which comprises a bioorthogonal reactive functional group.
[00108] As used herein, the term "expression" refers to the transcription and stable accumulation of sense (mRNA) or anti-sense RNA derived from a nucleic acid, and/or to translation of an mRNA into a polypeptide [00109] The term "genetic modification," as used herein, refers to any genetic change.
Exemplary genetic modifications include those that increase, decrease, or abolish the expression of a gene, including, for example, modifications of native chromosomal or extrachromosomal genetic material. Exemplary genetic modifications also include the introduction of at least one plasmid, modification, mutation, base deletion, base addition, and/or codon modification of chromosomal or extrachromosomal genetic sequence(s), gene over-expression, gene amplification, gene suppression, promoter modification or substitution, gene addition (either single or multi-copy), antisense expression or suppression, or any other change to the genetic elements of a host cell, whether the change produces a change in phenotype or not. Genetic modification can include the introduction of a plasmid, e.g. , a plasmid comprising at least one amino acid catabolism enzyme operably linked to a promoter, into a bacterial cell. Genetic modification can also involve a targeted replacement in the chromosome, e.g. , to replace a native gene promoter with an inducible promoter, regulated promoter, strong promoter, or constitutive promoter. Genetic modification can also involve gene amplification, e.g. , introduction of at least one additional copy of a native gene into the chromosome of the cell. Alternatively, chromosomal genetic modification can involve a genetic mutation.
[00110] A "pharmaceutical composition," as used herein, refers to a composition comprising an active ingredient (e.g., a bacterial cell, an inducer, a drug, or a detectable compound) with other components such as a physiologically suitable carrier and/or excipient.
[00111] As used herein, the term "pharmaceutically acceptable" or "pharmacologically acceptable" refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. Moreover, for animal (e.g. , human) administration, it will be understood that compositions should meet sterility, pyrogenicity, general safety and purity standards as required by the FDA Office of Biological Standards.
[00112] As used herein, the term "pharmaceutically acceptable excipient" means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g. , lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be "acceptable" in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and/or polyanhydrides; (22) bulking agents, such as polypeptides and amino acids (23) serum component, such as serum albumin, HDL and LDL; (22) C2-C12 alcohols, such as ethanol; and (23) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, disintegrating agents, binders, sweetening agents, flavoring agents, perfuming agents, protease inhibitors, plasticizers, emulsifiers, stabilizing agents, viscosity increasing agents, film forming agents, solubilizing agents, surfactants,
preservative and antioxidants can also be present in the formulation. The terms such as "excipient", "carrier", "pharmaceutically acceptable excipient" or the like are used interchangeably herein.
[00113] The term "orthogonal", as used herein, when referring to a heterologous translation system, or to a heterologous component of the translation system (e.g. , a heterologous amino acyl synthetase), refers to the ability of an aminoacyl synthetase and/or tRNA to function independently of the aminoacyl synthetases and tRNAs endogenous to the host bacterium.
[00114] As used herein, the term "orthogonal aminoacyl tRNA synthetase" refers to an enzyme that does not specifically aminoacylate endogenous tRNAs of the host bacterium, but specifically aminoacylates its cognate orthogonal tRNA.
[00115] As used herein, the term "orthogonal tRNA" refers to a tRNA that is not a substrate for the endogenous aminoacyl tRNA synthetases of a host bacterium, but specifically interacts with an orthogonal aminoacyl tRNA synthetase. In some embodiments, the orthogonal tRNA directs the translation incorporation of a nonstandard amino acid of an orthogonal aminoacyl tRNA synthetase in response to a specific codon (e.g. , the UAG codon, also known as the amber stop codon).
[00116] A "plasmid" or "vector" includes a nucleic acid construct designed for delivery to a host cell or transfer between different host cell. An "expression plasmid" or "expression vector" can be a plasmid that has the ability to incorporate and express heterologous nucleic acid fragments in a cell. An expression plasmid may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms. The nucleic acid incorporated into the plasmid can be operatively linked to an expression control sequence when the expression control sequence controls and regulates the transcription and translation of that
polynucleotide sequence.
[00117] As used herein, a "biofilm" refers to a mass of microorganisms which can adhere or is adhering to a surface. A biofilm comprises a matrix of extracellular polymeric substances, including, but not limited to extracellular DNA, proteins, glycopeptides, and polysaccharides. The nature of a biofilm, such as its structure and composition, can depend on the particular species of bacteria present in the biofilm. Bacteria present in a biofilm are commonly genetically or phenotypically different than corresponding bacteria not in a biofilm, such as isolated bacteria or bacteria in a colony. Conditions suitable for the production of a biofilm can include, but are not limited to, conditions under which the microbial cell is capable of logarithmic growth and/or polypeptide synthesis. Conditions may vary depending upon the species and strain of microbial cell selected. Conditions for the culture of microbial cells are well known in the art. Biofilm production can also be induced and/or enhanced by methods well known in the art, e.g. contacting cells with subinhibitory concentrations of beta- lactam or aminoglycoside antibiotics, exposing cells to fluid flow, contacting cells with exogenous poly-N-acetylglucosamine (PNAG), or contacting cells with quorum sensing signal molecules. In some embodiments, conditions suitable for the production of a biofilm can also include conditions which increase the expression and secretion of CsgA, e.g. by exogenously expressing CsgD.
[00118] As used herein, the terms "protein" and "polypeptide" are used
interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues. The terms "protein", and "polypeptide" refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function. "Protein" and "polypeptide" are often used in reference to relatively large polypeptides, whereas the term "peptide" is often used in reference to small polypeptides, but usage of these terms in the art overlaps. The terms "protein" and
"polypeptide" are used interchangeably herein when referring to a gene product and fragments thereof. Thus, exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
[00119] A "nucleic acid" or "nucleic acid sequence" may be any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof. The nucleic acid can be either single- stranded or double-stranded. A single- stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single- stranded nucleic acid not derived from any double- stranded DNA. In one aspect, the nucleic acid can be DNA. In another aspect, the nucleic acid can be RNA. Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
[00120] The term "non-pathogenic" as used herein to refer to bacteria refers to bacteria that are not capable of causing disease or harmful responses in a host. In some embodiments, non-pathogenic bacteria are commensal bacteria. Examples of non-pathogenic bacteria include, but are not limited to Bacillus, Bacteroides, Bifidobacterium, Brevibacteria,
Clostridium, Enterococcus, Escherichia coli, e.g., Escherichia coli Nissle 1917,
Lactobacillus, Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyri m. Enterococcus faecium, Lactobacillus acidophilus,
Lactobacillus bulgaricus, Lactobacillus casei, Lactobacillus johnsonii, Lactobacillus paracasei, Lactobacillus plantarum, Lactobacillus reuteri, Lactobacillus rhamnosus, and Lactococcus lactis. Naturally pathogenic bacteria may be genetically engineered to provide reduce or eliminate pathogenicity.
[00121] The articles "a" and "an," as used herein, should be understood to mean "at least one," unless clearly indicated to the contrary. For example, as used herein, "a heterologous gene encoding an amino acid catabolism enzyme" should be understood to mean "at least one heterologous gene encoding at least one amino acid catabolism enzyme." Similarly, as used herein, "a heterologous gene encoding an amino acid importer" should be understood to mean "at least one heterologous gene encoding at least one amino acid importer."
[00122] The phrase "and/or," when used between elements in a list, is intended to mean either (1) that only a single listed element is present, or (2) that more than one element of the list is present. For example, "A, B, and/or C" indicates that the selection may be A alone; B alone; C alone; A and B; A and C; B and C; or A, B, and C. The phrase "and/or" may be used interchangeably with "at least one of or "one or more of the elements in a list.
[00123] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
Engineered Bacteria of the Invention
[00124] In one aspect, the engineered bacterium has been genetically modified to comprise an orthogonal translation system. In some embodiment, the orthogonal translation system is composed of a heterologous gene encoding an orthogonal aminoacyl synthetase and a heterologous gene encoding an orthogonal tRNA. The orthogonal translation system allows the engineered bacterium to incorporate one or more nonstandard amino acids into a protein expressed by the bacterium.
[00125] In some embodiments, the orthogonal translation system is located in the bacterial genome. In some embodiments, the orthogonal translation system is located in a plasmid. In some embodiments, the orthogonal translation system is located in plasmid pEVOL-pAzF (described, e.g., in Chin et al. (2002) J. Am. Chem. Soc. 124(31): 9026-7; Rovner et al. (2015) Nature 518(7537): 89-93, which are incorporated herein by reference). In some embodiments, the heterologous gene encoding a component of the orthogonal translation system is located in the bacterial genome. In some embodiments, the
heterologous gene encoding a component of the orthogonal translation system is located in a plasmid. In some embodiments, the heterologous gene encoding an orthogonal aminoacyl synthetase is located in the bacterial genome. In some embodiments, the heterologous gene encoding an orthogonal aminoacyl synthetase is located in a plasmid. In some embodiments, the heterologous gene encoding an orthogonal tRNA is located in the bacterial genome. In some embodiments, the heterologous gene encoding an orthogonal tRNA is located in a plasmid.
[00126] In some embodiments, the orthogonal translation system includes a tRNA that decodes or recognizes a specific codon (i.e., a labeling codon) that is not decoded and/or recognized by any endogenous tRNA, and as aminoacyl tRNA synthetase that preferentially aminoacylates a cognate tRNA with a specific nonstandard amino acid. For example, if the bacterium expressing the orthogonal translation system is of the species Lactobacillus lactis, the orthogonal translation system will comprise an aminoacyl tRNA synthetase that does not preferentially aminoacylate endogenous L. lactis tRNAs. The orthogonal translation system will further comprise an orthogonal tRNA that is minimally, or not at all, aminoacylated by an endogenous L. lactis aminoacyl tRNA synthetase.
[00127] In some embodiments, the orthogonal translation system is from, or is derived from, an Archea translational system. In some embodiments, the orthogonal translation system is from, or is derived from, an bacterial translation system. In some embodiments, the orthogonal translations system is an engineered translation system. In some embodiments, the orthogonal translation system is a naturally-occurring translation system. In some embodiments, the orthogonal translations system is from, or is derived from, a
Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus translation system. In some embodiments, the orthogonal translation system is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii translation system.
[00128] In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, an Archea aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, an bacterial aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is an engineered aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is a naturally-occurring aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl synthetase. In some embodiments, the orthogonal aminoacyl synthetase is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl synthetase.
[00129] In some embodiments, the orthogonal tRNA is from, or is derived from, an
Archea tRNA. In some embodiments, the orthogonal tRNA is from, or is derived from, a bacterial tRNA. In some embodiments, the orthogonal tRNA is an engineered tRNA. In some embodiments, the orthogonal tRNA is a naturally-occurring tRNA. In some
embodiments, the orthogonal tRNA is from, or is derived from, a Methanosarcina,
Desufitobacterium, Pyrococcus or Methanocaldococcus tRNA. In some embodiments, the orthogonal tRNA is from, or is derived from, a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii tRNA.
[00130] Orthogonal translation systems, orthogonal aminoacyl synthetases and/or an orthogonal tRNAs for use in the present invention may be selected based on their ability to incorporate a specific nonstandard amino acid and/or based on their ability to recognize a specific labeling codon. In some embodiments, the orthogonal aminoacyl synthetase and the orthogonal tRNA are from, or are derived from, the same organism. In some embodiments, the orthogonal aminoacyl synthetase and the orthogonal tRNA are from, or are derived from, different organisms.
[00131] In some embodiments, the orthogonal aminoacyl synthetase and/or orthogonal tRNA is from, or is derived from, an organism selected from the group consisting of
Methanosarcina mazei, Methanosarcina acetovorans, Methanosarcina barken,
Methanosarcina frisia, Methanosarcina thermophila, Methanosarcina vacolata,
Desulfitobacterium hqfhiense, Methanococcus jannaschii, Methanobacterium
thermoautotrophicum, Haloferax volcanii, Archaeo globus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, Methanococcus maripaludis, Methanopyrus kandleri, Methanosarcina mazei, Pyrobaculum aerophilum, Pyrococcus abyssi, Sulfolobus solfataricus, Sulfolobus tokodaii, Thermoplasma acidophilum, and Thermoplasma volcanium. Multiple orthogonal translation systems, and methods for producing orthogonal translation systems, are known in the art and can be used as described herein (see, e.g., PCT Publication Numbers WO 2005/007624; WO 2002/086075; WO 2002/085923; WO 2004/094593; WO 2005/019415; WO 2005/007870; WO 2006/110182; and WO 2007/103490; which are all incorporated by reference herein in their entireties).
[00132] In some embodiments, the engineered bacterium comprises more than one orthogonal translation system, thus allowing for the incorporation of more than one type of nonstandard amino acid into a protein of interest. In some embodiments, when more than one orthogonal translation system is used, each of the orthogonal translation systems may recognize the same and/or different labeling codons. [00133] In embodiments where the engineered bacterium comprises more than one orthogonal translation system, one or more than one labeling codon(s) may be used as described herein. Thus, multiple same or different nonstandard amino acid may be incorporated into a protein of interest by using different labeling codons.
[00134] In some embodiments, the engineered bacterium described herein comprises a heterologous nucleic acid comprising a labeling codon. A labeling codon that is not recognized by the endogenous translation machinery of a bacterial cell results in a blockade of the translation of the polypeptide being produced. However, in the presence of an orthogonal translation system, the aminoacyl tRNA synthetase/tRNA pair of the system recognizes the labeling codon and loads an amino acid (e.g. , a nonstandard amino acid) in response to the labeling codon, thereby suppressing the blockade of translation.
[00135] Labeling codons for use in the present invention expand the genetic codon framework of the bacterium. In some embodiments, the labeling codon is a three base codon. In some embodiments, the labeling codon is a nonsense codon. In some
embodiments, the labeling codon is a stop codon (e.g. , an amber codon (TAG), an ochre codon (TAA), or an opal codon (TGA)). In some embodiments, the labeling codon is an unnatural codon. In some embodiments, the labeling codon is an extended codon (e.g., a codon comprising four or more bases). In some embodiments, the labeling codon comprises four bases (e.g. , CTAG, AGGA, TAGA, CCCT). In some embodiments, the labeling codon comprises five bases (e.g. , AGGAC, CCCCT, CCCTC, CTAGA, CTACT, TAGGC). In some embodiments, the labeling codon comprises six bases. In some embodiments, the labeling codon comprises seven or more bases.
[00136] In some embodiments, the labeling codon is a three base codon that is not used by the bacterium' s translational machinery. In some embodiments, the labeling codon is a three base codon that is rarely used by the bacterium' s translational machinery. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce the abundance of the labeling codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to remove the labeling codon. In some embodiments, the engineered bacterium comprises a genome that has been recoded to reduce the abundance of the labeling codon TAG. In some embodiments, the engineered bacterium comprises a genome that has been recoded to remove the labeling codon TAG.
[00137] In embodiments where the engineered bacterium comprises more than one orthogonal translation system such that more labeling codons may be used as described herein. Thus, multiple same or different nonstandard amino acid may be incorporated into a polypeptide of interest by using different labeling codons.
[00138] In some embodiments, the engineered bacterium described herein comprises a heterologous nucleic acid comprising a labeling codon. In some embodiments, the heterologous nucleic acid is located in the bacterial genome. In some embodiments, the heterologous gene is located in a plasmid. In some embodiments, the expression of the heterologous nucleic acid is under the control of a constitutive promoter (e.g. , a constitutive promoter disclosed herein). In some embodiments, the heterologous nucleic acid is under the control of an inducible promoter (e.g. , an inducible promoter disclosed herein). In some embodiments, the heterologous nucleic acid comprises one labeling codon. In some embodiments, the heterologous nucleic acid comprises more than one labeling codon. In some embodiments, the heterologous nucleic acid comprises one, two, three, four, five, six, seven, eight or more labeling codons. Labeling codons may be introduced into the heterologous nucleic acid using methods known in the art, including, e.g., site-directed mutagenesis).
[00139] In some embodiments, the heterologous nucleic acid comprises a labeling codon and a heterologous gene encoding a protein. In some embodiments, the heterologous nucleic acid further encodes a polypeptide linker sequence. In some embodiments, the polypeptide linker sequence is flexible. In some embodiments, the heterologous nucleic acid further encodes a polypeptide tag. In some embodiments, the labeling codon is located at a nucleic acid position corresponding to the open reading frame of the protein. In some embodiments, the labeling codon is not located at a nucleic acid position corresponding to the open reading frame of the protein. In some embodiments, the labeling codon is located at a nucleic acid position corresponding to the open reading frame of the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence. In some embodiments, the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
[00140] In some embodiments, the engineered bacterium described herein comprises a protein having a nonstandard amino acid. In some embodiments, the protein comprises one nonstandard amino acid. In one embodiment, the non standard amino acid does not interfere with the structural fold, function, enzymatic activity and/or location of the protein. In one embodiment, the non standard amino acid interferes with the structural fold, function, enzymatic activity and/or location of the protein. In some embodiments, the protein comprises more than one nonstandard amino acid. In some embodiments where the protein comprises multiple nonstandard amino acids, one or more of the nonstandard amino acids does not interfere with the structural fold, function, enzymatic activity and/or location of the protein. In some embodiments where the protein comprises multiple nonstandard amino acids, one or more of the nonstandard amino acids interfere with the structural fold, function, enzymatic activity and/or location of the protein. In some embodiments, the protein comprises two, three, four five, six, seven, eight, or more nonstandard amino acids. Multiple nonstandard amino acids are know in the art and can be used as described herein (see, e.g., Lang and Chin (2014) Chem. Rev. 114: 4764-806, which is incorporated herein by reference in its entirety).
[00141] In some embodiments, the nonstandard amino acid comprises a bioorthogonal reactive functional group. In some embodiments, the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), p- bromophenylalanine (p-BrF), /?-iodophenylalanine (p-lF), /?-ethynylphenylalanine (p-EtF), /?ara-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra). In one embodiment, the non-standard amino acid is p-AzF.
[00142] In some embodiments, the non-standard amino acid comprises a bioorthogonal reactive functional group. In some embodiments, the detectable moiety comprises a bioorthogonal reactive functional group. Multiple bioorthogonal reactive functional groups are known in the art and can be used in the methods described herein (see, e.g. , Lang and Chin (2014)). In some embodiments, the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkene moiety, an alkyne moiety, a tetrazine moiety, and a norbornene moiety. In some embodiments, the
bioorthogonal reactive functional group is able to participate in a click chemistry reaction with a second bioorthogonal reactive functional group (e.g. , a bioorthogonal reactive functional group present on a drug or detectable compound). Multiple click chemistry reactions are known in the art (see, e.g., Lang and Chin (2014)).
[00143] Any protein can be expressed in the engineered bacterium described herein to incorporate a nonstandard amino acid. In some embodiments, the protein is a secreted protein. In some embodiments, the protein is a non-secreted protein. In some embodiments, the protein is a membrane protein. In some embodiments, the protein is a cytosolic protein. In some embodiments, the protein is a nuclear protein. In some embodiments, the protein is an enzyme. In some embodiments, the protein is an extracellular matrix protein. In some embodiments, the protein is a bio film protein. In some embodiments, the protein is a fiber protein (e.g., a curli fiber protein). In some embodiments, the protein is a pilin protein.
[00144] In some embodiments the protein is CsgA. CsgA is the major structural subunit of curli. The sequences of CsgA and its homologs are known in a number of species, e.g., E. coli (NCBI Gene ID NO: 949055; NCBI Ref Seq: NP_415560). In some
embodiments, the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA.
[00145] In some embodiments, the protein is Trat. TraT is an outer membrane lipoprotein encoded by the tra operon. In some embodiments, the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type TraT.
[00146] In some embodiments, the protein is InaV. In some embodiments, the protein is InaV and the nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
[00147] In some embodiments, the protein is maltose binding protein (MBP). In some embodiments, the protein is MBP and the nonstandard amino acid is located at an amino acid residue corresponding to residue 67 of wild-type MBP.
[00148] In some embodiments, the protein expressed by the engineered bacterium described herein comprises a polypeptide tag. In some embodiments, the protein comprises more than one polypeptide tag. In some embodiments, the protein comprises two, three, four, or more polypeptide tags. Multiple polypeptide tags are known in the art and can be used as described herein. Exemplary polypeptide tags for use in the methods described herein include, but are not limited to, the polypeptide tags shown in Table 1. In one embodiment, the polypeptide tag is at the N-terminus of the protein. In one embodiment, the polypeptide tag is at the C-terminus of the protein. In one embodiment, the polypeptide tag is located between two domains of the protein.
Table 1. Exemplary polypeptide tags
Figure imgf000036_0001
DY DDDDK CSEQ ID NO: 3 ) or
DYKDDDK (SEQ I D NO: 4)
HA YPYDVPDYA i SEQ ID NO: 5) or
YAYDVPDYA (SEQ ID NO: 6) or
YDVPDYASL (SEQ ID NO: 7)
Myc EQKLISEEDL (SEQ ID NO: S)
poly His HHHHHH (SEQ ID NO: 9)
S-tag ETA AA KFERQHMDS (SEQ ID NO: 10)
V5 G PIPNPLLGLDST (SEQ ID NO: 1 1 )
[00149] In some embodiments, the protein expressed by the engineered bacterium described herein comprises a polypeptide linker. In some embodiments, the polypeptide linker is one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, twenty-five, thirty, thirty- five, forty, forty-five, fifty, or more amino acids in length. In some embodiments, the polypeptide linker is twelve, twenty-four, thirty-six, forty-eight, sixty, seventy-two, eighty- four, or ninety-six amino acids in length. In some embodiments, the polypeptide linker is N- terminus of the protein. In some embodiments, the polypeptide linker is C-terminus of the protein. In some embodiments, the polypeptide linker is located between a domain of the protein and a polypeptide tag. In some embodiments, the polypeptide linker is located between two domains of the protein. In some embodiments, the polypeptide linker is flexible. In some embodiments, the polypeptide linker is rigid. In some embodiment, the polypeptide linker comprises a nonstandard amino acid.
[00150] Many plasmids (also referred to as "vectors" herein) useful for transferring genes into bacterial cells are available. The plasmids may be episomal or may be integrated into the bacterial cell's genome through homologous recombination or random integration. In some embodiments, is an expression vector. A plasmid can be viral or non-viral. Plasmids for use as described herein can include, but are not limited to, pEVOL (see Young et al.
(2010) J. Mol. Biol. 395: 361-74, which is incorporated hereby by reference in its entirety), pBR322, pBR325, pACYC177, pACYC184, pUC8, pUC9, pUC18, pUC19, pLG339, pR290, pKC37, pKClOl, SV 40, pBluescript II SK +/- or KS +/- (see "Stratagene Cloning Systems" Catalog (1993) from Stratagene, La Jolla, Calif, which is hereby incorporated by reference), pQE, pIH821, pGEX, pET series (see Studier et al. (1990) "Use of T7 RNA Polymerase to Direct Expression of Cloned Genes," Gene Expression Technology 185, which is hereby incorporated by reference in its entirety). [00151] The expression of any of the genes incorporated into the engineered bacterium described herein may be regulated using any promoter known in the art. In some
embodiments, the promoter is a constitutive promoter. In some embodiments, the promoter is an inducible promoter. An "inducible promoter" may be one that is characterized by initiating or enhancing transcriptional activity when in the presence of, influenced by, or contacted by an inducer or inducing agent than when not in the presence of, under the influence of, or in contact with the inducer or inducing agent. An "inducer" or "inducing agent" may be endogenous, or a normally exogenous compound or protein that is
administered in such a way as to be active in inducing transcriptional activity from the inducible promoter. In some embodiments, the inducer or inducing agent, e.g., a chemical, a compound or a protein, can itself be the result of transcription or expression of a nucleic acid sequence (e.g., an inducer can be a transcriptional repressor protein), which itself may be under the control or an inducible promoter. Non-limiting examples of inducible promoters include but are not limited to, the lac operon promoter, a nitrogen- sensitive promoter, an IPTG-inducible promoter, a salt-inducible promoter, tetracycline-inducible promoter, the lambda phage pL promoter, steroid-responsive promoters, rapamycin responsive promoters and the like. Inducible promoters for use in prokaryotic systems are well known in the art, see, e.g. the β-lactamase and lactose promoter systems (Chang et al. (1978) Nature 275: 615, which is incorporated herein by reference; Goeddel et al. (1979) Nature 281: 544, which is incorporated herein by reference), the arabinose promoter system, including the araBAD promoter (Guzman et al. (1992) . Bacteriol. 114: 7716-28, which is incorporated herein by reference; Guzman et al. (1995) J. Bacteriol., Ill: 4121-30, which is incorporated herein by reference; Siegele and Hu (1997) Proc. Natl. Acad. Sci. USA 94: 8168-72, which is incorporated herein by reference), the rhamnose promoter (Haldimann et al. (1998) J.
Bacteriol. 180: 1277-86, which is incorporated herein by reference), the alkaline phosphatase promoter, a tryptophan (trp) promoter system (Goeddel (1980) Nucleic Acids Res., 8: 4057, which is incorporated herein by reference), the PLtetO-1 and Plac/are-1 promoters (Lutz and Bujard (1997) Nucleic Acids Res. 25: 1203-10, which is incorporated herein by reference), the phage lambda pL promoter system and pR promoter system (Simmons et al. (1984) Gene 28(1): 55-64; Gilman and Love (2016) Biochem. Soc. Trans. 44(3): 731-7; and Valdez-Cruz et al. (2010) Microb. Cell Fact. 9: 18. which are incorporated herein by reference), and hybrid promoters such as the tac promoter (see deBoer et al. (1983) Proc. Natl. Acad. Sci. USA 80: 21-5, which is incorporated herein by reference). [00152] An inducible promoter useful in the methods and systems as disclosed herein can be induced by one or more physiological conditions, such as changes in pH, temperature, radiation, osmotic pressure, saline gradients, cell surface binding, and the concentration of one or more extrinsic or intrinsic inducing agents. The extrinsic inducer or inducing agent may comprise amino acids and amino acid analogs, saccharides and polysaccharides, nucleic acids, protein transcriptional activators and repressors, cytokines, toxins, petroleum-based compounds, metal containing compounds, salts, ions, enzyme substrate analogs, hormones, and combinations thereof. In specific embodiments, the inducible promoter is activated or repressed in response to a change of an environmental condition, such as the change in concentration of a chemical, metal, temperature, radiation, nutrient or change in pH. Thus, an inducible promoter useful in the methods and systems as disclosed herein can be a phage inducible promoter, nutrient inducible promoter, temperature inducible promoter, radiation inducible promoter, metal inducible promoter, hormone inducible promoter, steroid inducible promoter, and/or hybrids and combinations thereof. Appropriate environmental inducers can include, but are not limited to, exposure to heat (i.e., thermal pulses or constant heat exposure), various steroidal compounds, divalent cations (including Cu2+, Ca2+, and Zn2+), galactose, arabinose, anhydrotetracycline (ATc), tetracycline, IPTG (isopropyl-P-D thiogalactoside), as well as other naturally occurring and synthetic inducing agents and gratuitous inducers.
[00153] Inducible promoters useful in the methods and systems as disclosed herein also include those that are repressed by "transcriptional repressors" that are subject to inactivation by the action of environmental, external agents, or the product of another gene. Such inducible promoters may also be termed "repressible promoters" where it is required to distinguish between other types of promoters in a given module or component of the biological switch converters described herein. Preferred repressors for use in the present invention are sensitive to inactivation by physiologically benign agent. Thus, where a lac repressor protein is used to control the expression of a promoter sequence that has been engineered to contain a lacO operator sequence, treatment of the host cell with IPTG will cause the dissociation of the lac repressor from the engineered promoter containing a lacO operator sequence and allow transcription to occur. Similarly, where a tet repressor is used to control the expression of a promoter sequence that has been engineered to contain a tetO operator sequence, treatment of the host cell with tetracycline, or the tetracycline analog anhydrotetracycline (ATc), will cause the dissociation of the tet repressor from the engineered promoter and allow transcription of the sequence downstream of the engineered promoter to occur.
[00154] Bacteria for use in the methods and compositions described herein can be of any species. Preferably, the bacteria are of a species and/or strain which is amenable to culture and genetic manipulation. In some embodiments, the bacterium is a gram-positive bacterium. In some embodiments, the bacterium is a gram-negative bacterium. In some embodiments, the bacterium is a probiotic. In some embodiments, the bacterium is Generally Recognized as Safe (GRAS) by a regulatory authority. In some embodiments, the bacterium is pathogenic. In some embodiments, the bacterium is non-pathogenic. In some embodiments, the bacterium is an attenuated pathogenic bacterium. In some embodiments, the parental strain of the bacterium used herein is of a strain optimized for protein expression.
[00155] Non- limiting examples of bacterial species and strains suitable for use in the present technologies include Escherichia coli, E. coli BL21, E. coli Tuner, E. coli Rosetta, E. coli JMlOl, and derivatives of any of the foregoing. In one embodiment, the bacterium is of the E. coli Nissle 1917 strain. Other non-pathogenic bacterial strains known to those of skill in the art such as MG1655, K12-derived strains, and the like, may also be used.
[00156] In some embodiments, the parental strains of the bacterium described herein is optimized for use with an orthogonal translation system. In some embodiments, the bacterium is genetically modified (e.g., recoded) to reduce or eliminate a codon that is specifically recognized by the orthogonal translation system. Any codon may be reduced or eliminated from the genome of a bacterium described herein using methods known in the art. In some embodiments, the bacterium is genetically modified (e.g., recoded) to reduce or eliminate the TGA codon (see, e.g., Lajoie et al. (2013) Science 342(6156):357-60. In some embodiments, the bacterium is genetically modified (e.g., recoded) to reduce the codon TGA in the bacterial genome. In some embodiments, the bacterium is genetically modified (e.g., recoded) to eliminate the codon TGA in the bacterial genome. In some embodiments, the bacterium for use in the present invention comprise a deletion in the gene encoding peptide chain release factor 1 or a homo log thereof. In some embodiments, the bacterium for use in the present invention comprise a deletion of the prfA gene (see, e.g., Lajoie et al. (2013)). In some embodiments, the bacterium is of the Escherichia coli strain C321 (Addgene bacterial strain #48999). In some embodiments, the bacterium is of the Escherichia coli strain C321.AA (Addgene bacterial strain #48998). In some embodiments, the bacterium is of the Escherichia coli strain C321.AA.exp (Addgene bacterial strain #49018). [00157] In some embodiments, the bacterium for use in the present invention comprise a deletion of the endogenous gene encoding the protein in which a nonstandard amino acid is being incorporated. In some embodiments, the bacterium comprises a deletion in the csgA gene. In some embodiment, the bacterium comprises a deletion of a curli operon. In some embodiments, the bacterium comprises a deletion of one or more endogenous Csg genes. In some embodiments, the bacterium comprises a deletion of csgA. In some embodiments, the bacterium comprises a deletion of csgB. In some embodiments, the bacterium comprises a deletion of csgC. In some embodiments, the bacterium comprises a deletion of csgD. In some embodiments, the bacterium comprises a deletion of csgE. In some embodiments, the bacterium comprises a deletion of csgF. In some embodiments, the bacterium comprises a deletion of csgG. In some embodiments, the bacterium comprises a deletion of the csgBAC operon. In some embodiments, the bacterium comprises a deletion of the csgDEFG operon. In some embodiments, the bacterium comprises a deletion of the csgBAC and csgDEFG operons. In some embodiments, the bacterium comprises a deletion in the inaV gene. In some embodiments, the bacterium comprises a deletion in the traT gene. In some embodiments, the bacterium comprise a deletion in the malE gene.
Biofilms of the Invention
[00158] In one aspect, biofilms comprising the engineered bacterium described herein are also provided. In one aspect, the bio film comprises an engineered bacterium described herein and a protein comprising a nonstandard amino acid expressed by an engineered bacterium described herein. In some embodiments, the bio film comprises a protein comprising a nonstandard amino acid expressed by an engineered bacterium described herein. In some embodiments, the bio film comprises a bacterium {e.g., an engineered bacterial cell described herein). In some embodiments, the bio film does not comprise a bacterium {e.g., an engineered bacterial cell described herein). In some embodiments, the bio film comprises a curli fiber composed of bacterial extracellular matrix protein having a nonstandard amino acid. In some embodiments, the biofilm comprises curli fiber comprising CsgA protein having a nonstandard amino acid. In some embodiments, the nonstandard amino acid has been reacted with a detectable compound or drug as described herein.
Pharmaceutical Compositions of the Invention
[00159] Pharmaceutical compositions comprising the engineered bacterium described herein may be used to diagnose, treat, manage, ameliorate, and/or prevent a disease or disorder, as described herein Pharmaceutical compositions comprising one or more engineered bacteria, alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided.
[00160] In certain embodiments, the pharmaceutical composition comprises one species, strain, or subtype of bacteria that are engineered to comprise the genetic modifications described herein, e.g. , to express at least one orthogonal translation system and at least one protein comprising a nonstandard amino acid. In alternate embodiments, the pharmaceutical composition comprises two or more species, strains, and/or subtypes of bacteria that are each engineered to comprise the genetic modifications described herein, e.g. , to express at least one orthogonal translation system and at least one protein comprising a nonstandard amino acid.
[00161] The pharmaceutical compositions described herein may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into
compositions for pharmaceutical use. Methods of formulating pharmaceutical compositions are known in the art (see, e.g., "Remington's Pharmaceutical Sciences," Mack Publishing Co., Easton, PA). In some embodiments, the pharmaceutical compositions are subjected to tableting, lyophilizing, direct compression, conventional mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping, or spray drying to form tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated. Appropriate formulation depends on the route of
administration.
[00162] The engineered bacteria described herein may be formulated into pharmaceutical compositions in any suitable dosage form (e.g. , liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration) and for any suitable type of administration (e.g. , oral, topical, injectable, immediate-release, pulsatile-release, delayed-release, or sustained release). Suitable dosage amounts for the engineered bacteria may range from about 105 to 1012 bacteria, e.g. , approximately 105 bacteria, approximately 106 bacteria, approximately 107 bacteria, approximately 108 bacteria, approximately 109 bacteria, approximately 1010 bacteria,
11 12
approximately 10 bacteria, or approximately 10 bacteria. The composition may be administered once or more daily, weekly, or monthly.
[00163] The engineered bacterium may be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, nanoparticles, liposomes, penetration enhancers, carrier compounds, and other
pharmaceutically acceptable carriers or agents. Further, any one of the detectable compound, inducer, and/or nonstandard amino acid may also be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, nanoparticles, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents. For example, the pharmaceutical composition may include, but is not limited to, the addition of calcium bicarbonate, sodium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20. The engineered bacterium may be administered and formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc. The engineered bacterium disclosed herein may be administered topically and formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well-known to one of skill in the art. See, e.g.,
"Remington's Pharmaceutical Sciences," Mack Publishing Co., Easton, PA. In an
embodiment, for non-sprayable topical dosage forms, viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity greater than water are employed. Suitable formulations include, but are not limited to, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, etc., which may be sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, e.g. , osmotic pressure. Other suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g. , a gaseous propellant, such as freon) or in a squeeze bottle. Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms. Examples of such additional ingredients are well known in the art.
[00164] The pharmaceutical compositions disclosed herein may be administered orally and formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc. Pharmacological compositions for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores. Suitable excipients include, but are not limited to, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol;
cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium
carbomethylcellulose; and/or physiologically acceptable polymers such as
polyvinylpyrrolidone (PVP) or polyethylene glycol (PEG). Disintegrating agents may also be added, such as cross-linked polyvinylpyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate.
[00165] Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g. , pregelatinised maize starch,
polyvinylpyrrolidone, hydroxypropyl methylcellulose, carboxymethylcellulose, polyethylene glycol, sucrose, glucose, sorbitol, starch, gum, kaolin, and tragacanth); fillers (e.g. , lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g. , calcium, aluminum, zinc, stearic acid, polyethylene glycol, sodium lauryl sulfate, starch, sodium benzoate, L- leucine, magnesium stearate, talc, or silica); disintegrants (e.g., starch, potato starch, sodium starch glycolate, sugars, cellulose derivatives, silica powders); or wetting agents (e.g. , sodium lauryl sulphate). The tablets may be coated by methods well known in the art. A coating shell may be present, and common membranes include, but are not limited to, polylactide, polyglycolic acid, polyanhydride, other biodegradable polymers, alginate- polylysine-alginate (APA), alginate-polymethylene-co-guanidine-alginate (A-PMCG-A), hydro ymethylacry late- methyl methacrylate (HEMA-MMA), multilayered HEMA-MMA- MAA, polyacrylonitrilevinylchloride (PAN-PVC), acrylonitrile/sodium methallylsulfonate (AN-69), polyethylene glycol/poly pentamethylcyclopentasiloxane/polydimethylsiloxane (PEG/PD5/PDMS), poly N,N- dimethyl acrylamide (PDMAAm), siliceous encapsulates, cellulose sulphate/sodium alginate/polymethylene-co-guanidine (CS/A/PMCG), cellulose acetate phthalate, calcium alginate, k-carrageenan-locust bean gum gel beads, gellan-xanthan beads, poly(lactide-co-glycolides), carrageenan, starch poly-anhydrides, starch
polymethacrylates, polyamino acids, and enteric coating polymers.
[00166] In some embodiments, the pharmaceutical compositions may be enterically coated for release into the gut or a particular region of the gut, for example, the large intestine. The typical pH profile from the stomach to the colon is about 1-4 (stomach), 5.5-6 (duodenum), 7.3-8.0 (ileum), and 5.5-6.5 (colon). In some diseases, the pH profile may be modified. In some embodiments, the coating is degraded in specific pH environments in order to specify the site of release. In some embodiments, at least two coatings are used. In some
embodiments, the outside coating and the inside coating are degraded at different pH levels.
[00167] Liquid preparations for oral administration may take the form of solutions, syrups, suspensions, or a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable agents such as suspending agents (e.g. , sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate. Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of the engineered bacterium described herein.
[00168] In some embodiments, the pharmaceutical composition is formulated for intraintestinal administration, intrajejunal administration, intraduodenal administration, intraileal administration, gastric shunt administration, or intracolic administration, via nanoparticles, nanocapsules, microcapsules, or microtablets, which are enterically coated or uncoated. The pharmaceutical compositions may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g. , conventional suppository bases such as cocoa butter or other glycerides. The compositions may be suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain suspending, stabilizing and/or dispersing agents.
[00169] The pharmaceutical compositions described herein may be administered intranasally, formulated in an aerosol form, spray, mist, or in the form of drops, and conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant (e.g. , dichlorodifluoromethane,
trichlorofluoro methane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas). Pressurized aerosol dosage units may be determined by providing a valve to deliver a metered amount. Capsules and cartridges (e.g. , of gelatin) for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch. [00170] The pharmaceutical compositions may be administered and formulated as depot preparations. Such long acting formulations may be administered by implantation or by injection, including intravenous injection, subcutaneous injection, local injection, direct injection, or infusion. For example, the compositions may be formulated with suitable polymeric or hydrophobic materials (e.g. , as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (e.g., as a sparingly soluble salt).
[00171] In some embodiments, disclosed herein are pharmaceutically acceptable compositions in single dosage forms. Single dosage forms may be in a liquid or a solid form. Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration. In certain embodiments, a single dosage form may be administered in bolus form, e.g. , single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, lozenge, etc. In alternate
embodiments, a single dosage form may be administered over a period of time, e.g. , by infusion.
[00172] Single dosage forms of the pharmaceutical composition may be prepared by portioning the pharmaceutical composition into smaller aliquots, single dose containers, single dose liquid forms, or single dose solid forms, such as tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated. A single dose in a solid form may be reconstituted by adding liquid, typically sterile water or saline solution, prior to administration to a patient.
[00173] In other embodiments, the composition can be delivered in a controlled release or sustained release system. In one embodiment, a pump may be used to achieve controlled or sustained release. In another embodiment, polymeric materials can be used to achieve controlled or sustained release of the therapies of the present disclosure (see e.g. , U.S. Patent No. 5,989,463). Examples of polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly( methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N- vinyl pyrrolidone), poly( vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters. The polymer used in a sustained release formulation may be inert, free of leachable impurities, stable on storage, sterile, and biodegradable. In some embodiments, a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose. Any suitable technique known to one of skill in the art may be used.
Methods of the Invention
[00174] Further disclosed herein are methods for labeling an engineered bacterium disclosed herein comprising a protein having a nonstandard amino acid. The engineered bacterium described herein comprise a protein having a nonstandard amino acid, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group. The engineered bacterium can be exposed to a labeling reagent or detectable compound also having a bioorthogonal reactive functional group that will react the bioorthogonal reactive functional group of the nonstandard amino acid.
[00175] In one aspect, methods for labeling a protein having a nonstandard amino acid expressed by an engineered bacterium described herein are provided. The protein comprises a nonstandard amino acid, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group. In one embodiment, the protein can be reacted with a labeling reagent or detectable compound having a bioorthogonal reactive functional group to attach the labeling reagent or detectable compound to the bioorthogonal reactive functional group of the nonstandard amino acid.
[00176] In some embodiments, the method is performed in vitro. In some embodiments, the method is performed in vivo. Thus, in some embodiments, the method comprises administering to the subject an engineered bacterium having a protein comprising at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein, thereby labeling the engineered bacterium in the subject in vivo.
[00177] In some embodiments, the labeling reagent or detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, or a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent. In some embodiments, the labeling reagent or detectable compound comprises a drug delivery vehicle selected from the group consisting of a nanocarrier (e.g., a polymer), a nanoparticle (e.g., a metal gold, silver, or iron
nanoparticle), a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein. Thus, the bioorthogonal reactive functional group may be present on the drug delivery vehicle. In some embodiments, the labeling reagent or detectable compound comprises a bioorthogonal reactive functional group selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a hydrazine moiety, a tetrazine moiety, a norbornene moiety and a hydroxylamine moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a ketone moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a hydrazine moiety or a hydroxylamine moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises an azide moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises an alkyne moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises an alkyne moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises an azide moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a tetrazine moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a norbornene moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a norbornene moiety, and the bioorthogonal reactive functional group of the labeling reagent or detectable compound comprises a tetrazine moiety. In some embodiments, the labeling reagent or detectable compound is a detectable or traceable compound. In some embodiments, the labeling reagent or detectable compound is selected from the group consisting of a fluorescent moiety, a radioactive moiety, a
colorimetric dye, a fluorescent dye, a luminescent dye, a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, and an ultrasound contrast agent. Examples of labeling reagents or detectable compounds include, but are not limited to, radioisotopes, dyes, enzymes, contrast agents, fluorescent compounds or molecules such as a fluorescent dye, MRI contrast agents (e.g. , paramagnetic ions such as Gadolinium(III)-based MRI contrast agents, , superparamagnetic iron oxide (SPIO) and ultrasmall
superparamagnetic iron oxide (USPIO) MRI contrast agents, superparamagnetic iron platinum particle (SIPPs) MRI contrast agents, and Mn-based nanoparticle MRI contrast agents, and 19F MRI contrasting agents), positron emission tomography (PET) contrast agents
18 18 18 18
(e.g., F-based contrast agents such as [ F] maltose, [ F]-maltohexaose and [ F]2- fluorodeoxysorbitol (FDS) and 64Cu-based contrast agents), CT contrast agents (e.g., iodine- based contrast agents), ultrasound contrast agents, and small molecules including both inorganic and organic small molecules. The labeling reagent or detectable compound may include any suitable label or detectable group detectable by optical, spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means including but not limited to biotin, dyes, fluorophores, antigens, porphyrins, chromophores, and radioactive isotopes. Diagnostic agents include, but are not limited to, radiolabels
35 125 32 3 14
(e.g., S, 1, P, H, C), radioacoustic labels, enzyme labels (e.g. , horseradish peroxidase, alkaline phosphatase), gold beads, chemiluminescence labels, ligands (e.g. , biotin, digoxin) and/or fluorescence labels (e.g. , rhodamine, phycoerythrin, fluorescein, fluorescent proteins), a fluorescent protein including, but not limited to, a green fluorescent protein or one of its many modified forms, energy absorbing and energy emitting agents, fluorescent dyes (e.g., fluorescein, fluorescein-isothiocyanate (FITC), Texas red, rhodamine, green fluorescent protein, enhanced green fluorescent protein, lissamine, phycoerythrin, near-IR dye, Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX (Amersham), and SyBR Green I & II (Molecular Probes)), chemiluminescent groups, and chromogenic agents. In some embodiments, the labeling reagent or detectable compound comprises a dibenzocyclooctyne group (DBCO). In some embodiments, the labeling reagent or detectable compound is selected from the group consisting of BDP-FL-PEG4-DBCO, DBCO-PEG4-5/6-FAM, DBCO-PEG4-ATTO-488, DBCO-PEG4-5/6-Carboxyrhodamine 110, DBCO-PEG4-5/6-TAMRA, DBCO-Sulfo-Cy3, DBCO-5/6-Sulforhodamine B, DBCO-PEG4-5/6-Sulforhodamine B, DBCO-5/6-Texas Red, DBCO-PEG4-5/6-Texas Red, DBCO-Sulfo-Cy5, DBCO-Cy5.5, DBCO-Cy7. In some embodiments, the labeling reagent or detectable compound is dibenzyl cyclooctyne- conjugated Cy5 (DBCO-Cy5). In some embodiments, the labeling reagent or detectable compound is dibenzyl cyclooctyne-conjugated Cy3 (DBCO-Cy3).
[00178] Methods for detection of the detectable compound are known in the art and include, for example, microscopy (e.g., confocal microscopy), x-rays, ultrasound, X-ray computed tomography (CT), magnetic resonance imaging (MRI), positron emission tomography (PET) scan, ultrasound imaging (tomography), optical imaging, scintigraphy (including PET scintigraphy and gamma scintigraphy), and near infrared imaging.
[00179] In some embodiments, disclosed herein are methods for detecting the distribution of an engineered bacterium disclosed herein in a subject. In some embodiments, the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby detecting the distribution of the engineered bacterium in the subject. In some embodiments, the engineered bacterium is administered to the gastrointestinal tract of the subject. In some embodiments, the engineered bacterium is administered to the respiratory tract of the subject. In some embodiments, the engineered bacterium is administered to the circulatory system of the subject. In some embodiments, the engineered bacterium is administered to an organ or tissue selected from the group consisting of mouth, esophagus, heart, lung, stomach, small intestine, large intestine, rectum, anal canal, hair, and skin. In some embodiments, the engineered bacterium is administered to specifically target a lesion in the subject. In some embodiments, the engineered bacterium senses changes in the local gut environment that indicates a disease or disorder.
[00180] In some embodiments, disclosed herein are methods for detecting the distribution of a biofilm produced by an engineered bacterium disclosed herein in a subject. In some embodiments, the biofilm comprises a protein having a nonstandard amino acid that is secreted by the engineered bacterium. In some embodiments, the biofilm comprises an engineered bacterium disclosed herein. In some embodiments, the biofilm comprises a protein having a nonstandard amino acid produced by the engineered bacterium disclosed herein (e.g., CsgA). In some embodiments, the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby determining the distribution of the biofilm produced by the engineered bacterium in the subject. In some embodiments, the biofilm is present in the gastrointestinal tract of the subject. In some embodiments, the biofilm is present in the respiratory tract of the subject. In some embodiments, the biofilm is present in the circulatory system of the subject. In some embodiments, the biofilm is present in an organ or tissue selected from the group consisting of mouth, esophagus, lung, heart, stomach, small intestine, large intestine, rectum, anal canal, hair, and skin.
[00181] In some embodiments, disclosed herein are methods for delivering a drug to a subject. In some embodiments, the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid, thereby delivering the drug to the subject. Any drug comprising a bioorthogonal reactive functional group that reacts with a bioorthogonal reactive functional group of the nonstandard amino acid may be used. In some embodiments, the drug comprises a drug delivery vehicle selected from the group consisting of a nanocarrier (e.g., a polymer), a nanoparticle (e.g. , a metal gold, silver, or iron nanoparticle), a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein. Thus, the bioorthogonal reactive functional group may be present on the drug delivery vehicle.
[00182] In some embodiments, the drug comprises a bioorthogonal reactive functional group selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a hydrazine moiety, a tetrazine moiety, a norbornene moiety and a hydroxylamine moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a ketone moiety, and the bioorthogonal reactive functional group of the drug comprises a hydrazine moiety or a hydroxylamine moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises an azide moiety, and the bioorthogonal reactive functional group of the drug comprises an alkyne moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises an alkyne moiety, and the bioorthogonal reactive functional group of the drug comprises an azide moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a tetrazine moiety, and the bioorthogonal reactive functional group of the drug comprises a norbornene moiety. In some embodiments, the bioorthogonal reactive functional group of the nonstandard amino acid comprises a norbornene moiety, and the bioorthogonal reactive functional group of the drug comprises a tetrazine moiety. [00183] In some embodiments, the drug is selected from the group consisting of a nonsteroidal ant i- inflammatory drug (NSAID), a steroidal ant i- inflammatory drugs, an antifungal drugs, a detoxifying drug, an analgesics, a bronchodilator, an antibiotic, a monoclonal antibody, a diuretic, an immunosuppressant, a lymphokine, a hormone and a calcium channel blocker.
[00184] In some embodiments, disclosed herein are methods for diagnosing a disease or a disorder in a subject. In some embodiments, the method comprises administering to a subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group, and administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid and detecting the detectable compound in the subject, thereby diagnosing the disease or disorder in the subject.
[00185] In some embodiments, the disease or disorder is a gastrointestinal disease or disorder. In some embodiments, the disease or disorder is a respiratory disease or disorder. In some embodiments, the disease or disorder is an autoimmune disease or disorder. In some embodiments, the disease is an infectious disease. In some embodiments, the disease or disorder is a proliferative disease or disorder. In some embodiments, the disease or disorder is cancer. In some embodiments, the disease or disorder is a precancerous lesion. In some embodiments, the disease or disorder is an inflammatory disease or disorder. In some embodiments, the disease or disorder is selected from the group consisting of cystic fibrosis, congestive heart failure, benign prostatic hyperplasia, a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, non-ulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction, Crohn's disease, ulcerative colitis, and inflammatory bowel disease.
[00186] In some embodiments, the subject is an animal. In some embodiments, the subject is a mammal. In some embodiments, the subject is a domesticated animal. In some embodiments, the subject is a ruminant. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a human subject.
[00187] The method may comprise preparing a pharmaceutical composition with at least one genetically engineered species, strain, or subtype of bacteria described herein, and administering the pharmaceutical composition to a subject in a therapeutically effective amount. In some embodiments, the engineered bacteria disclosed herein are administered orally, e.g., in a liquid suspension. In some embodiments, the engineered bacteria are lyophilized in a gel cap and administered orally. In some embodiments, the engineered bacteria are administered via a feeding tube or gastric shunt. In some embodiments, the engineered bacteria are administered rectally, e.g., by enema. In some embodiments, the engineered bacteria are administered topically, intraintestinally, intrajejunally,
intraduodenally, intraileally, and/or intracolically.
[00188] The methods disclosed herein may comprise administration of a composition alone or in combination with one or more additional therapies, e.g., chemotherapy. The pharmaceutical composition may be administered alone or in combination with one or more additional therapeutic agents. An important consideration in the selection of the one or more additional therapeutic agents is that the agent(s) should be compatible with the bacteria, e.g., the agent(s) must not interfere with or kill the bacteria.
[00189] In some embodiments, the engineered bacterium described herein, or
pharmaceutical compositions comprising the engineered bacterium described herein may be administered to a subject, and a period of time is allowed to lapse in order to allow the bacterium to engraft and/or colonize in the subject (e.g., in the subject's gastrointestinal tract, skin and/or respiratory tract). Thereafter, any intervention using the methods described herein may be used.
[00190] In some embodiments, it may be necessary to administer a nonstandard amino acid to the subject that can be used by the orthogonal translation systems described herein to incorporate the nonstandard amino acid into the protein expressed by the engineered bacterium. In some embodiments, the nonstandard amino acid is administered in a pharmaceutical composition. In some embodiments, the nonstandard amino acid is administered to the subject as part of a nutritional product. In some embodiment, the nonstandard amino acid is administered orally, intravenously, intradermally or rectally. In some embodiments, the nonstandard amino acid is administered to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group. In some embodiments, the nonstandard amino acid is administered to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
[00191] In some embodiments, it may be necessary to administer an agent (i.e., an inducer) that regulates one or more inducible promoter that regulate the expression of one or more genes being expressed by the engineered bacterium described herein. The inducer will activate the expression of one or more of the orthogonal translation system and the heterologous gene encoding the protein of interest. In some embodiments, the inducer is administered in a pharmaceutical composition. In some embodiments, the inducer is administered to the subject as part of a nutritional product. In some embodiment, the inducer is administered orally, intravenously, intradermally or rectally. In some embodiments, the inducer is administered to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group. In some embodiments, the inducer is administered to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
[00192] In some embodiments, both an inducer and a nonstandard amino acid are administered to the subject. In some embodiments, the inducer is administered to the subject concurrently with the nonstandard amino acid. In some embodiments, the inducer is administered the subject after the nonstandard amino acid is administered to the subject. In some embodiments, the inducer is administered before the nonstandard amino acid is administered to the subject. In some embodiments, the inducer and the nonstandard amino acid are administered in the same dosage form. In some embodiments, the inducer and the nonstandard amino acid are administered in separate dosage forms. In some embodiments, the inducer and the nonstandard are administered concurrently to the subject at least one, two, three, four, five, six, eight, twelve, sixteen, twenty, twenty-four, thirty-six or forty-eight hours prior to administering a detectable compound or drug to the subject comprising a
bioorthogonal reactive functional group. In some embodiments, the inducer and the nonstandard amino acid are administered concurrently to the subject at least one, two, three, four, five, six, or seven days prior to administering a detectable compound or drug to the subject comprising a bioorthogonal reactive functional group.
[00193] In some embodiments, an inducer, a nonstandard amino acid and a detectable agent are administered to the subject. In some embodiments, the inducer is administered to the subject concurrently with the non standard amino acid, followed by administration of the detectable agent to the subject. In some embodiments, the inducer is administered to the subject concurrently with the detectable agent, followed by administration of the nonstandard amino acid. In some embodiments, the nonstandard amino acid is administered concurrently with the detectable agent, followed by administration of the inducer. In some embodiments, the inducer, the nonstandard amino acid and the detectable agent are administered separately. In some embodiments, two or more of the inducer, the nonstandard amino acid and the detectable agent are administered in the same dosage form. In some embodiments, the inducer, the nonstandard amino acid and the detectable agent are administered in separate dosage forms.
[00194] Definitions of common terms in cell biology and molecular biology can be found in The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); Benjamin Lewin (2009) Genes X, published by Jones & Bartlett Publishing (ISBN-10: 0763766321); Kendrew et al. (eds.) (1995) Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc. (ISBN 1-56081-569-8); and Coligan et al. (eds) (2009) Current Protocols in Protein Sciences Wiley Intersciences.
[00195] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure.
Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims. [00196] Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.
EXAMPLES
[00197] The following examples are set forth as being representative of the present disclosure. These examples are not to be construed as limiting the scope of the present disclosure as these and other equivalent embodiments will be apparent in view of the present disclosure, figures and accompanying claims.
[00198] Unless otherwise stated, the present invention was performed using standard procedures, as described, for example in Sambrook et al, Molecular Cloning: A Laboratory Manual (3 ed.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2001); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (1995); or Methods in Enzymology: Guide to Molecular Cloning
Techniques Vol.152, S. L. Berger and A. R. Kimmel Eds., Academic Press Inc., San Diego, USA (1987); and Current Protocols in Protein Science (CPPS) (John E. Coligan et al, ed., John Wiley and Sons, Inc.), which are all incorporated by reference herein in their entireties.
Example 1: Generation of engineered bacteria expressing proteins comprising the nonstandard amino acid ?-AzF
[00199] Engineered heterologous nucleic acids expressing proteins comprising InaV, Trat, CsgA (as part of a synthetic curli csgBACEFG operon, which excludes the gene encoding the regulatory protein csgD), and MBP were cloned in pBbB8k plasmids, under the control of arabinose-inducible promoters. The proteins were cloned to incorporate a poly-histidine tag that allowed for affinity purification. Plasmid maps of engineered proteins are shown in Figures 1A and IB. Table 2 lists the DNA sequences of engineered proteins. Table 2. Sequences of engineered proteins containing the nonstandard amino acid p- AzF. All proteins contain a poly-His tag (a 12 amino acid flexible linker followed by a 6X His tag). p-AzF inserted in a linker are placed just after the 6 histidine tag, and before a 36 or 48 amino acid flexible linker and a myc Tag. The position of p-AzF amino acid residue(s) is indicated with a ":
Figure imgf000057_0001
CsgA MKLLKV AAI AAIVFS GS ALAGVVPQYGGGGNHG 16676.73 GGGNNS GPNS ELNI YQ YGGGNS AL ALQTD ARNS DLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNS ATLDQWNGKNSEMTVKQFGGGNGAAVDQTASN S S VNVTQVGFGNN AT AHQYGS GGS GGS GGS GH HHHHH (SEQ ID NO: 15)
CsgA with p-AzP at MKLLKV AAI AAIVFS GS ALAGVVPQYGGGGNHG 16717.74 position 89 GGGNNS GPNS ELNI YQ YGGGNS AL ALQTD ARNS
DLTLTQHGGGNGADVGQGSDDS*IDLTQRGFGNS
ATLDQWNGKNSEMTVKQFGGGNGAAVDQTASN S S VNVTQVGFGNN AT AHQYGS GGS GGS GGS GH HHHHH (SEQ ID NO: 16)
CsgA with p-AzP in MKLLKV AAI AAIVFS GS ALAGVVPQYGGGGNHG 20572.49 a linker GGGNNS GPNS ELNI YQ YGGGNS AL ALQTD ARNS
DLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNS ATLDQWNGKNSEMTVKQFGGGNGAAVDQTASN S S VNVTQVGFGNN AT AHQYGS GGS GGS GGS GH HHHHH* GGS GS S GS GGS GGGS GS S GS GGS GGGS
GSSGSGGS GEQKLIS EEDL (SEQ ID NO: 17)
InaV MNIDKALVLRTC ANNM ADHCGLIWP AS GT VES K 30246.32
YWQS TRRHENGLVGLLWG AGTS AFLS VH AD AR WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI A LP V VEQPS HE VFD V ALVS A A APS VNTLP VTTPQN LQT AT YGS TLS GDNNS RLI AG YGS NET AGNHS DL IAGYGSTGTAGSDSSLVFRLWDGKRYRQLVART GENGVEADIPYYVNEDDDIVDKPDEDDDWIEVE GSGGSGGSGGS GHHHHHH (SEQ ID NO: 18)
InaV with p-AzP at MNIDKALVLRTC ANNM ADHCGLIWP AS GT VES K 30287.33 position 174 YWQS TRRHENGLVGLLWG AGTS AFLS VH AD AR
WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI A LP V VEQPS HE VFD V ALVS A A APS VNTLP VTTPQN LQT AT * GS TLS GDNNS RLI AG YGS NET AGNHS DLI
AGYGSTGTAGSDSSLVFRLWDGKRYRQLVARTG ENGVEADIPYYVNEDDDIVDKPDEDDDWIEVEGS GGSGGSGGS GHHHHHH (SEQ ID NO: 19)
InaV with p-AzP in MNIDKALVLRTC ANNM ADHCGLIWP AS GT VES K 34736.62 a linker YWQS TRRHENGLVGLLWG AGTS AFLS VH AD AR
WKVCEVAVADIIGLEEPGMVKFPRAEVVHVGDR IS AS HFIS ARQ ADP AS TPTPTPTPM ATPTP AA ANI A LP V VEQPS HE VFD V ALVS A A APS VNTLP VTTPQN LQT AT YGS TLS GDNNS RLI AG YGS NET AGNHS DL IAGYGSTGTAGSDSSLVFRLWDGKRYRQLVART GENGVEADIPYYVNEDDDIVDKPDEDDDWIEVE GS GGS GGS GGS GHHHHHH* GGGS GGGS GGGS G
GGSGGGSGGGSGGGSGGGSGGGSGGGSGGGSG GGSEQKLISEEDL (SEQ ID NO: 20) Trat MMKTKKLMMVALVSSTLALSGCGAMSTAIKKR 27659.42
NLEVKTQMSETIWLEPASERTVFLQIKNTSDKDM
SGLQGKIADAVKAKGYQVVTSPDKAYYWIQAN
VLKADKMDLRESQGWLNRGYEGAAVGAALGA
GITGYNSNSAGATLGVGLAAGLVGMAADAMVE
DVNYTMITDVQIAERTKATVTTDNVAALRQGTS
GAKIQTSTETGNQHKYQTRVVSNANKVNLKFEE
AKP VLEDQL AKS I ANILGS GGSGGSGGS GHHHHH
H (SEQ ID NO: 21)
Trat with p-AzP at MMKTKKLMMVALVSSTLALSGCGAMSTAIKKR 27700.43 position 200 NLEVKTQMSETIWLEPASERTVFLQIKNTSDKDM
SGLQGKIADAVKAKGYQVVTSPDKAYYWIQAN
VLKADKMDLRESQGWLNRGYEGAAVGAALGA
GITGYNSNSAGATLGVGLAAGLVGMAADAMVE
DVNYTMITDVQIAERTKATVTTDNVAALRQGTS
GAKIQ*TSTETGNQHKYQTRVVSNANKVNLKFE
E AKP VLEDQL AKS I ANILGS GGSGGSGGS GHHHH
HH (SEQ ID NO: 22)
Trat with p-AzP in a MMKTKKLMMVALVSSTLALSGCGAMSTAIKKR 32149.72 linker NLEVKTQMSETIWLEPASERTVFLQIKNTSDKDM
SGLQGKIADAVKAKGYQVVTSPDKAYYWIQAN
VLKADKMDLRESQGWLNRGYEGAAVGAALGA
GITGYNSNSAGATLGVGLAAGLVGMAADAMVE
DVNYTMITDVQIAERTKATVTTDNVAALRQGTS
GAKIQTSTETGNQHKYQTRVVSNANKVNLKFEE
AKP VLEDQL AKS I ANILGS GGSGGSGGS GHHHHH
H*GGGSGGGSGGGSGGGSGGGSGGGSGGGSGG
GSGGGSGGGSGGGS GGGS EQKLIS EEDL (SEQ ID
NO: 23)
[00200] An E. coli Nissle (ECN) 1917 strain comprising a knockout of the csgBAC and csgDEFG operons was developed using the lambda red system. For expressing curli fibers in vitro, pBbB8k plasmids containing the whole synthetic curli operon (csgBACEFG operon) were used. The knockout of the native curli operons allows for clear assessment of recombinant curli fibers production. The developed curli operons knockout strain was used for all experiments described in Examples 2 - 8 below.
[00201] Bacterial cells were transformed with a pBbB8k plasmid encoding the engineered proteins above by inserting a TAG codon at the corresponding nucleotide location in the open reading frame of the protein, and with the plasmid pEVOL-pAzF (a gift from Peter Schultz (Addgene plasmid # 31186)) which encodes an orthogonal translation system that incorporates p-AzF into proteins encoded by nucleic acids having the TAG codon. Two control bacterial strains were also developed: bacteria transformed with pBbB8k plasmid encoding engineered proteins without p-AzF and co-transformed with pEVOL-pAzF to observe background incorporation of p-AzF into other E. coli proteins; and bacteria transformed with pBbB8k plasmids encoding engineered proteins without p-AzF alone.
[00202] Engineered ECN were grown in 3 to 5 mL of Luria broth (LB) with the appropriate antibiotics (kanamycin for pBbB8k plasmids only, or kanamycin and
spectinomycin for pBbB8k and pEVOL-pAzF plasmids) overnight at 37°C. Fresh cultures were inoculated by diluting the overnight culture 100 times in fresh LB with the appropriate antibiotic, and the cultures were grown at 37° C to an optical density at 600 nm (OD600) of 0.6 to 0.7. The cultures were then induced with 0.01 to 0.2 % arabinose (inducer) overnight. Along with the inducer, p-AzF was added to the cultures to a final concentration ranging between 0.1 to 5 mM. The cells were then pelleted, resuspended in lysis buffer and sonicated to complete the lysis. After centrifugation, the supernatant was incubated with Ni NT A beads (as instructed by the manufacturer) to purify the proteins. Protein expression and purity was assessed via SDS-PAGE and Western blotting using an anti-His tag antibody. Protein integrity was assessed using Western blot with an anti-myc tag antibody for engineered proteins with p-AzF inserted in a linker.
Example 2: Maltose-binding protein (MBP) comprising the nonstandard amino acid p- AzF was expressed and purified from E. coli Nissle 1917
[00203] The purpose of this experiment was to determine if E. coli Nissle could successfully used to express a protein comprising the non-standard amino acid p-AzP without having to recode the bacterial genome to remove or reduce the amount of the labeling codon TAG. As described in Example 1, three different bacterial cells were used: cells transformed with a single plasmid to express wild-type MBP (without a nonstandard amino acid), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS"). 0.05% arabinose was added as an inducer to induce the production of the orthogonal translation system and of MBP. p-AzP was not added to the culture media of the bacteria of the first group {i.e., No mutation/No OTS and UAG mutation/With OTS). However, p-AzF was added at a final concentration of 1 mM to the culture media of the bacteria of the remaining two groups {i.e., No mutation/With OTS and UAG mutation/With OTS) at the time of induction. As shown in Figure 3, E. coli Nissle comprising an orthogonal translation system encoded by the plasmid pEVOL-pAzF, and a heterologous nucleic acid encoding MBP protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells without needing to recode the bacterial genome to remove the used labeling codon (TAG).
Example 3: MBP comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle was labeled with DBCO-Cy5
[00204] The purpose of this experiment was to determine if MBP comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle could successfully be reacted with a detectable moiety (DBCO-Cy5). MBP expression and purification was performed as described in Examples 1 and 2. For labeling of proteins with DBCO-Cy5, the purified protein eluates were incubated for 1 hour at room temperature with DBCO-Cy5 dye at molar ratios ranging between 1: 10 to 10: 1 MBP:DBCO-Cy5. Labeling reactions were run on SDS- PAGE gels and Cy5 fluorescence was detected using a FluorChem M System. As shown in Figure 4, MBP comprising /?-AzF can be successfully reacted with DBCO-Cy5 to label the protein. Further, very little background incorporation of p-AzP into endogenous E. coli proteins appears to have occurred, as determined by analyzing the background fluorescence in cells transformed with a plasmid to express wild-type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("No
mutation/With OTS").
[00205] To further confirm whether non-specific binding of the DBCO-Cy5 to endogenous proteins and/or low specific incorporation of p-AzP into endogenous E. coli proteins was occurring, cell pellets from the three transformation conditions were reacted with DBCO- Cy5, and residual fluorescence was analyzed. As shown in Figure 7, low non-specific binding was observed in cells expressing wild-type MBP.
[00206] To determine whether the number of functional groups from p-AzF that are attached to a detectable moiety can be tittered, purified MBP was reacted with DBCO-Cy5 at various DBCO-Cy6:MBP molar rations including 2, 2.5, 1, 0.75, 0.5 and 0.25. As shown in Figure 12, the number of functional groups from p-AzP that are attached to a detectable moiety can be tittered. Example 4: CsgA comprising the nonstandard amino acid p-AzF was expressed and purified from E. coli Nissle 1917
[00207] The purpose of this experiment was to determine if E. coli Nissle could successfully used to express an operon comprising a heterologous gene encoding CsgA comprising the non-standard amino acid p-Az¥. As described in Example 1, three different bacterial cells were used: cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("No mutation/No OTS"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("No mutation/With OTS"); and cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("UAG mutation/With OTS"). 0.05% arabinose was added as an inducer to induce the production of the orthogonal translation system and of the synthetic curli operon proteins. p- zF was not added to the culture media of the bacteria of the first group {i.e., No mutation/No OTS and UAG mutation/With OTS). However, p- zF was added at a final concentration of 1 mM to the culture media of the bacteria of the remaining two groups {i.e., No mutation/With OTS and UAG mutation/With OTS) at the time of induction. As shown in Figure 5, E. coli Nissle comprising an orthogonal translation system encoded by the plasmid pEVOL-pAzF, and a heterologous nucleic acid encoding the synthetic curli operon, which encodes the CsgA protein comprising a nonstandard amino acid can be successfully expressed in and purified from the bacterial cells. Without wishing to be bound by any particular theory, it appeared that the larger burden of expressing a whole operon instead of a single protein resulted in lower CsgA expression, as compared to MBP (see Example 2).
Example 5: CsgA comprising the nonstandard amino acid ρ-ΑτΈ purified from in E. coli Nissle was labeled with DBCO-Cy5
[00208] The purpose of this experiment was to determine if CsgA comprising the nonstandard amino acid p-AzF purified from in E. coli Nissle could successfully be reacted with a detectable moiety (DBCO-Cy5). CsgA expression and purification was performed as described in Examples 1 and 2. For labeling of proteins with DBCO-Cy5, concentrated 500 mM eluates of the purified protein were incubated for 1 hour at room temperature with DBCO-Cy5 dye at a molar excess of DBCO-Cy5 to MBP. Labeling reactions were run on SDS-PAGE gels and Cy5 fluorescence was detected using a FluorChem M System. As shown in Figure 6, CsgA comprising p-AzP can be successfully reacted with DBCO-Cy5 to label the protein. Further, the apparent higher background staining observed could be due to the low CsgA concentration loaded onto the SDS-PAGE gel.
Example 6: CsgA comprising the nonstandard amino acid ?-AzF expressed in E. coli Nissle 1917 forms curli fibers
[00209] The purpose of this experiment was to determine the optimal concentration of the inducer, arabinose, used to induce the expression of the orthogonal translation system and of the curli operon proteins necessary for optimal expression CsgA comprising the nonstandard amino acid p-AzF in E. coli Nissle. Congo Red dye binding to curli fiber (CsgA) was determined using spectrophotometry at OD490/OD600, a measure of bound Congo Red dye over cell density. Increased Congo Red binding signifies increased curli fiber (CsgA) production. For this experiment, cells expressing MBP were used as control. As shown in Figure 8, optimal expression of CsgA comprising p-AzP was observed at an arabinose concentration of 0.05%. The background signal observed for cells expressing MBP might be attributable to Congo Red binding to other extracellular appendages of E. coli Nissle (for example, cellulose).
[00210] To determine whether the expressed CsgA comprising p-AzP could form curli fibers in the cells expressing the protein. The production of curli fiber comprising CsgA having p-AzP was determined using scanning electron microscopy (SEM). SEM samples were prepared by filtering bacterial cultures on Nucleopore filter membranes (0.22 μιη pores) under vacuum. The samples were rinsed with 0.1 M sodium cacodylate buffer, and fixed with 2 % (m/v) glutaraldehyde and 2 % (m/v) paraformaldehyde for 2 hours at room temperature. The membranes were then washed in water, and the solvent was gradually exchanged to ethanol with an increasing ethanol 15 minute incubation step gradient (25 %, 50 %, 75 % and 100 % (v/v) ethanol). The membranes were dried in a critical point dryer and sputtered until they were coated in a 5 nm layer of Pt/Pd. Imaging was performed using a Zeiss Ultra 55 Field Emission SEM. As shown in Figure 9, no curli fiber production was observed in cells expressing MBP as expected, since the strain of E. coli Nissle has a deletion of the endogenous curli operons. However, when an exogenous synthetic curli operon was expressed in the cells, which included CsgA comprising /?-AzF, curli fibers were observed near the bacterial cells. [00211] To determine whether the amount of labeled fibers after incubation with
DBCO-Cy5 could be varied by administering less p-AzP to the cultured cells. As shown in Figure 13, when cells were grown in media containing varying concentrations of the nonstandard amino acid, lower concentrations of p-AzP resulted in a smaller fraction of labeled fibers after incubation with DBCO-Cy5.
Example 7: Growth of engineered E. coli Nissle to express proteins having a
nonstandard amino acid is not significantly affected
[00212] The purpose of this experiment was to determine whether genetic manipulation of E. coli Nissle to express proteins having a nonstandard amino acids affected cellular growth. Cells were grown in a deep- well 96 well plate, and arabinose, /?-AzF, or arabinose and /?-AzF were added to the culture media at an OD600 of ~ 0.2. Growth curves of E. coli Nissle cells either: lacking plasmid ("No plasmid"); comprising an orthogonal translation system
(encoded by the pEVOL-pAzF plasmid) ("OTS"); cells transformed with a single plasmid to express wild-type MBP (without a nonstandard amino acid), where the bacteria lacked an orthogonal translation system ("MBP"); cells transformed with a plasmid to express wild- type MBP (without a nonstandard amino acid) expressed and a plasmid comprising an orthogonal translation system ("MBP + OTS"); and cells transformed with a plasmid to express MBP comprising the nonstandard amino acid /?-AzF and a plasmid comprising an orthogonal translation system ("MBP (mutation) + OTS"); cells transformed with a single plasmid to express wild-type CsgA (as part of the synthetic curli operon), where the bacteria lacked an orthogonal translation system ("Curli operon"); cells transformed with a plasmid to express wild-type CsgA (as part of the synthetic curli operon) expressed and a plasmid comprising an orthogonal translation system ("Curli operon + OTS"); or cells transformed with a plasmid to express CsgA (as part of the synthetic curli operon) comprising the nonstandard amino acid p-AzP and a plasmid comprising an orthogonal translation system ("Curli operon (mutation) + OTS"), were determined. Growth curves are shown in Figures 10 and 11. The growth of E. coli Nissle transformed with the OTS (pEVOL-pAzF) was not significantly affected, as compared to the non-transformed E. coli Nissle growth curve. The growth of cells expressing MBP with or without /?-AzF, and with or without the presence of the orthogonal translation system, also was not significantly affected. As compared to the growth of cells expressing MBP, the growth of cells expressing curli fibers (including CsgA) was slower, but no significant differences between wild-type curli fibers, curli fibers expressed in the presence of an orthogonal translation system, and curli fibers containing p- AzF expressed in the presence of the orthogonal translation system. Thus, the results show that recombinant proteins containing a nonstandard amino acid can be expressed in E. coli Nissle without significantly affecting bacterial growth.
Example 8: TraT was expressed and purified from E. coli Nissle 1917
[00213] The purpose of this experiment was to determine if E. coli Nissle could successfully used to express TraT. 0.05% arabinose was added as an inducer to induce the production of TraT. As shown in Figure 14, TraT protein can be successfully expressed in and purified from the E. coli Nissle bacterial cells. Three different lysate buffers (as indicated) were used to lyse the cells.
Example 9: In vivo labeling of engineered bacteria
[00214] Based on expression of MBP and CsgA containing /?-AzF (described above), the number of recombinant proteins produced per cell is in the order of 106 proteins/cells (approximately the same number of available bioorthogonal reactive functional groups (i.e., azide moieties) per cell). With an approximate number of cells colonizing the gastrointestinal tract of mice after 3 days of 10 4 to 108 cells, the concentration of the bioorthogonal reactive functional group azide in the gut of a mouse could range between tens of nM to
approximately 10 μΜ. Assuming that the click reaction with the bioorthogonal functional group of a detectable compound proceeds to completion, this concentration should be sufficient to allow for signal detection for optical or MRI imaging techniques.
[00215] In vivo studies may be performed using engineered bacteria comprising the native curli operons, or lacking the native curli operons. Expression of native curli fibers may be important for colonization of the bacteria in the gut, especially when other engineered surface proteins are expressed (without co-expression of recombinant curli fibers).
[00216] For in vivo studies, 6-8 week old female mice are administered selection marker antibiotics (e.g., kanamycin and spectinomycin; 1 g/L in drinking water), to maintain the plasmids of the engineered bacteria, continuously during the course of the experiment beginning 24 hours prior to administration of the engineered bacteria. The mice are divided into four separate groups: one experimental group and three control groups. The mice of control group 1 are administered engineered bacteria (as described, for example in Example 1 above) and a detectable compound (e.g., DBCO-Cy5), but will not receive inducer (e.g., arabinose, to induce the expression of the protein comprising /?-AzF and the expression of the orthogonal translation system) nor the nonstandard amino acid (e.g. , p-AzF). The mice of control group 2 are administered detectable compound, but will not be administered engineered bacteria, inducer, nor nonstandard amino acid. The mice of control group 3 do not receive engineered bacteria, inducer, nonstandard amino acid, nor detectable compound. At day 0, the mice the experimental group and of control group 1 are administered a single dose of engineered bacteria by oral gavage (109-1010 colony forming units (CFUs)). At days 1, 3, 5, 7, 9 and 11, mice of the experimental group and control group 1 are administered inducer (e.g. , arabinose at 10 g/L in drinking water) and nonstandard amino acid (e.g. , p-AzF at 0.25 g/L in drinking water). At days 2, 4, 6, 8, 10 and 12, the mice of the experimental group, control group 1 and control group 2 are administered detectable compound (e.g. , DBCO-Cy5, 100 μΐ^ at 0.08 mM) by oral gavage. Body weight, plasma samples, and fecal samples are taken throughout the duration of the study. In vivo imaging of the mice using the IVIS Spectrum In Vivo Imaging System (PerkinElmer) is performed throughout the study to determine labeling of the engineered bacteria in vivo. Fecal samples are also analyzed by fluorescence microscopy to determine bacterial labeling. Upon conclusion of the study at day 13, the mice can be euthanized, and internal organs (liver, spleen, intestines) collected and assayed.
Example 10: In vivo labeling and detection of engineered bacteria comprising mutant CsgA or mutant TraT having the non-standard amino acid pAzF
Protein Expression
[00217] Plasmids expressing either wild-type (wt) TraT or a mutant TraT having a labeling codon were transformed into PBP8 cells with or without the pEVOL-pAzF plasmid, which encodes an orthogonal translation system (OTS), and expression was induced. Proteins were purified after cells lysis and detected using Western Blot with either anti-myc or anti-his antibodies. Both wt and mutant TraT proteins have an expected molecular weight of about 27 kDa, each variants having a his-tag before either the stop-codon or the amber-codon (i.e. , labeling codon), respectively (FIG. 15A). A second band having a molecular weight of about 34 kDa was observed in Western Blots of cells expressing the mutant TraT protein using either an anti-His antibody (FIG. 15A) or an anti-myc antibody (FIG. 15B). The 34 kDa band is the expected size of the full length mutant TraT. As shown in Fig. 15C, in cells lacking the OTS and not grown in the presence of NSAA, about 5% of the protein expressed was the 34 kDa variant. This read-through might be a result of an Amber suppression mutation. However, about 35% of TraT protein observed in the cells expressing both the mutant TraT, the OTS, and cultured in the presence of NSAA, was full length. Premature termination of translation appears to have occurred at the amber codon, perhaps due to inefficiencies of the OTS.
NSAA incorporation
[00218] Mutant TraT comprising pAzF, mutant CsgA comprising pAzF, wild-type
CsgA, and wild-type TraT were purified, incubated with DBCO-Cy5 and analyzed through SDS PAGE. Two bands, each representing TraT or CsgA, were visible using red fluorescence imaging (FIG. 16), and solely observed in cells comprising both the plasmid expressing the mutant TraT or mutant CsgA and the plasmid comprising the OTS, when the cells were grown in the presence of the NSAA pAzF. Since no protein bands were observed in the negative controls (i.e., bacterial cells expressing wt CsgA or wt TraT in the presence or absence of both the OTS and NSAA pAzF), both the mutation and OTS are necessary for the incorporation of the NSAA.
Cell Labeling
[00219] To determine the optimal conditions for labeling of cells expressing the mutant TraT comprising pAzF labeling experiments were performed using different incubation conditions. E. coli PBP8 cells expressing the mutant TraT comprising pAzF and the OTS were grown in the presence of 5 mM pAzF. Although higher concentrations of pAzF were tested, adverse effects on cell grown were observed when cells were grown in the presence of greater that 10 mM pAzF. Complete cell growth inhibition was observed when cells were grown in the presence of 20 mM pAzF.
[00220] First, either non-transformed PBP8 cells, or PBP8 cells transformed to express mutant TraT and the OTS were incubated with varying concentrations of DBCO-Cy5 for 1 hour at 25 °C. Fluorescence intensity was measured after cell pellets were deposited onto nitrocellulose. As shown in FIG. 17A, the intensity of the sham control increased linearly with the concentration of DBCO-Cy5. However, in cells expressing the mutant TraT increased fluorescence intensity, as compared to the control cells, was observed at low concentrations of DBCO-Cy5, with saturation observed at about 500 μΜ DBCO-Cy5. [00221] To determine the optimal incubation time for labeling with DBCO-Cy5, either non-transformed PBP8 cells (control), or PBP8 cells transformed to express mutant TraT and the OTS were incubated with 200 μΜ DBCO-Cy5 at 37°C for 1-4 hours. As shown in FIG. 17B, fluorescence intensity increased linearly over time in the control cells. However, fluorescence intensity saturation was observed after 2 hours in cells transformed to express mutant TraT and the OTS.
[00222] To determine the optimal incubation temperature for labeling with DBCO-
Cy5, either non-transformed PBP8 cells (control), or PBP8 cells transformed to express mutant TraT and the OTS were incubated with either 100 μΜ or 200 μΜ DBCO-Cy5 at either 25°C or 37°C. As shown in FIG. 17C, labeling performed using 200 μΜ DBCO-Cy5 at 25°C resulted in comparable fluorescence intensity as labeling performed using 100 μΜ DBCO-Cy5 at 37°C.
[00223] Additional labeling experiments were performed using PBP8 cells expressing either mutant CsgA comprising pAzF or mutant TraT comprising pAzF and the OTS to determine optimal labeling conditions. As shown in FIGs. 18A and 18B, cells expressing either mutant CsgA or mutant TraT incubated at 37°C for 2 hours with increasing
concentrations of DBCO-Cy5 for labeling demonstrated that fluorescence intensity increased proportionally with higher concentration of DBCO-Cy5, with saturation observed at 300 μΜ DBCO-Cy5. Further, as shown in FIGs. 18C and 18D, cells expressing either mutant CsgA or mutant TraT incubated with 200 μΜ DBCO-Cy5 for labeling between 1-4 hours, showed maximum labeling after 2 hours. Fluorescence intensity decrease after 2 hours, which may be due to protein degradation.
[00224] To study the distribution of DBCO-Cy5 uptake and labeling efficiency in a population of bacterial cells, PBP8 cells expressing either mutant CsgA comprising pAzF and the OTS or mutant TraT comprising pAzF and the OTS were cultured in the presence of pAzF, and the cultures were induced overnight with arabinose, and incubated with Cy5- DBCO as described above. The labeled populations of cells were analyzed using flow cytometry and confocal microscopy. As shown in FIGs. 21A, 21B, 21C and 21D, Cy5- DBCO labeling was detected in both PBP8 cells expressing either mutant CsgA comprising pAzF or mutant TraT comprising pAzF and the OTS. Further, as shown in FIGs. 19 and 20, a bimodal distribution was observed when flow cytometry was performed on cell
populations, with minimal fluorescence observed in control untransformed PBP8 cells and non-induced PBP8 cells transformed to express either mutant CsgA comprising pAzF or mutant TraT comprising pAzF and the OTS.
In Vivo Detection of Cy5-DBCO-labeled Bacterial Cells
[00225] To determine whether Cy5-DBCO-labelled could be detected in vivo, the following study was performed. PBP8 cells expressing either mutant CsgA comprising pAzF and the OTS were cultured, protein expression induced, and the cells were labeled with Cy5- DBCO in vitro as described above. Mice were either administered no bacteria (control), 1 x 106 cells, or 1 x 109 cells by oral gavage, and Cy5 fluorescence detected in vivo using the IVIS Lumina II system (PERKIN ELMER). Fluorescence was monitored over time. As shown in FIG. 22, the bacteria were readily detected in vivo. Some background fluorescence was detected in mice which may be due to their feed (non alfalfa-free feed), which may result in background fluorescence interference. In later experiments, regular food was replaced with alfalfa-free food to minimize any fluorescence background.
[00226] To determine whether cells could be labelled with Cy5-DBCO in vivo, the following experiments were performed. To determine the optimal concentration of Cy5- DBCO for detection using the VIS Lumina II system (PERKIN ELMER), mice were administered either 5 uM, 50 uM, 100 uM, or 200 μΜ of Cy5-DBCO. Maximum
fluorescence detection without detector saturation was observed using 100 μΜ Cy5-DBCO (see FIG. 23). Therefore, 100 μΜ Cy5-DBCO was the concentration used for the labelling experiments described below.
[00227] Having demonstrated that labeled bacteria expressing mutant CsgA
comprising pAzF labelled with Cy5-DBCO were detectable after passing the gastrointestinal tract, in vivo experiments were designed to label the bacteria in vivo. Briefly, four groups of mice were treated with either (a) Cy5-DBCO dye alone (Group 1); (b) bacteria expressing wild-type CsgA (Group 2); (c) bacteria expressing mutant CsgA comprising pAzF in the absence of arabinose inducer (Group 3); or (d) bacteria expressing mutant CsgA comprising pAzF in the presence of arabinose inducer (Group 4). For the groups of mice receiving bacteria (Groups 2-4), unlabeled bacteria were administered by oral gavage at day 0. Mice were continuously administered pAzF in water. Mice from Groups 2 and 4 were also administered the arabinose inducer. Subsequently (day 1), mice in all groups were administered Cy5-DBCO by gavage and no longer administered pAzF and arabinose (as applicable) 2 hours prior to administration of Cy5-DBCO. Mice were imaged using the VIS Lumina II system (PERKIN ELMER) to detect the clearance rate of the dye alone as well as the labeled bacteria. As shown in FIG. 24, a difference in the residence time was observed between mice administed the Cy5-DBCO dye alone (Group 1) and mice administered both Cy5-DBCO and bacteria expressing mutant CsgA comprising pAzF in the presence of arabinose inducer (Group 4). The Cy5-DBCO dye was no longer detectable after about 24 hours in the mice of Group 1, while fluorescence was detectable for an extended period of time (> 35 hours) in the majority of mice of Group 4, indicative of labeling of the the engineered bacteria. The differences in fluorescence residence time was statistically significant (see FIG. 25).
[00228] To determine whether pH changes and other biological factors affected the ability to detect the labelled bacteria in vivo, the following experiments were performed to determine whether the bacteria remained viable in vivo, and whether the bacteria lost either of the plasmids expressing the OTS or the mutant CsgA. Fecal samples were obtained from the mice three days after bacteria were administered to the mice, and fecal pellets were plated onto agar plates containing 50 μg/mL chloramphenicol, kanamycin and spectinomycin to culture the bacteria in the sample. Bacterial colonies were selected, grown in the presence and absence of pAzF. Cell lysates were analyzed by SDS-PAGE. SDS-PAGE gels were dyed with either Coomasie Blue or Cy5-DBCO in order to detect total protein, or mutant CsgA comprising pAzF, respectively. As shown in FIG. 26A and 26B mutant CsgA comprising pAzF was detectable in some of the isolated bacteria. Not all of the bacteria retained the ability to express mutant CsgA comprising pAzF which may be due to the loss of the plasmid encoding the mutant CsgA protein, and/or the plasmid encoding the OTS.
[00229] In order to detect the distribution of the bacteria in the gastrointestinal tract of the mice ex vivo, the mice were sacrificed and the gastrointestinal tract was imaged using the IVIS Lumina II system (PERKIN ELMER). As shown in FIGs. 27A and 27B, a significant difference was observed in the level of fluorescence detected in mice receiving the control untransformed PBP8 bacteria and mice receiving bacteria expressing the mutant CsgA comprising pAzF. Non-specific binding of the Cy5-DBCO dye was detected in the gut.
However, as shown in FIG. 27C, when the total radiance efficiency was determined after stomach fluorescence was subtracted, the differences in radiance efficiency at sites distal to the gut were statistically significant. While no fluorescence was observed in the cecum of mice receiving the control, fluorescence was detected in mice receiving bacteria expressing the mutant CsgA comprising pAzF. At 24 hours, the fluorescence detected in the cecum of the mice receiving bacteria expressing the mutant CsgA comprising pAzF decreased.
[00230] To further confirm that the bacteria could be labeled in the gastrointestinal tract of the mice, the following experiment was performed. Mice were administered PBP8 cells expressing either mutant CsgA comprising pAzF and the OTS, arabinose inducer, and pAzF. As control, a group of mice were not treated with bacteria, nor administered pAzF and arabinose. The gastrointestinal tract tissue was collected from the mice and imaged using the IVIS Lumina II system (PERKIN ELMER) (see FIGs. 28 and 29). The cecal tissue was isolated and homogenized. Following cell lysis, the pellet and soluble fractions of the ceca were analyzed to determine whether labeled mutant CsgA comprising pAzF (i.e., bound to Cy5-DBCO) could be detected in either fraction (see FIG. 30). To extract all of the CsgA protein that was potentially present in the pellet fraction, samples were treated with
HFIP:TFA to disassemble aggregated curli fibers. As shown in FIGs. 31A, 31B, 32A, and 32B, Cy5-DBCO-labelled mutant CsgA was detected in the soluble fractions of untreated cecum homogenate of every mouse to which bacteria expressing mutant CsgA comprising pAzF was administered, but not in the cecum homogenate from mice not administered bacteria.
Materials and Methods
Cell strains and plasmids
[00231] The divergent curli operon regions consisting of csgBAC and csgEFG were
PCR isolated from E. coli K12 substr. W3110 and cloned by overlap extension into the pBbB8k plasmid, to create a single operon, csgBACEFG, under the control of the araBp promoter. A six-histidine tag (HisTag) was added to the C-terminus of CsgA to allow for immunodetection (pBbB8k-WT). A control plasmid was constructed by cloning the malE gene encoding for the maltose binding protein (MBP) from the W3110 genome into the pBbB8k plasmid under the control of the araBp promoter (pBbB8k-MBP). To allow for the incorporation of NSAA, a mutation encoding for the amber stop codon (TAG) was inserted within the open-reading frame of CsgA (pBbB8k-Mut) or MBP (pBbB8k-MBPMut) using site-directed mutagenesis. The pEVOL-pAzF plasmid was used as orthogonal translation system (OTS).
[00232] Protein expression was performed in a curli operon deletion mutant, PBP8, an
E. coli strain derived from E. coli Nissle 1917 (ECN). PBP8 strain was constructed using the lambda red recombineering method as previously described (see Datsenko and Wanner (2000) Proc. Nat'l. Acad. Set USA 97(12): 6640-5). Briefly, the chloramphenicol acetyltransferase (CAT) cassette was constructed with 500 bp homology arms upstream and downstream of the curli operon using SOEing PCR. The CAT cassette was transformed into electrocompetent EcN with pre-induced lambda red genes from pKD46 plasmid using 0.5% arabinose during the growth step of electrocompetent cell preparation. Transformants were expanded using SOC media at 30°C shaking incubator for 3 hours to promote the genomic replacement of the curli operon with the CAT cassette. Transformants were then plated onto LB agar plates containing 25 μg/mL chloramphenicol and incubated overnight at 37 °C. Colonies that were resistant to chloramphenicol were selected and verified for knockout of the curli operon by colony PCR and genomic DNA sequencing as compared to wild-type EcN.
In vitro expression of curli fiber
[00233] PBP8 cells transformed with a pBbB8k plasmid were streaked onto lysogeny broth (LB) agar plates containing 50 μg/mL kanamycin. PBP8 cells transformed both with a pBbB8k plasmid and with the OTS plasmid were streaked onto Luria Broth (LB) agar plates containing both 50 μg/mL kanamycin and 50 μg/mL spectinomycin. Colonies were picked from the plates and 5 mL cultures were inoculated (in LB containing the appropriate antibiotics). Cultures were grown overnight at 37°C. The overnight cultures were diluted 100-fold in fresh LB medium containing the appropriate antibiotics, and cultured at 37°C until they reached an optical density (OD) at 600 nm of 0.6 to 0.8. Arabinose was added to the bacterial cultures at a final concentration of 0.05 % to induce protein expression. If NSAA incorporation was desired, the NSAA 4-azido-L-phenylalanine (pAzF) (Toronto Research Chemicals) was also added to the cultures to a final concentration ranging between 1 mM and 5 mM. Higher concentrations of NSAA affected cell growth. Protein expression was allowed to occur at 37°C overnight.
Bacterial growth curves and doubling times
[00234] Bacterial cells were grown in LB overnight, diluted 1: 100 in fresh LB, and grown in 1 mL-well 96 wells plate at 37 °C and shaken at 900 rpm. Once the culture reached an optical density (OD) of 0.6, measured at 600 nm (optimal for protein expression), the cultures were again diluted 1: 100 in fresh LB in a 250 mL 96 well plate. Half of each cell culture was induced with 0.05% arabinose and incubated with 5 mM NSAA. The other half of the cell culture was used as negative control and were not induced with arabinose nor exposed to NSAA. Bacterial cells expressing either the curli operon, or MBP as control, were used. Bacterial growth was assessed using a Biotek Kinetics Machine, which measured OD every 5 minutes over a period of 24 hours. The data was then plotted and the linear slope during exponential growth was used to calculate doubling times. Because curli-expression cells derivatives had more irregular exponential growths than MBP-expressing cells, the first exponential growth "hump" of curli variants was used to determine doubling times.
Electron microscopy
[00235] Cells expressing curli fiber (with and without NSAA) were imaged by scanning electron microscopy (SEM) to assess the formation of fibers. 100 μΐ of cell cultures were filtered onto Nucleopore filter membranes (0.22 um pore size, GE Healthcare Bio- Sciences) under vacuum. The samples were fixed with 2% (w/v) glutaraldehyde and 2% (w/v) paraformaldehyde in 0.1 M sodium cacodylate buffer for 2 hrs. at room temperature. The membranes were then gently washed with water, and the solvent was gradually exchanged to ethanol using an increasing gradient ethanol 15-minute incubation step (25 %, 50 %, 75 % and 100 % (v/v) ethanol). Samples were dried in a critical point dryer, placed onto SEM sample holders using silver adhesive (Electron Microscopy Sciences), and sputtered until they were coated in a 5 nm layer of Pt/Pd. Imaging was performed using a Zeiss Ultra 55 Field Emission SEM.
In vitro labeling and detection of bacterial cells
[00236] Cells expressing curli fibers were pelleted at 4,000 x g for 10 min. The cells were resuspended in phosphate buffered saline (PBS) containing 1% (w/v) bovine serum albumin (BSA). The centrifugation and resuspension process was repeated 3 times to remove excess free NSAA present in the culture medium. For labelling, 100
Figure imgf000073_0001
of cell culture at OD6oo of 10 were incubated with Cy5-DBCO dye in PBS containing 1% (w/v) BSA for 2 hours at 37 °C with agitation. The labeled cells were pelleted again, and resuspended in PBS containing 1% (w/v) BSA. This wash step was repeated 3 times to remove any unbound dye. Labeling was assessed by spotting 10 μΐ of labeled cells at OD 1 on a nitrocellulose membrane and detecting the fluorescence of Cy5 using a FluorChem™ M system (Protein Simple). Flow cytometry was used to determine the fraction of cells that were labeled.
Samples were analyzed with a BD LSRFortessa Flow Cytometer System (BD Biosciences).
[00237] For confocal microscopy, bacterial cells were also stained with 5 μΜ Hoechst
33342 (THERMO SCIENTIFIC) in PBS for 1 hour and rinsed 3 times using 1 mL of PBS. Subsequently, the bacterial cells were fixed in 2% paraformaldehyde for 10 minutes at 25 °C and washed 3 times with 1 mL of PBS. 10 μΐ of cells were deposited on a glass slide for imaging using a Leica SP5 X MP Inverted Confocal Microscope (Leica Microsystems).
Purification and identification of proteins labeled in vitro
[00238] Pre-labeled bacterial cells were pelleted at 4,000 x g for 20 min, and resuspended in lysis buffer (50 mM phosphate buffer, 100 mM NaCl, 7 M guanidinium hydrochloride). A protease inhibitor cocktail was added, and the suspension was stored at - 20 °C overnight. The suspension was thawed on ice, and sonicated to fully lyse the cells (40% amplitude, 3 x 25 seconds ON, 35 seconds OFF). After centrifugation at 10,000 x g for 30 minutes, the supernatant was applied to a NiNTA column and incubated 2 hours with agitation at room temperature in the presence of 10 mM imidazole. His-tag purification was performed by washing the column 3 times with 40 mM imidazole, and eluting His-tagged CsgA proteins with 500 mM imidazole (both in 50 mM phosphate buffer with 100 mM NaCl). Eluates were concentrated using 3 kDa Amicon ultracentrifugal filters and analyzed by SDS-PAGE using a 4-20% polyacrylamide gel. Prior to staining with Coomassie Blue, Cy5 fluorescence within the SDS-PAGE gel was also detected. Mass spectrometry analysis was used to confirm the presence of CsgA in the Cy5-labeled bands.
In vivo tracking of click microbes
[00239] Prior to the experiments, mice were given a non- fluorescent food (alfalfa- free) for at least 5 days to minimize background autofluorescence. At six hours prior to oral gavage with bacteria, mice were fasted and given water containing antibiotics (1 g/L kanamycin (RPI), 1 g/L spectinomycin (RPI)), inducer (10 g/L L-(+)-Arabinose (Sigma)) and NSAA (5 mM) based on their assigned experimental conditions. The starting culture of PBP8 transformed with pBbB8k-WT was expanded 1: 100 dilution in LB containing 50 μg/mL kanamycin, while that of PBP8 transformed with pBbB8k-Mut and pEVOL-pAzF was expanded 1: 100 dilution in LB containing 50 μg/mL kanamycin and spectinomycin to OD of 0.5. Log-phase cultures were centrifuged at 4,000 x g for 15 minutes at 4°C and resuspended in 20% sucrose (OmniPur) in PBS to an OD of 10. Once the mice were fasted for six hours, 100 μΐ^ of the prepared log-phase bacteria were administered to the mice via oral gavage.
[00240] The alfalfa- free food and water were administered again to the mice to allow for proliferation and protein induction of the engineered bacteria in vivo. Meanwhile, the abdominal hair of the mice was removed to allow for imaging. 40 hours after gavage with the bacteria, pAzF and arabinose-containing water was switched for antibiotic-only- containing water, and the food was briefly remove to prepare the mice for dye administration.
[00241] Two hours after the water was switched and the food withheld, 100 μΐ^ of 100 μΜ of Cy5-DBCO in 20% sucrose in PBS were administered to the mice by oral gavage. Then, mice were imaged under anesthesia using IVIS Lumina II (PerkinElmer). The IVIS instrument was equipped with 10 narrow-band excitation filters (30 nm bandwidth) and 4 broadband emission filters (60- and 75-nm bandwidth). At the time point, the mice were imaged using excitation filter at 675 nm, and 500 nm for background subtraction, and emission filter at 695-770 nm, with field of view (FOV) = D (12.5 cm), fstop = 2 and medium binning. Living Image software version 4.3.1/4.4 was used for image analysis.
Whole GI tract ex vivo fluorescence imaging
[00242] The mouse experiments were performed in the same manner as the in vivo tracking experiment described above, except that 36 hours after administration of the Cy5- DBCO dye. the mice were euthanized to harvest the whole gastrointestinal (GI) tract for ex vivo fluorescence imaging. The GI tract was placed on the lid of 150x25 mm polystyrene tissue culture plate (Falcon) and imaged using IVIS Lumina II with the same setting as the in vivo imaging. After imaging, the GI tract was kept at -20°C for protein extraction.
Whole cecum fluorescence and protein analysis
[00243] The GI tract specimens used in the ex vivo fluorescence imaging were further analyzed for curli and Cy5-DBCO interaction. The mouse GI tracts were removed from - 20°C. The cecum from each sample was excised, transferred to a 15-ml falcon tube, and crushed to homogenize. 3 mL of PBS was added to each sample, supplemented with 4 of benzonase nuclease (NOVAGEN) and 8 of 1 M magnesium sulfate (MgS04) (SIGMA). The samples were incubated at 37°C overnight.
[00244] Each sample was transferred to 2-ml microtube and centrifuged at 14,000 rpm for 10 minutes to extract the supernatant. The supernatant samples were transferred to another set of tubes, and concentrated using 10-kDa Amicon Ultra 0.5 mL centrifugal filters
(Millipore) at 10,000 rpm centifugation for 15 minutes twice. The pellet samples were resuspended with 200 μΐ^ of PBS. Both supernatant and pellet samples were diluted five times, mixed with 2X dyeless laemli buffer in 1: 1 ratio, incubated at 95°C for 5 minutes and run on 12% SDS-PAGE gel (Bio-Rad) at 200 Volts for 30 minutes. After the gel electrophoresis, the gels were rinsed with water and imaged to detect the fluorescence of Cy5 using a FluorChem™ M system (Protein Simple). Then, the gels were stained with
Coomassie Brilliant Blue to detect the presence of proteins and compared the size against standard protein ladder (Bio-Rad).
Re-labeling of click microbes from fecal pellets
[00245] During the in vivo tracking experiment, fecal pellets were collected from each mouse in a sterile manner at 24-hour time point after dye administration. The pellets were homogenized using bead mill homogenizer TissueLyser LT (Qiagen) and 5-mm stainless steel beads (Qiagen) with the frequency of 30 Hz for 2 minutes. The fecal homogenates were centrifuged briefly at 1,000 rpm for 1 minute to loosely pellet the large particulates. The supernatant was serially diluted and plated on appropriate antibiotic- selection plates. The colonies were grown, induced, and undergone similar in vitro labeling experiment and analysis mentioned previously.
References
Each of the following references is hereby incorporated by reference in its entirety.
1. Chin et al. (2002) J. Am. Chem. Soc. 124(31): 9026-7.
2. Lang and Chin (2014) Chem. Rev. 114: 4764-4806.
3. Datta et al. (2002) J. Am. Chem. Soc. 124(20): 5652-3.
4. Young et al. (2010) J. Mol. Biol. 395: 361-74.

Claims

1. An engineered bacterium comprising:
a. an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and
b. a heterologous nucleic acid comprising a labeling codon, wherein the heterologous nucleic acid comprises a heterologous gene encoding a protein selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein;
wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with a nonstandard amino acid; and
wherein the orthogonal tRNA incorporates the nonstandard amino acid at the residue corresponding to the labeling codon during translation.
2. The engineered bacterium of claim 1, wherein the heterologous nucleic acid further encodes a polypeptide linker sequence.
3. The engineered bacterium of claim 2, wherein the polypeptide linker sequence is flexible.
4. The engineered bacterium of any one of claims 1-3, wherein the heterologous nucleic acid further encodes a polypeptide tag.
5. The engineered bacterium of any one of claims 1-4, wherein the labeling codon is located at a nucleic acid position within the heterologous gene encoding the protein.
6. The engineered bacterium of any one of claims 2-4, wherein the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide linker sequence.
7. The engineered bacterium of any one of claims 2-4, wherein the labeling codon is located at a nucleic acid position within the heterologous nucleic acid encoding the polypeptide tag.
8. The engineered bacterium of any one of claims 1-7, wherein the heterologous nucleic acid comprises 2, 3, 4, 5, 6, 7, or 8 labeling codons.
9. An engineered bacterium comprising:
a. an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and
b. a heterologous nucleic acid encoding a protein, wherein the protein comprises a nonstandard amino acid, and wherein the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein;
wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and
wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
10. The engineered bacterium of claim 9, wherein the protein further comprises a polypeptide linker.
11. The engineered bacterium of claim 10, wherein the polypeptide linker is flexible.
12. The engineered bacterium of any one of claims 9-11, wherein the protein further comprises a polypeptide tag.
13. The engineered bacterium of claim 4 or claim 12, wherein the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
14. The engineered bacterium of any one of claims 9-13, wherein the protein comprises 2, 3, 4, 5, 6, 7, or 8 nonstandard amino acids.
15. The engineered bacterium of any one of claims 1-14, wherein the bacterial extracellular matrix protein is a fiber protein, a flagellar protein, or a pilin protein.
16. The engineered bacterium of any one of claims 1-14, wherein the protein is selected from the group consisting of InaV, Trat, and CsgA.
17. The engineered bacterium of claim 16, wherein the protein is CsgA.
18. The engineered bacterium of any one of claims 9-17, wherein the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA.
19. The engineered bacterium of any one of claims 9-16, wherein the protein is InaV and the nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
20. The engineered bacterium of any one of claims 9-16, wherein the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
21. The engineered bacterium of any one of claims 1-8, wherein the labeling codon is TAG.
22. The engineered bacterium of claim 1 or claim 9, wherein the orthogonal tRNA comprises an anticodon loop that specifically recognizes the codon UAG.
23. The engineered bacterium of any one of claims 1-22, wherein the nonstandard amino acid comprises a bioorthogonal reactive functional group.
24. The engineered bacterium of claim 23, wherein the bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, or a norbornene moiety.
25. The engineered bacterium of any one of claims 1-24, wherein the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF),
azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), /?-bromophenylalanine (p-BrF), /?-iodophenylalanine (p-lF), p- ethynylphenylalanine ( ?-EtF), /?<3ra-acetylphenylalanine (p-AcF), azidonorleucine (Anl), irans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra).
26. The engineered bacterium of claim 25, wherein the nonstandard amino acid is p-AzP.
27. The engineered bacterium of any one of claims 1-26, wherein the engineered bacterium is non-pathogenic.
28. The engineered bacterium of any one of claims 1-27, wherein the engineered bacterium is of the species Escherichia coli.
29. The engineered bacterium of any one of claims 1-28, wherein the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and C321.AA.exp.
30. The engineered bacterium of any one of claims 1-28, wherein the engineered bacterium is of the Escherichia coli Nissle 1917 strain.
31. The engineered bacterium of any one of claims 1-30, wherein the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon.
32. The engineered bacterium of claim 31, wherein the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon.
33. The engineered bacterium of any one of claims 1-30, wherein the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon.
34. The engineered bacterium of any one of claims 1-33, wherein the engineered bacterium further comprises a prfA gene deletion.
35. The engineered bacterium of any one of claims 1-34, wherein the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase.
36. The engineered bacterium of any one of claims 1-35, wherein the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina,
Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene.
37. The engineered bacterium of any one of claims 1-36, wherein the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei,
Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or
Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene.
38. The engineered bacterium of any one of claims 1-37, wherein the orthogonal translation system is located in the bacterial genome.
39. The engineered bacterium of any one of claims 1-37, wherein the orthogonal translation system is located in a plasmid.
40. The engineered bacterium of claim 39, wherein the plasmid is pEVOL-pAzF.
41. The engineered bacterium of any one of claims 1-40, wherein the expression of the heterologous nucleic acid is under the control of a constitutive promoter.
42. The engineered bacterium of any of claims 1-40, wherein the expression of the heterologous nucleic acid is under the control of an inducible promoter.
43. The engineered bacterium of claim 42, wherein the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
44. The engineered bacterium of any one of claims 1-43, wherein the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of a constitutive promoter.
45. The engineered bacterium of any one of claims 1-43, wherein the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the heterologous gene encoding the orthogonal tRNA is under the control of an inducible promoter.
46. The engineered bacterium of claim 45, wherein the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
47. A biofilm comprising the engineered bacterium of any one of claims 1-46.
48. A pharmaceutical composition comprising an engineered bacterium of any one of claims 1-46 and a pharmaceutically- acceptable excipient.
49. The pharmaceutical composition of claim 48, wherein the composition is formulated for oral administration to a subject.
50. The pharmaceutical composition of claim 48, wherein the composition is formulated for rectal administration to a subject.
51. The pharmaceutical composition of claim 49 or claim 50, wherein the subject is a mammalian subject.
52. The pharmaceutical composition of claim 51, wherein the mammalian subject is a human subject.
53. The pharmaceutical composition of any one of claims 48-52, wherein the pharmaceutical composition is formulated as a pill, a capsule, a lozenge, or a suppository.
54. A method for labeling of an engineered bacterium in a subject in vivo, the method comprising:
(a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group; and
(b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group,
wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid of the protein,
thereby labeling the engineered bacterium in the subject in vivo.
55. A method for detecting the distribution of an engineered bacterium in a subject in vivo, the method comprising:
(a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group;
(b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and
(c) detecting the detectable compound in the subject,
thereby detecting the distribution of the engineered bacterium in the subject in vivo.
56. A method for diagnosing a gastrointestinal disease in a subject, the method comprising
(a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group;
(b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and (c) detecting the distribution of the detectable compound in the gastrointestinal tract of the subject, thereby diagnosing a gastrointestinal disease in the subject.
57. A method for detecting the distribution of a bio film produced by an engineered bacterium in a subject, the method comprising:
(a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid to a subject, and wherein the nonstandard amino acid comprises a first bioorthogonal reactive functional group;
(b) administering to the subject a detectable compound comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the detectable compound to the nonstandard amino acid; and
(c) detecting the detectable compound in the subject,
thereby determining the distribution of the bio film produced by the engineered bacterium in the subject.
58. A method for delivering a drug to a subject in need thereof, the method comprising:
(a) administering to the subject an engineered bacterium comprising a protein having at least one nonstandard amino acid, wherein said nonstandard amino acid comprises a first bioorthogonal reactive functional group;
(b) administering to the subject a drug comprising a second bioorthogonal reactive functional group, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group in vivo, thereby attaching the drug to the nonstandard amino acid,
thereby delivering the drug to the subject in need thereof.
59. The method of any one of claims 54-58, wherein the engineered bacterium comprises:
(a) an orthogonal translation system comprising a heterologous gene encoding an orthogonal aminoacyl tRNA synthetase and a heterologous gene encoding an orthogonal tRNA; and
(b) a heterologous nucleic acid encoding the protein having the at least one nonstandard amino acid; wherein the aminoacyl tRNA synthetase is capable of specifically aminoacylating the orthogonal tRNA with the nonstandard amino acid; and
wherein the orthogonal tRNA incorporates the nonstandard amino acid into the protein during translation.
60. The method of any one of claims 54-58, wherein step (a) is performed concurrently with step (b).
61. The method of any one of claims 54-58, wherein step (a) is performed before step (b).
62. The method of any one of claims 54-60, further comprising administering a nonstandard amino acid to the subject.
63. The method of claim 62, wherein the nonstandard amino acid is administered to the subject prior to administering the detectable compound or the drug to the subject.
64. The method of any one of claims 54-63, wherein the first bioorthogonal reactive functional group is selected from the group consisting of an azide moiety, a ketone moiety, an alkyne moiety, an alkene moiety, a tetrazine moiety, and a norbornene moiety.
65. The method of any one of claims 54-64, wherein the second bioorthogonal reactive functional group is selected from the group consisting of a hydrazine moiety, a
hydroxylamine moiety, an alkyne moiety, an azide moiety, a tetrazine moiety, and a norbornene moiety.
66. The method of any one of claims 54-65, wherein the first bioorthogonal reactive functional group is a ketone moiety, and the second bioorthogonal reactive functional group is either a hydrazine moiety or a hydroxylamine moiety.
67. The method of any one of claims 54-65, wherein the first bioorthogonal reactive functional group is an azide moiety, and the second bioorthogonal reactive functional group is an alkyne moiety.
68. The method of any one of claims 54-65, wherein the first bioorthogonal reactive functional group is an alkyne moiety, and the second bioorthogonal reactive functional group is an azide moiety.
69. The method of any one of claims 54-68, wherein the first bioorthogonal reactive functional group reacts with the second bioorthogonal reactive functional group via a click chemistry reaction.
70. The method of any one of claims 54-69, wherein the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group requires a catalytic agent.
71. The method of any one of claims 54-69, wherein the reaction between the first bioorthogonal reactive functional group and the second bioorthogonal reactive functional group does not require a catalytic agent.
72. The method of any one of claims 54-70 further comprising administering a catalytic agent to the subject.
73. The method of claim 70 or claims 72, wherein the catalytic agent is copper or nickel.
74. The method of any one of claims 54-73, wherein the detectable compound comprises a fluorescent moiety, a radioactive moiety, a colorimetric dye, a fluorescent dye, a luminescent dye, a magnetic resonance imaging (MRI) contrast agent, a CT contrast agent, a PET contrast agent, or an ultrasound contrast agent.
75. The method of any one of claims 54-74, wherein the protein further comprises a polypeptide linker.
76. The method of claim 75, wherein the polypeptide linker is flexible.
77. The method of any one of claims 54-76, wherein the protein further comprises a polypeptide tag.
78. The method of claim 77, wherein the polypeptide tag is selected from the group consisting of a poly-histidine tag, a myc tag, a FLAG tag, a hemagglutinin (HA) tag, and a V5 tag.
79. The method of any one of claims 54-78, wherein the protein is selected from the group consisting of a secreted protein, a membrane protein, or a bacterial extracellular matrix protein.
80. The method of claim 79, wherein the bacterial extracellular matrix protein is a curli fiber protein, a flagellar protein, or a pilin protein.
81. The method of any one of claims 54-79, wherein the protein is selected from the group consisting of InaV, Trat, and CsgA.
82. The method of claim 81, wherein the protein is CsgA.
83. The method of any one of claims 54-82, wherein the protein is CsgA and the nonstandard amino acid is located at an amino acid residue corresponding to residue 89 of wild-type CsgA.
84. The method of any one of claims 54-81, wherein the protein is InaV and the nonstandard amino acid is located at an amino acid residue corresponding to residue 174 of wild-type InaV.
85. The method of any one of claims 54-81, wherein the protein is Trat and the nonstandard amino acid is located at an amino acid residue corresponding to residue 200 of wild-type Trat.
86. The method of any one of claims 54-85, wherein the nonstandard amino acid is selected from the group consisting of /?-azidophenylalanine (p-AzF), azidoho mo alanine (Aha), azidolysine, homopropargylglycine (Hpg), homoallylglycine (Hag), oxonorvaline (Onv), /?-bromophenylalanine (p-BrF), /?-iodophenylalanine (p-IF), /?-ethynylphenylalanine ( ?-EtF), /?(3ra-acetylphenylalanine (p-AcF), azidonorleucine (Anl), trans-crotylglycine (Teg), selenomethionine (Se-Met), 2-aminooctynoic acid (Aoa), and propargylglycine (Pra).
87. The method of claim 86, wherein the nonstandard amino acid is p-AzP.
88. The method of claim 87, wherein the detectable compound is DBCO-Cy5.
89. The method of any one of claims 54-88, wherein the engineered bacterium is nonpathogenic.
90. The method of any one of claims 54-89, wherein the engineered bacterium is of the species Escherichia coli.
91. The method of any one of claims 54-90, wherein the engineered bacterium is of an Escherichia coli strain selected from the group consisting of C321, C321.AA and
C321.AA.exp.
92. The method of any one of claims 54-90, wherein the engineered bacterium is of the Escherichia coli Nissle 1917 strain.
93. The method of any one of claims 54-92, wherein the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a codon.
94. The method of any one of claims 54-93, wherein the engineered bacterium comprises a genome that has been recoded to reduce or eliminate a TAG codon.
95. The method of any one of claims 54-92, wherein the engineered bacterium comprises a genome that has not been recoded to reduce or eliminate a codon.
96. The method of any one of claims 54-95, wherein the engineered bacterium further comprises a prfA gene deletion.
97. The method of any one of claims 54-96, wherein the orthogonal aminoacyl tRNA synthetase is an Archea aminoacyl tRNA synthetase or a bacterial aminoacyl tRNA synthetase.
98. The method of any one of claims 54-97, wherein the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina, Desufitobacterium, Pyrococcus or Methanocaldococcus aminoacyl tRNA synthetase gene.
99. The method of any one of claims 54-98, wherein the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase is a Methanosarcina mazei, Methanosarcina barkeri, Desulfitobacterium hafniense, Pyrococcus horikoshii, or Methanocaldococcus jannaschii aminoacyl tRNA synthetase gene.
100. The method of any one of claims 54-99, wherein the orthogonal translation system is located in the bacterial genome.
101. The method of any one of claims 54-99, wherein the orthogonal translation system is located in a plasmid.
102. The method of claim 101, wherein the plasmid is pEVOL-pAzF.
103. The method of any one of claims 54-102, wherein the expression of the heterologous nucleic acid is under the control of a constitutive promoter.
104. The method of any one of claims 54-102, wherein the expression of the heterologous nucleic acid is under the control of an inducible promoter.
105. The method of claim 104, wherein the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
106. The method of any one of claims 54-105, wherein the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of a constitutive promoter.
107. The method of any one of claims 54-105, wherein the expression of the heterologous gene encoding the orthogonal aminoacyl tRNA synthetase and/or the orthogonal tRNA is under the control of an inducible promoter.
108. The method of claim 107, wherein the inducible promoter is responsive to an inducer selected from the group consisting of IPTG, arabinose, and tetracycline.
109. The method of claim 104, further comprising administering to the subject an inducer that regulates the inducible promoter.
110. The method of claim 107, further comprising administering to the subject an inducer that regulates the inducible promoter.
111. The method of claim 109 or claim 110, wherein the inducer is administered to the subject prior to administering the detectable compound or the drug to the subject.
112. The method of any one of claims 54-111, wherein the engineered bacterium is administered to the subject orally or rectally.
113. The method of any one of claims 54-112, wherein the engineered bacterium is comprised in a pharmaceutical composition.
114. The method of any one of claims 54-112, wherein the detectable compound or the drug is administered to the subject orally, subcutaneously, intravenously, rectally, or transdermally.
115. The method of any one of claims 54-112, wherein the detectable compound or the drug is comprised in a pharmaceutical composition.
116. The method of any one of claims 109-115, wherein the inducer is comprised in a pharmaceutical composition.
117. The method of any one of claims 54-116, wherein the detectable compound or the drug further comprises a drug delivery vehicle selected from the group consisting of a nanocarrier, a nanoparticle, a liposome, a dendrimer, a carbon nanotube, a micelle, and a protein.
118. The method of claim 58, wherein the drug is delivered to the gastrointestinal tract of the subject.
119. The method of claim 58, wherein the drug is delivered to the mouth, esophagus, stomach, large intestine, small intestine, rectum, colon, or anal canal of the subject..
PCT/US2017/045869 2016-08-08 2017-08-08 Engineered bacteria for non-invasive imaging and therapeutic applications Ceased WO2018031531A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662372148P 2016-08-08 2016-08-08
US62/372,148 2016-08-08

Publications (2)

Publication Number Publication Date
WO2018031531A1 true WO2018031531A1 (en) 2018-02-15
WO2018031531A4 WO2018031531A4 (en) 2018-04-05

Family

ID=61162476

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/045869 Ceased WO2018031531A1 (en) 2016-08-08 2017-08-08 Engineered bacteria for non-invasive imaging and therapeutic applications

Country Status (1)

Country Link
WO (1) WO2018031531A1 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020041723A1 (en) * 2018-08-24 2020-02-27 Talis Biomedical Corporation Live cell capture
WO2021137937A3 (en) * 2019-11-05 2021-09-30 The Trustees Of Columbia University In The City Of New York Engineered bacteria containing biosensors for precision targeting and containment
CN114053430A (en) * 2020-07-29 2022-02-18 深圳先进技术研究院 Bacterium loaded with nano drug-loaded particles as well as preparation method and application thereof
US11661600B2 (en) 2017-11-02 2023-05-30 University Of Iowa Research Foundation Methods of rescuing stop codons via genetic reassignment with ACE-tRNA
US11891662B2 (en) 2019-12-02 2024-02-06 Talis Biomedical Corporation Polynucleotides for amplification and detection of human beta actin
US12264365B2 (en) 2020-03-23 2025-04-01 Talis Biomedical Corporation Polynucleotides for amplification and detection of SARS-CoV-2
US12275999B2 (en) 2016-11-10 2025-04-15 Talis Biomedical Corporation Polynucleotides for the amplification and detection of chlamydia trachomatis

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090081669A1 (en) * 2006-02-01 2009-03-26 Encode Bio, Inc. Fluorescent Assays Using Orthogonal tRNA - Aminoacyl Synthetase Pairs
US20130244245A1 (en) * 2004-10-27 2013-09-19 The Scripps Research Institute Orthogonal Translation Components for the in Vivo Incorporation of Unnatural Amino Acids
US20130323821A1 (en) * 2008-09-26 2013-12-05 Ambrx, Inc. Non-Natural Amino Acid Replication-Dependent Microorganisms and Vaccines

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130244245A1 (en) * 2004-10-27 2013-09-19 The Scripps Research Institute Orthogonal Translation Components for the in Vivo Incorporation of Unnatural Amino Acids
US20090081669A1 (en) * 2006-02-01 2009-03-26 Encode Bio, Inc. Fluorescent Assays Using Orthogonal tRNA - Aminoacyl Synthetase Pairs
US20130323821A1 (en) * 2008-09-26 2013-12-05 Ambrx, Inc. Non-Natural Amino Acid Replication-Dependent Microorganisms and Vaccines

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12275999B2 (en) 2016-11-10 2025-04-15 Talis Biomedical Corporation Polynucleotides for the amplification and detection of chlamydia trachomatis
US11661600B2 (en) 2017-11-02 2023-05-30 University Of Iowa Research Foundation Methods of rescuing stop codons via genetic reassignment with ACE-tRNA
US12559749B2 (en) 2017-11-02 2026-02-24 University Of Iowa Research Foundation Methods of rescuing stop codons via genetic reassignment with ACE-tRNA
US12565649B2 (en) 2017-11-02 2026-03-03 University Of Iowa Research Foundation Methods of rescuing stop codons via genetic reassignment with ACE-tRNA
WO2020041723A1 (en) * 2018-08-24 2020-02-27 Talis Biomedical Corporation Live cell capture
WO2021137937A3 (en) * 2019-11-05 2021-09-30 The Trustees Of Columbia University In The City Of New York Engineered bacteria containing biosensors for precision targeting and containment
US11891662B2 (en) 2019-12-02 2024-02-06 Talis Biomedical Corporation Polynucleotides for amplification and detection of human beta actin
US12264365B2 (en) 2020-03-23 2025-04-01 Talis Biomedical Corporation Polynucleotides for amplification and detection of SARS-CoV-2
CN114053430A (en) * 2020-07-29 2022-02-18 深圳先进技术研究院 Bacterium loaded with nano drug-loaded particles as well as preparation method and application thereof

Also Published As

Publication number Publication date
WO2018031531A4 (en) 2018-04-05

Similar Documents

Publication Publication Date Title
US10195234B2 (en) Bacteria engineered to reduce hyperphenylalaninemia
US11291693B2 (en) Bacteria engineered to treat metabolic diseases
EP3341394B1 (en) Improved cell-permeable (icp)-socs3 recombinant protein and uses thereof
JP4975630B2 (en) Bacteria vector
EP3294757B1 (en) Bacteria engineered to treat a disease or disorder
US20240165168A1 (en) Engineered bacteria secreting therapeutic proteins and methods of use thereof
AU2024201593A1 (en) A genetically modified Lactobacillus and uses thereof
EP2436756B1 (en) Selective infarcted-tissue-targeting bacteria and use thereof
US20200248190A1 (en) Biosynthetic amyloid-based materials displaying functional protein sequences
JP2009525727A (en) Engineered antibody-stress protein fusion
EP3377518A1 (en) Bacteria engineered to reduce hyperphenylalaninemia
WO2022166978A1 (en) Genetically gengineered bacterium for hangover and liver disease prevention and/or treatment
US20240382536A1 (en) Bacteria engineered to treat a disease or disorder
WO2017023818A1 (en) Bacteria engineered to treat disorders involving propionate catabolism
CN116987725A (en) An engineered bacterium for targeted treatment of colorectal cancer and its construction method and application
EP2873726A1 (en) Antitumor agent, marker for tumor detection, and oral vaccine agent
EP4019539A1 (en) Recombinant bacterium and uses thereof
US20120225099A1 (en) Compositions for and methods of activating guanylyl cyclase c
KR102948253B1 (en) Anticancer Adjuvant Using Anticancer Microbials Expressing Strep-tag
Ren et al. Edwardsiella piscicida effector EseD mediates ferritinophagy by targeting NCOA4 and STING in teleost cells
KR102960064B1 (en) Anticancer Microbials Secreting Different Proteins and Anticancer Composition Comprising the Microbials
US20170246223A1 (en) Combination Therapy for Solid Tumour Cancer
Gong et al. Engineering the Escherichia coli Nissle strain for monitoring the bacterial cell distribution and therapeutic protein expression within the intestinal tract of animal models
KR102327091B1 (en) Salmonella strain for treating cancer and use thereof
WO2024064888A2 (en) Engineered microorganisms with enhanced protein expression and secretion

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17840136

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17840136

Country of ref document: EP

Kind code of ref document: A1