WO2018029097A1 - Method for synthesising amides - Google Patents

Method for synthesising amides Download PDF

Info

Publication number
WO2018029097A1
WO2018029097A1 PCT/EP2017/069773 EP2017069773W WO2018029097A1 WO 2018029097 A1 WO2018029097 A1 WO 2018029097A1 EP 2017069773 W EP2017069773 W EP 2017069773W WO 2018029097 A1 WO2018029097 A1 WO 2018029097A1
Authority
WO
WIPO (PCT)
Prior art keywords
naturally occurring
coa
acyltransferase
variant
coa ligase
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/069773
Other languages
French (fr)
Inventor
Sarah Louise LOVELOCK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Intellectual Property Development Ltd
Original Assignee
GlaxoSmithKline Intellectual Property Development Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by GlaxoSmithKline Intellectual Property Development Ltd filed Critical GlaxoSmithKline Intellectual Property Development Ltd
Publication of WO2018029097A1 publication Critical patent/WO2018029097A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P13/00Preparation of nitrogen-containing organic compounds
    • C12P13/02Amides, e.g. chloramphenicol or polyamides; Imides or polyimides; Urethanes, i.e. compounds comprising N-C=O structural element or polyurethanes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • C12N9/1029Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93Ligases (6)

Definitions

  • the present invention relates to a method for synthesising amides that is of general applicability.
  • the method may be performed in vitro or in vivo.
  • Cell lines for use in the in vivo methods also form aspects of the invention.
  • Amide bond formation is one of the most frequently encountered reactions in organic synthesis and amides are commonly found in active pharmaceutical ingredients, biologically active molecules, synthetic polymers, peptides and proteins.
  • amide- bond formation was used in the synthesis of 84% of drug candidates (Constable et al., Green Chem. 9 (5), 41 1 -420, 2007).
  • Lipases have been used as biocatalysts to generate amide bonds in organic solvents.
  • these enzymes are typically highly enantioselective (for a review, see Gotor, Bioorg Med Chem, 7, 2189-2197, 1999).
  • the currently studied lipases would appear to have narrow substrate specificity and furthermore, must be used in dry organic solvents to prevent unwanted hydrolysis.
  • the requirement for dry solvents and molecular sieves makes scaling lipase catalyzed reactions challenging, furthermore they are not compatible with multi-enzyme pathways.
  • the present invention provides a method for synthesising a non-natural amide comprising:
  • step (a) reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and (b) reaction of the product of step (a) with an amine in the presence of a naturally occurring N- acyltransferase or a variant thereof; with the proviso that where the CoA ligase and N- acyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
  • the method of the invention overcomes the disadvantages associated with prior art methods of synthesising amides.
  • the method utilises enzymes, which possess molecular recognition elements making them inherently regioselective, removing the requirement to protect other functional groups present in the reactants. Furthermore, enzymes are also often naturally enantioselective.
  • the method does not utilise, and is indeed incompatible with dry organic solvents. This minimises the amount of waste solvent generated and makes this method compatible with multi- enzyme pathways in vivo.
  • the present invention provides a method for producing an active pharmaceutical ingredient, characterised in that the active pharmaceutical ingredient is produced from a non-natural amide intermediate that is synthesised by the method described above.
  • the invention provides a host cell comprising either: (a) an expression vector comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and an expression vector comprising the coding sequence for a naturally occurring N- acyltransferase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring N-acyltransferase or a variant thereof in the host cell; or (b) an expression vector having at least two expression cassettes, a first expression cassette comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring CoA ligase or a variant thereof
  • FIGURE 1 shows stained SDS gels of fractions generated following Ni-NTA chromatography purification of CoA ligases and N-acyltransferases, the gels demonstrate the purity of the expressed enzymes.
  • FIGURE 2 shows the structures of a number of carboxylic acid substrates referred to in the examples.
  • FIGURE 3 is a graph showing the substrate specificity of nine CoA ligases measured using the EnzChek pyrophosphate detection assay
  • FIGURE 4 is an example of a HPLC trace, showing CoA ligase (PhCL) catalysed formation of a CoA ester (cinnamoyl-CoA)
  • FIGURE 5 is a graph showing the effect of CoA concentration on the activity of CoA ligases phi, PhCL, CBL and ipfF in the presence of N-acyltransferase HolE measured using the EnzChek pyrophosphate detection assay
  • FIGURE 6 shows the structures of a number of amine substrates referred to in the examples.
  • FIGURE 7 is a graph showing the amine substrate specificity of four N-acyltransferases CASHT, HolE, HCBT-MBP and HpA3 measured using the Ellman's assay
  • FIGURE 8 is a graph showing the effect of CoA concentration and the ratio of the enzymes CASHT and PhCL upon conversion as measured by HPLC.
  • FIGURE 9 shows LC-MS traces showing CoA ligase and N-acyltransferase catalysed amide bond formation
  • FIGURE 10A is a stained gel showing coexpression of N-acyltransferase CASHT and four different CoA ligases phi, PhCL, CBL and ipfF in £. co// cells.
  • FIGURE 10B is a western blot corresponding to the stained gel and shows coexpression of particular CoA ligases and N-acyltransferase CASHT in E. coli cells.
  • FIGURE 1 1 is a stained gel showing coexpression of N-acyltransferase CASHT and CoA ligase CBL, generated from E. coli cells transformed with a pCDF-Duet vector carrying both CASHT and CBL genes.
  • FIGURE 12 shows a reaction scheme for the formation of 6-chloro-N-neopentylnicotinamide
  • FIGURE 13 shows the structures of a number of amine and carboxylic acid substrates referred to in the examples
  • FIGURE 14 shows the structures of a number of secondary amines referred to in the examples
  • the present invention provides a method for synthesising a non-natural amide comprising: (a) reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and (b) reaction of the product of step (a) with an amine in the presence of a naturally occurring N-acyltransferase or a variant thereof; with the proviso that where the CoA ligase and N- acyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
  • a non-natural amide is a compound comprising an amide bond that is not the product of metabolism of any species and therefore, does not exist in nature.
  • N-(E)-p-coumaroyl-3-hydroxyanthranilic acid (YAv) and N-(E)-p-caffeoyl- 3-hydroxyanthranilic acid (YAvll) were disclosed in Moglia et al., Metabolic Engineering, 12: 223- 232, 2010.
  • the proviso that the naturally occurring CoA ligase and naturally occurring N-acyltransferase are not derived from the same source species and do not act sequentially in a metabolic pathway is intended to exclude enzyme pairs where the natural product of the CoA ligase is a substrate of the N-acyltransferase in vivo.
  • the method of the invention is one of general applicability and it is envisaged that substantially any amide could be formed by selection of the appropriate carboxylic acid and amine substrates.
  • the flexibility of the claimed method is achieved by careful selection of enzymes having appropriate substrate specificities.
  • a CoA ligase is employed that has specificity for the carboxylic acid substrate.
  • an N-acyltransferase with specificity for the product of step (a) and the amine substrate is required.
  • Most enzymes, including CoA ligases and N-acyltransferases catalyse particular reactions in vivo.
  • Examples 3 and 14 clearly demonstrate that CoA ligases are capable of accepting multiple carboxylic acid substrates.
  • the CoA ligase phi catalyses the formation of CoA thioesters from free CoA and carboxylic substrates 3-7, 9, 11 and 15.
  • Examples 7, 9, 14 and 15 demonstrate that N-acyltransferases are capable of accepting multiple CoA thioesters and amine substrates.
  • HolE accepts octanoyl CoA and the CoA thioesters generated by carboxylic acids 5, 6, 7 and 16 and amines 19, 21 , 24-26 and 28 including amines containing both aromatic moieties and non-aromatic
  • any particular CoA ligase or N-acyltransferase will not accept all substrates.
  • the panel of CoA ligases exemplified herein is capable of catalysing the ligation of carboxylic acids across of broad range of chemical space including acids containing aromatic, heteroaromatic, allylic and aliphatic groups.
  • the panel of N-acyltransferases exemplified herein is similarly capable of accepting a broad range of thioester and amine substrates, including both primary and secondary amines. To synthesise any particular amide, it will be apparent that it is first necessary to identify enzymes capable of accepting the carboxylic acid and amine substrates.
  • the substrate(s) is (are) identical to the natural substrate(s) for a known enzyme or to substrates shown to be accepted by a particular enzyme in the Examples of the present application, it is clear that the known enzyme could be used. In many cases, however, it will not be clear which enzymes will be suitable. In such cases, it would be possible to screen a panel of enzymes to identify those with activity.
  • Examples 3 and 6 which describe a screen for CoA ligases utilising the commercially available EnzChek pyrophosphate (PPi) assay kit;
  • Example 4 which describes a HPLC screen for CoA ester formation;
  • Examples 5, 8, 1 1 and 14 which describe LC-MS screens for amide formation;
  • example 7 which describes a screen for N- acyltransferases using an Ellman's assay.
  • CoA ligases are considered to have activity for a particular substrate in the EnzCheck pyrophosphate (PPi) assay if the mean Vmax in the presence of the substrate is greater than the mean Vmax in the absence of any substrate.
  • PPi EnzCheck pyrophosphate
  • a CoA ligase is considered active at a particular substrate when Vmax in the presence of the substrate is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus one standard deviation. In another embodiment, a CoA ligase is considered active at a particular substrate when Vmax in the presence of the substrate is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus two standard deviations.
  • a CoA ligase may be considered to have activity if a peak corresponding to the CoA thioester product is present in the HPLC trace.
  • the area % total of the CoA thioester peak should be greater than or equal to 1. In another embodiment, the area % total of the CoA thioester peak should be greater than or equal to 5.
  • N-Acyltransferases may be considered to have activity for the product of reaction (a) and amine, if a peak corresponding to the amide product is detected by LC-MS.
  • the area % total of the amide peak should be greater than or equal to 1 .
  • the area % total of the amide peak should be greater than or equal to 5.
  • An alternative technique for screening activity of N-acyltransferases is use of an Ellman's assay.
  • an N- acyltransferase is considered to have activity for the product of reaction (a) and amine if Vmax in the presence of the product of reaction (a) and amine is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus one standard deviation.
  • an N- acyltransferase is considered active towards a particular substrate when the Vmax in the presence of the product of reaction (a) and amine is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus two standard deviations.
  • a CoA ligase is an enzyme which catalyses the formation of CoA thioesters from free CoA and carboxylic acids at the expense of ATP.
  • Certain naturally occurring CoA ligases are known in the literature or described herein. These include the
  • phi phenylacetate CoA ligase
  • phl2 aminoacyl CoA ligase from Penicillium chrysogenum: (Uniprot 074725 and B6HL15), the cinnamate CoA ligase from Petunia hybrid (PhCL) (Uniprot I3PB37), the 4-chorobenzoate CoA ligase (CBL) from Alcaligenes sp.
  • ALP83 (Uniprot Q8GN86), the CoA ligase from Sphingomonas lbu-2 (ipfF) (Uniprot A1 E027), the CoA ligase from
  • Streptomyces carzinostaticus (ScCL) (Uniprot Q84HC5), the CoA ligase from Photorhabdus luminescens (stIB) (Uniprot Q7N526), the CoA ligase from Rhodopseudomonas palustris (RpCL) (Uniprot 007454), the CoA ligase from Leptothrix cholodnii (LcCL) (Uniprot B1Y4L8), the CoA ligase from Acinetobacter radioresistens (ArCL) (Uniprot C6RPQ0), the CoA ligase from Mycobacterium smegmatis (MsCL) (Uniprot A0QZQ6), the cinnamate CoA ligases from, Streptomyces coelicolor A3(2)(see J Bacteriol, 185(1): 20-27, 2003), soybean (four isoforms; see
  • CoA ligases may be identified by searching protein or DNA databases. Enzymes in protein databases are often assigned an EC number based on their similarity to known proteins. EC number 6.2.1 is assigned to ligases that form carbon to sulphur bonds, and covers both ATP dependent CoA ligases (which are useful in the present invention) and GTP dependent CoA ligases (which are not used). There are several subdivisions within EC number 6.2.1 (e.g. 6.2.1.1 refers to acetate CoA ligases). Accordingly, putative CoA ligases may be identified by searching within protein databases for proteins having particular EC numbers. The skilled person will appreciate that the subdivisions within EC 6.2.1 may give an indication of likely substrate specificity.
  • Protein or DNA databases can be searched to identify protein or DNA sequences similar to known CoA ligases.
  • the skilled person might expect sequence identity between CoA ligases with similar activity to be high. However, CoA ligases with activity for different substrates might exhibit lower sequence identity.
  • Example 1 shows that levels of sequence identity between CoA ligases can be low (the cyclohexanoic acid CoA ligase from Rhodopseudomonas palustris having uniprot ID 007454 and the cyclohexane carboxylate CoA ligase from Mycobacterium smegmatis having uniprot ID A0QZQ6 share just 38% sequence identity at a DNA level).
  • searching DNA databases using a known CoA ligase as a query sequence can be used to identify other putative CoA ligases.
  • searches could be used to identify DNA sequences having at least 40% sequence identity to the query sequence.
  • other putative CoA ligases can be identified by searching protein databases using a known CoA ligase as a query sequence.
  • searches could be used to identify protein sequences having at least 70% sequence identity to the query sequence.
  • Further CoA ligases may be identified by DNA hybridisation using a suitable cDNA or genomic DNA library (derived from any species) and a single stranded DNA probe of at least 100 bp derived from a query CoA ligase gene or cDNA.
  • DNA hybridisation is affected by the hybridisation conditions as outlined in the following relationship: __[Na+]__ ⁇
  • Tm 81 .5 + 16.6log 10 1 .0 + 0.7[Na + ] + 0.41 (%[G+C]) - SffiL- P - F
  • Tm the temperature at which 50% of the probe molecule is ssDNA in °C
  • %[G+C] percentage of G+C bases in probe sequence
  • n length of probe sequence in bases
  • the conditions for DNA hybridisation should not be highly stringent. Where the substrate specificity required is not too dissimilar, more stringent conditions could be used. Low stringency conditions to identify alternative CoA ligases would involve hybridisation at a temperature of 40- 48°C below the Tm (calculated assuming no mismatched base pairs) for any particular sodium ion concentration/formamide concentration combination. More stringent conditions would involve hybridisation at a temperature closer to the Tm (calculated assuming no mismatched base pairs) for any particular sodium ion concentration/formamide concentration combination.
  • hybridisation reaction could take place with stepwise increasing temperature or reduced salt/formamide concentrations in order to reduce the number of hits to a manageable number.
  • the hybridising clones could then be expressed, the proteins purified and screened according to methods well known in the art and exemplified herein.
  • the CoA ligase employed is a naturally occurring CoA ligase.
  • a naturally occurring CoA ligase is one that naturally occurs in any species and includes all allelic variations (variant forms of the enzymes that are coded by different alleles at the same locus).
  • the CoA ligase is a variant of a naturally occurring CoA ligase.
  • a variant of a naturally occurring CoA ligase is an enzyme that has an amino acid sequence that differs from any naturally occurring CoA ligase, but which has activity for the substrate carboxylic acid as determined by the methods outlined above.
  • Certain variant CoA ligases differ from naturally occurring CoA ligases simply by the inclusion of an N or C terminal tag whose inclusion facilitates purification e.g. a His tag.
  • the CoA ligase has been modified to give improved properties, for example improved activity for a particular substrate.
  • the process of modifying enzymes to improve enzymatic characteristics is known as directed enzyme evolution.
  • fluorescent assays could be exploitedin microfludics such as abcams pyrophosphate assay kit (ab1 12155) to measure CoA ligase activity or abcams thiol quantification assay kit (ab1 12158) to detect acetyltransferase activity.
  • abcams pyrophosphate assay kit (ab1 12155) to measure CoA ligase activity or abcams thiol quantification assay kit (ab1 12158) to detect acetyltransferase activity.
  • an enzyme coupled assay could be developed to provide a fluorescence based response using similar enzymes to those used in the commercially available PiPer pyrophoshate assay kit (Invitrogen P22062).
  • An alternative approach is to generate smaller more focused libraries using structure- guided saturation mutagenesis. This involves targeting specific amino acid positions within the protein which are believed to have a function in substrate binding, enzyme activity and/or stability, and randomising those positions with all 20 canonical
  • Streptomyces coelicolor A3 (2) having the double substitution A294G/A318G) was capable of using ferulate as a substrate, although the parent enzyme was incapable of doing this.
  • a further example is provided by Gm4CL3dVal367 (a mutated version of soybean 4-coumarate CoA ligase isoform 3 in which valine 367 has been deleted), which had activity for sinapate and 3,4-dimethoxy
  • an N-acyltransferase is an enzyme which catalyses the transfer of an acyl group from a thioester onto an amine or hydrazine group of a second molecule to form an amide bond.
  • Certain naturally occurring N-acyltransferases are known in the literature or described herein.
  • holothin N-acetyl transferase from Pseudoalteromonas sp having uniprot ID F8J3H2
  • hydroxycinnamoyl-CoA serotonin N-transferase from Capsicum annuum (uniprot ID Q9ATJ3)
  • hydroxycinnamyl/ benzoyl-CoA anthranilate transferase from
  • Dianthus caryophyllus (uniprot ID 024645), L-azetidine-2-carboxylic acid N-acetyl transferase (MpR1 ) and D-amino acid N-acyltransferase (HpA3) from Saccaromyces cerevisiae (Uniprot IDs E9P8D2 and P39979 respectively) and an aryl amine N-acyltransferase from Bacillus cereus (BcAT) (Uniprot Q81 AS3).
  • MpR1 L-azetidine-2-carboxylic acid N-acetyl transferase
  • HpA3 D-amino acid N-acyltransferase from Saccaromyces cerevisiae
  • BcAT Bacillus cereus
  • N-acyltransferases include enzymes having the following Uniprot IDs: Q00267, 086309, Q9HUY3, Q5YYQ3, A9ZPJ7, Q9FNP9, A9ZPJ6, 080467, P21340, Q5CPU3, Q94521 , G6FA50, Q81 MQ2, Q836H8, Q7A2S0, P80969, Q9SMB8, P9WP21 , G3XD76, Q4JQJ5, A6VCX3, P30419, P16426, Q9R381 , D8FSU9, B7SP66, D8FSU8, Q09927, Q9ZV05, Q5D8C0, Q8H9D9, P761 12, V4HKD0, A0A0F5VBE7, Q8RXB6, Q8RXB8, Q8RXB7, E3HPZ9, L8EWB7, V6JJA0, Q08649 and Q03330
  • acetyltransferases instead of N-acyltransferases.
  • the definition of acetyltransferases given therein is "an enzyme which catalyses the transfer of an acyl group from a thioester onto an amine or hydrazine group of a second molecule to form an amide bond" which is identical to the definition of N-acyltransferase given above. It is also noted that several examples of acetyltransferases listed in this provisional application are identical to those listed above. It is thus clear that these terms are intended to be synonymous.
  • the N-acyltransferase used in the methods or host cells of the invention is an acetyltransferase defined as "an enzyme which catalyses the transfer of an acyl group from a thioester onto an amine or hydrazine group of a second molecule to form an amide bond".
  • Embodiment 1 A method for synthesising a non-natural amide comprising:
  • step b reaction of the product of step a with an amine in the presence of a naturally occuring acetyltransferase or a variant thereof;
  • non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
  • Embodiment 2 A method according to embodiment 1 , wherein steps a and b take place in vitro, and wherein step a takes place in the presence of ATP and CoA.
  • Embodiment 3 A method according to embodiment 2, wherein the product of step a is not purified prior to step b.
  • Embodiment 4 A method according to embodiment 2 or embodiment 3, wherein the naturally occurring CoA ligase or a variant thereof is attached to a solid substrate.
  • Embodiment 5 A method according to any one of embodiments 2 to 4, wherein the naturally occuring acetyltransferase or a variant thereof is attached to a solid substrate Embodiment 6.
  • a method according to embodiment 1 wherein steps a and b take place in vivo in a host cell expressing the naturally occurring CoA ligase or variant thereof and the naturally occuring acetyltransferase or variant thereof.
  • Embodiment 7 A method according to embodiment 6, wherein the host cell is a prokaryotic host cell.
  • Embodiment 8 A method according to any preceding embodiment, which further comprises a step of purification of the non-natural amide product.
  • Embodiment 9 A method for producing an active pharmaceutical ingredient, characterised in that the active pharmaceutical ingredient is produced from a non-natural amide intermediate that is synthesised as defined in any one of embodiments 1 to 8.
  • Embodiment 10 A host cell comprising either:
  • an expression vector comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and an expression vector comprising the coding sequence for a naturally occurring acetyltransferase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring acetyltransferase or a variant thereof in the host cell; or
  • an expression vector having at least two expression cassettes, a first expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and a second expression cassette comprising the coding sequence for naturally occurring acetyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring acetyltransferase or a variant thereof in the host cell; or
  • an expression vector having one expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof fused in frame to a cleavable linker and then to the coding sequence for naturally occurring acetyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the fusion protein in the host cell;
  • the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring acetyltransferase
  • the CoA ligase is not a 4- coumarate CoA ligase where the acetyltransferase is a serotonin N-hydroxycinnamoyl transferase
  • the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring acetyltransferase
  • the CoA ligase is not tobacco 4-coumarate CoA ligase 2 where the acetyltransferase is the globe artichoke hct gene having accession number DQ104740 with the proviso that the expression vector of (c) does not comprise pepper serotonin N-hydroxycinnamoyltransferase fused in frame with the self processing FDMV 2A sequence followed by 4-cou
  • Embodiment 1 A host cell according to embodiment 10 which is a prokaryotic cell.
  • N-acyltransferases may be identified by searching protein or DNA databases as outlined above.
  • EC number 2.3.1 is assigned to acyltransferases.
  • Putative acyltransferases may be identified by searching within protein databases for proteins in this class. The skilled person will appreciate that the subdivisions within EC 2.3.1 may give an indication of likely substrate specificity.
  • Protein or DNA databases can be searched to identify protein or DNA sequences similar to known N-acyltransferases (or acetyltransferases as defined herein).
  • Kang et al. Plant Physiol, 140, 704- 715, 2006
  • the amino acid sequences derived from a variety of plants have between 73 and 76% identity and that pepper serotonin N-hydroxycinnamoyl transferase has 83%, 80% and 71 % amino acid identify with tomato, potato and tobacco tyramine N-hydroxycinnamoyltransferases.
  • N-Acyltransferases (or acetyltransferases as defined herein) from very different organisms or having very different substrate specificity are likely to have even lower sequence specificity. Accordingly, searching protein or DNA databases using a known N-acyltransferase (or known acetyltransferase as defined herein) as a query sequence can be used to identify other putative N-acyltransferases (or acetyltransferases as defined herein). In one embodiment, searches could be used to identify DNA sequences having at least 40% sequence identity to the query sequence. In another embodiment, searches could be used to identify protein sequences having at least 70% sequence identity to the query sequence.
  • N-acyltransferases may be identified by DNA hybridisation using a suitable cDNA or genomic DNA library (derived from any species) and a single stranded DNA probe of at least 100 bp derived from a query N-acyltransferase gene or cDNA in the manner described above for CoA ligases.
  • a suitable cDNA or genomic DNA library derived from any species
  • a single stranded DNA probe of at least 100 bp derived from a query N-acyltransferase gene or cDNA in the manner described above for CoA ligases.
  • the hybridisation reaction could take place with stepwise increasing temperature or reduced salt/formamide concentrations in order to reduce the number of hits to a manageable number.
  • the hybridising clones could then be expressed, the proteins purified and screened according to methods well known in the art and exemplified herein.
  • the N-acyltransferase (or acetyltransferase as defined herein) employed is a naturally occurring N-acyltransferase (or acetyltransferase as defined herein).
  • a naturally occurring N-acyltransferase is one that naturally occurs in any species and includes all allelic variations (variant forms of the enzymes that are coded by different alleles at the same locus).
  • the N-acyltransferase (or acetyltransferase as defined herein) is a variant of a naturally occurring N-acyltransferase (or acetyltransferase as defined herein).
  • a variant of a naturally occurring N-acyltransferase (or acetyltransferase as defined herein) is an enzyme that has an amino acid sequence that differs from any naturally occurring N-acyltransferase (or acetyltransferase as defined herein), but which has activity for the CoA thioesters and amine substrates as determined by the methods outlined above.
  • N-acyltransferases differ from naturally occurring N- acyltransferases (or acetyltransferases as defined herein) simply by the inclusion of an N or C terminal tag whose inclusion facilitates purification e.g. a His tag.
  • Example 2 describes the use of Hydroxycinnamyl/ benzoyl-CoA:anthranilate transferase from Dianthus caryophyllus that is an N- terminal 6-His-MBP (maltose binding protein) fusion which is used for increased protein solubility.
  • the N-acyltransferase (or acetyltransferase as defined herein) has been modified to give improved properties, for example improved activity for a particular substrate in the same manner as described above in relation to CoA ligases.
  • N-acyltransferases or acetyltransferases as defined herein
  • Amino acids responsible for substrate specificity of at least certain N-acyltransferases have been identified by sequence alignments, reviewing X-ray crystal structures and in vitro mutagenesis studies (see e.g. Kang et al., Plant Physiol, 140, 704- 715, 2006).
  • Key residues affecting the substrate specificity of pepper serotonin N- hydroxycinnamoyl transferase are residues 129 to 165 and the key residues affecting the substrate specificity of tyramine N-hydroxycinnamoyl transferase are residues 125 to 160.
  • the corresponding residues in other N-acyltransferases could be identified by sequence alignment as described above in relation to CoA ligases.
  • N-acyltransferase or an acetyltransferase as defined herein
  • site directed mutagenesis is described by Kang et al. (supra).
  • One mutated enzyme the pepper serotonin N-hydroxycinnamoyl transferase having the substitution Y149F used tyramine as a substrate instead of serotonin. It will be evident to the skilled reader that the techniques for directed enzyme evolution described herein could be used to evolve N- acyltransferase (or acetyltransferase as defined herein) variants with specificity for particular CoA thioesters and amine substrates.
  • the amide formation reaction that is the subject of the present invention may take place in vitro or in vivo.
  • steps (a) and (b) take place in vitro in the presence of ATP and CoA.
  • purified enzyme preparations are utilised.
  • a purified enzyme preparation has less than 5% by weight other proteins, in one embodiment this is less than 1 % by weight.
  • the native enzymes may be purified from tissue derived from the source species. More typically however, the enzymes are produced recombinantly according to known techniques. In brief, the enzymes may be produced by transfection of a host cell with an expression vector comprising the coding sequence for the enzyme operatively linked to conventional regulatory control sequences capable of controlling the expression in and optionally secretion from a host cell.
  • the transfected cell is then cultured by conventional techniques to produce the enzymes, followed by harvesting and purification according to known techniques (e.g. chromatography).
  • the enzymes could be expressed together with a signal sequence resulting in their secretion into the growth media to facilitate purification.
  • Prokaryotic cells may be used as host cells.
  • various strains of E. coli, B. subtilis, Streptomyces, and other bacilli are well known as host cells in the field of biotechnology.
  • Eukaryotic cell lines may also be used as host cells e.g. strains of yeast, insect cells as well as mammalian cells. Suitable expression vectors for use in any particular host cell are commercially available or could be synthesised by well-known techniques.
  • the enzymes In order to exhibit enzymatic activity, the enzymes must be correctly folded. Occasionally, during overexpression, incorrectly folded proteins are formed (for example in inclusion bodies). Modification of the host cell type, vector or expression conditions can affect the folding of the expressed protein. Techniques for refolding proteins are also known. Accordingly, the skilled person would have no difficulty in preparing correctly folded enzymes for use in the invention.
  • the enzymes could be attached to a solid substrate (e.g. beads) or immobilized according to known methods. The skilled person would recognise that this facilitates purification of the products of the biocatalytic reaction.
  • the product of step (a) is purified before step (b). In other embodiments, the product of step (a) is not purified prior to step (b). In such embodiments, CoA should act in a catalytic manner (this is because it is utilised in step (a) but regenerated in step (b)). Examples 5 and 6 explore the requirement for CoA for particular CoA ligase/N-acyltransferase
  • the method also comprises a step of purification of the amide product.
  • the purified amide product contains less than 5% impurities by weight, more particularly, less than 1 % impurities by weight.
  • steps (a) and (b) take place in vivo in a host cell expressing the naturally occurring CoA ligase or variant thereof and the naturally occurring N-acyltransferase or variant thereof (or naturally occurring acetyltransferase as defined herein, or variant thereof).
  • the enzymes may be produced by co-transfection of a host cell with either two expression vectors, each comprising the coding sequence for one enzyme operatively linked to conventional regulatory control sequences capable of controlling the expression in the host cell, by transfection of a host cells with a single vector having two expression cassettes, each comprising the coding sequence for one enzyme operatively linked to conventional regulatory control sequences capable of controlling the expression in the host cell, or by transfection of host cells with a single vector having one expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof fused in frame to a cleavable linker and then to the coding sequence for naturally occurring N-acyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the fusion protein in the host cell.
  • the transfected cell is then cultured by conventional techniques to produce the enzymes.
  • Linkers capable of cleaving to liberate two separate enzymes are known in the art (see e.g. Chen et al. Adv. Drug. Deliv. Rev., 65, 1357-1369, 2013)
  • Prokaryotic cells may be used as host cells.
  • various strains of E. coli, B. subtilis, Streptomyces, and other bacilli are well known as host cells in the field of biotechnology.
  • Eukaryotic cell lines may also be used as host cells e.g. strains of yeast, insect cells as well as mammalian cells. Suitable expression vectors for use in any particular host cell are commercially available or could be prepared by well-known techniques.
  • the method takes place in vivo, the only process step is to add the carboxylic acid and amine substrates to the culture medium. It is noted that ATP and CoA will be produced by the host cell itself, so this does not need to be added as a supplement.
  • the method also comprises a step of purification of the amide product.
  • the purified amide product contains less than 5% impurities by weight, more particularly, less than 1 % impurities by weight.
  • the non-natural amide products may have a variety of uses, for example as active pharmaceutical ingredients for human or veterinary use, as plant protection products or in the fine chemical industry.
  • the non-natural amide products may also form intermediates in the synthesis of other products, such as active pharmaceutical ingredients for human or veterinary use or plant protection products.
  • the invention also comprises a method for producing an active pharmaceutical ingredient for human or veterinary use or a plant protection product which comprises a step of synthesising a non-natural amide intermediate as described above.
  • the active pharmaceutical ingredient for human or veterinary use or plant protection product may be a multi-step process and the step of non-natural amide formation can take place at any point in the multi-step process.
  • Example 13 shows that this method can be worked on a preparative scale to prepare active pharmaceutical ingredient-like molecules.
  • the product of Example 13 can be used as an intermediate in the production of the active pharmaceutical ingredient, losmapimod.
  • CoA ligases were identified from a review of literature and these were labelled as phi, PhCL, CBL, ipfF, ScCL, phl2, stIB and RpCL.
  • a search of the Uniprot database for proteins labelled as cyclohex-1 -ene-1 carboxylate CoA ligases returned 94 sequences and three of these sequences were chosen at random.
  • the putative proteins LcCL, ArCL and MsCL have varying percentage identity to a known cyclohex-1 -ene-1 carboxylate CoA ligase labelled as RpCL (77%, 60% and 38% respectively). All CoA ligase genes were synthesized at Genscript and the DNA sequences were codon optimised for E. coli expression.
  • Phl2 from Penicillium chrysogenum (Uniprot B6HL15) FEBS Lett, 201 1 , (585) 893-8
  • Rhodopseudomonas palustris (Uniprot 007454) Kuver et al., Arch. Microbiol. 1995, 164, 337-345
  • N-acyltransferase A panel of phylogenetically diverse N-acyltransferase were identified by reviewing the proteins in the Expasy database (EC 2.3.1 ). These genes were synthesized at Genscript and the DNA sequences were codon optimised for E. coli expression. The genes were cloned into pCDF-Duet vectors using BamHI and Hindi 11 restriction sites so that the expressed protein contains an N-terminal 6-His tag. HCBT1 did not express solubly and was expressed as an MBP-fusion (maltose binding protein fusion).
  • MBP-fusion maltose binding protein fusion
  • HCBT1 -MBP from Dianthus caryophyllus: (Uniprot 024645) Plant Mol. Biol., 1997, (35), 777-789
  • HpA3 from Saccharomyces cerevisiae: (Uniprot P39979) Arch. Microbiol., 2004, (182), 396-403 MGSSHHHHHHSQDPMKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWK EYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDL YVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY
  • kanamycin 50 g/ml was used in all LB agar plates and media
  • streptomycin 50 g/ml was used in all LB agar plates and media
  • Chemically competent BL21 (DE3) cells were transformed with plasmids carrying the constructs for CoA ligase or N-acyltransferase expression. Cells were plated onto LB agar and incubated at 37 °C overnight.
  • LB media (5-20 ml) was inoculated with a single colony and incubated at 37°C overnight (typically 18 hours) with shaking at 200 rpm.
  • LB media 500 ml containing 1 % glycerol and 0.05 % antifoam was inoculated with the overnight seed culture (5 ml).
  • Cultures were grown in 2.5 L ultraflasks with AirOTop seals at 37 °C, 200 rpm. When the cell density reached an ⁇ ⁇ 0.6-1 .0 the culture was cooled to room temperature and the protein expression was induced with the addition of IPTG to a final concentration of 0.3 mM. The cultures were incubated for a further 18-24 hours at 18 °C. The cells were harvested by centrifugation (20 mins, 4000 rpm, 4°C) and either purified directly or stored at - 20 °C until required.
  • CASHT Cells expressing the CASHT gene were incubated at 28 °C following the addition of IPTG
  • HCBT1-MBP Protein was cultured in Terrific Broth, inoculated with IPTG to a final concentration of 0.5 mM and incubated at 15 °C post induction.
  • Cell pellets were resuspended in 35 ml lysis buffer (50 mM Tris, 150 mM NaCI, 10 % glycerol, pH 7.4- 8.0). The cells were lysed by sonication using a 13 mm probe for a total of 5 minutes (9 sec on, 9.0 sec off) at 40 % amplitude. The lysates were cleared by centrifugation (39,191 g, 4°C, 45-60 minutes).
  • Ni-NTA resin was equilibrated with lysis buffer. Briefly, the resin was resuspended in 3-4 volumes of lysis buffer, the resin was pelleted by centrifugation (4000 rpm, 5 minutes, 4 °C) and the supernatant was decanted. This wash step was repeated three times and then the resin was resuspended in lysis buffer to give a 50 % slurry. The equilibrated resin (2-3 ml) was added to the cell free lysate and incubated on a blood roller at 4°C overnight. The matrix was packed into a 10 ml polypropylene column collecting the flow through.
  • the resin was washed with 7-8 ml wash buffer (50 mM Tris, 150 mM NaCI, 10 % glycerol, 20-25 mM imidazole, pH 7.4-8.0) and the wash was collected in two fractions.
  • the protein was eluted in buffer (50 mM Tris, 150 mM NaCI, 10 % glycerol, pH 7.4-8.0) containing 50 mM imidazole (2 x 3-4 ml fractions), 100 mM imidazole (2 x 3-4 ml fractions), 200 mM imidazole (2 x 3-4 ml fractions) and then 400 mM imidazole (2 x 3-4 ml fractions).
  • Fractions were analysed by SDS-PAGE (gel images for certain enzymes are shown in figure 1 ). Fractions containing protein with the expected molecular weight were pooled and concentrated using a centrifugal concentrator (10-30 kDa cut off) to 2.5 ml final volume. Proteins were loaded onto a PD10 column (GE Healthcare) pre-equilibrated with 25 ml storage buffer (50 mM Tris containing 300 mM NaCI, 10 mM MgC , 10 % glycerol, pH 7.4). The flow through was discarded and the protein was eluted in 3.5 ml storage buffer. Protein concentration was determined using a Bradford assay according to the manufacturers protocol (Bio-Rad). The proteins were diluted in storage buffer to a working concentration of 0.5 mg/ml and stored at -80°C until required.
  • the lysis buffer additionally contained a 1/200 dilution of protease inhibitor cocktail.
  • the equilibrated Ni-NTA resin (2-3 ml) was added to the cell free lysate and incubated on a blood roller at 4°C for 1.5 hours.
  • Example 3 Pyrophosphate detection assay for the evaluation of CoA ligase substrate specificity
  • Vmax milli OD units/min
  • CoA ligases assayed have complimentary substrate profiles and together catalyse the ligation of acid molecules across a broad range of chemical space. CoA ligases were identified which accept structurally diverse acids containing aromatic, heteroaromatic, allylic and aliphatic functionality.
  • Example 4 The activity and substrate promiscuity of CoA ligases
  • Biotransformations were prepared as follows in 50 mL falcon tubes:
  • the solutions were pH adjusted to pH 8.0 prior to the addition of the CoA ligase solution (500 ⁇ , 0.5 mg/ml).
  • the reactions were incubated at 21 °C, 150 rpm for 48 hours in a Kuhner Climo Shaker.
  • Table 3 shows the peak area for each of the starting materials (acid and CoA) and the product (CoA ester) as a percentage of the summed peak areas. ATP does not bind to the column and elutes in the solvent front.
  • Figure 4 shows an example of a HPLC trace for the PhCL catalysed formation of cinnamoyl-CoA.
  • Reactions were prepared in 1.5 ml Eppendorf tubes according to table 4. Reactions were incubated overnight at 21 °C with shaking at 700 rpm in an Eppendorf thermomixer.
  • LC-MS analysis a 500 ⁇ sample was taken from each biotransformation and acetonitrile (500 ⁇ ) was added to solubilise the amide product and to precipitate any proteins. The samples were cleared by centrifugation (1 min at 13,000 rpm). A 400 ⁇ sample of the supernatant was filtered using a filter vial (Fisher, part no. 1 1969414, Mini-UniPrep Syringeless Filter, 0.45 ⁇ , PVDF filtration) and injected directly onto the LC-MS.
  • a filter vial Fisher, part no. 1 1969414, Mini-UniPrep Syringeless Filter, 0.45 ⁇ , PVDF filtration
  • the LC analysis was conducted on an Acquity UPLC CSH C18 column (50mm x 2.1 mm, i.d. 1.7 ⁇ packing diameter).
  • the UV detection was a summed signal from wavelength 210nm to 350nm.
  • MS analysis was performed using a Waters ZQ, lonisation mode: Alternate-scan positive and negative electrospray, Scan Range: 100 to 1000 AMU, Scan Time: 0.27 seconds, Inter scan Delay: 0.10 seconds
  • Table 6 gives the peak areas of each component as a percentage of the summed peak areas.
  • Example 7 Amine substrate profiling of N-acyltransferases using an Ellman's Spectrophotometric assay
  • CASHT demonstrated high activity towards amines 23 and 30, HoLE was active towards substrates 25 and 26, whilst HCBT was specific for 21. Although these proteins don't appear to be highly promiscuous, they have complimentary activities and together give access to a structurally diverse set of amide products
  • Table 8 shows the conversion to amide product and the peak areas are reported as a percentage of the summed peak areas. In addition the results are represented graphically in figure 8. The results suggest that using 0.1 equivalents of CoA yields higher conversion to the amide product than using 1 CoA equivalent and that the optimal ratio of CASHT:PhCL is approx. 2:1.
  • Example 9 In vitro amide formation using a CoA ligase and N-Acyltransferase
  • Biotransformations were performed in vitro using CoA ligases (phi, PhCL, CBL and ipfF) in combination with N-acyltransferases (CASHT and HolE) as purified proteins.
  • the enzyme activity was evaluated towards a small panel of acids and amines (figure 2 & 6).
  • Reactions were prepared in 1.5 ml Eppendorf tubes according to table 9 and incubated overnight at 21 °C with shaking 700 rpm in an Eppendorf thermomixer. Reactions containing no N-acyltransferase served as a negative control.
  • Example 10 Co-expression of a CoA ligase and N-acyltransferase in E. coli
  • the cultures were grown at 37°C, 200 rpm until they reached an OD600 of 0.5 (2-5 hours).
  • Samples (2 ml) were taken from each culture and harvested by centrifugation (13,000 rpm, 4 °C, 2 min).
  • the cells were resuspended in 1 ml filter sterilized 0.1 M CaC and the cells were then pelleted by centrifugation.
  • the cells were resuspended in 200 ⁇ of the 0.1 M CaC solution and again the cells were pelleted by centrifugation.
  • the cells were resuspended in a final volume of 60 ⁇ CaC and incubated on ice.
  • the Rosetta2(DE3)-pCDF-CASHT strain was transformed with pET28-PhCL and the BL21 (DE3)-pCDF-CASHT strain was transformed with pET28- phl, pET28-CBL and pET28-ipfF.
  • the transformations were plated onto LB agar containing kanamycin (50 g/ml) and streptomycin (50 g/ml) and incubated at 37°C overnight.
  • Colonies of the co-transformed cells were picked and used to inoculate 10 ml LB containing kanamycin (50 g/ml) and streptomycin (50 g/ml), the Rosetta2(DE3) cultures also contained chloramphenicol (34 ⁇ g ml).
  • the starter cultures were grown overnight at 37°C with shaking 200 rpm.
  • LB media 200 ml
  • containing the appropriate antibiotics and 1 % glycerol was inoculated with 4 ml of each starter culture (2 % inoculum). The cultures were grown at 37 °C until they reached an ⁇ of 0.6-0.8 (3 hours). Expression was induced with the addition of IPTG to a final concentration of 0.3 mM.
  • Protein bands were transferred from the gels to PVDF membranes using the iBIot system (according to the manufacturer's protocol).
  • the membranes were incubated at room temperature in blocking buffer (5% non-fat milk powder in PBS + 0.1 % tween) for 2 hours and then washed with PBS + 0.1 % tween.
  • the membrane was incubated in blocking buffer plus anti-polyhistidine-HRP conjugate for 1 hour at room temperature and then washed thoroughly with PBS + 0.1 % tween.
  • the anti-polyhistidine- HRP conjugate was imaged using Super Signal West extended duration substrate (Pierce) according to the manufacturer's protocol.
  • Example 11 In vivo amide bond formation using a CoA ligase and N-acyltransferase
  • Amide formation using whole cell catalysts expressing a CoA ligase and N-acyltransferase was investigated to determine the requirements for extracellular ATP and CoA.
  • Four strains were evaluated each expressing the N-acyltransferase CASHT and one of the four CoA ligases phi, PhCL, CBL or ipfF.
  • Samples were either used directly in biotransformations (termed 'resting cells'), frozen in dry ice and stored at -80 °C for 3 days (termed 'frozen cells') or frozen in dry ice then lyophilized under vacuum for 18 hours and stored at -80 °C for 3 days (termed 'lyophilized cells').
  • Example 12 Optimisation of in vivo 6-chloro-N-neopentylnicotinamide (35) production
  • CoA ligase CBL and N-acyltransferase CASHT catalyse the formation 6-Chloro-N- neopentylnicotinamide (35) from 6-chloronicotinic acid (33) and neopentylamine (34) substrates (figure 12).
  • This reaction has been optimised by recloning the genes into a single Duet vector. The effect of reaction media, substrate loading and catalyst loading on the yield of the amide product has also been evaluated.
  • the CoA ligase construct pET28a-CBL and N-acyltransferase construct pCDF-Duetl -CASHT were generated at Genscript as described in Example 1.
  • the CBL gene was recloned into the second expression cassette of the pCDF-Duetl -CASHT construct.
  • the CBL gene insert was ligated into pCDF-Duetl-CASHT in a 3:1 ratio using 50 ng of vector and T4 DNA ligase.
  • the ligation reaction was used to transform E. coli NEB 5a chemically competent cells which were plated onto LB agar containing streptomycin (50 g/ml). The plates were incubated at 37 °C overnight.
  • the overnight culture (2 ml) was used to inoculate LB media (200 mL) containing streptomycin (50 ⁇ g ml).
  • the culture was incubated at 37 °C with shaking (200 rpm) until an ⁇ ⁇ 0.6-0.8 was reached (2.5 hours).
  • Expression was induced with the addition of IPTG to a final concentration of 0.3 mM.
  • the culture was incubated at 28 °C, 200 rpm overnight (18 hours) to give a final ⁇ ⁇ of 3.9.
  • cells were lysed and analysed by SDS-PAGE.
  • a 1 ml sample was taken from the culture and the cells were pelleted by centrifugation.
  • the cells were resuspended in 400 ⁇ bugbuster containing 1 U/ml benzonase and 0.1 mg/ml lysozyme from chicken egg white.
  • Cell suspension was incubated at room temperature for 20 minutes.
  • a sample (20 ⁇ ) of the total cell lysate was removed and the remaining cells were pelleted by centrifugation (13,000 rpm, 10 minutes).
  • a second sample (20 ⁇ ) was taken from the soluble supernatant (soluble fraction).
  • Samples (20 ⁇ ) were mixed with SDS loading buffer (10 ⁇ ) and heated to 95 °C for 5 minutes.
  • the samples were run on SDS-gels 12-20% according to the manufacturer's protocol.
  • the stained gel is shown in figure 1 1 and show successful co-expression of both proteins.
  • E. coli co-expressing CBL and CASHT were produced according to Example 12.2.
  • a 200 mL culture was divided between 6 x 50 mL falcon tubes and the cells were pelleted by centrifugation (20 minutes, 4000 rpm). The cell pellets were resuspended in 5 mL reaction media (see table 13) containing either 2.5 mM or 10 mM 6-chloronicotinic 33 acid and neopentylamine 34. Biotransformations were incubated at 21 °C overnight (16 hours) with shaking at 200 rpm.
  • a sample (500 ⁇ ) was taken from each biotransformation and acetonitrile (500 ⁇ ) was added to solubilise the amide product and to precipitate any proteins.
  • the samples were cleared by centrifugation (1 min at 13,000 rpm).
  • the supernatant was filtered using a filter vial (Fisher, part no. 1 1969414, Mini-UniPrep Syringeless Filter, 0.45 ⁇ , PVDF filtration) and injected directly onto the LC-MS.
  • Fresh cell paste was produced according to Example 12.2 with the following exceptions: A glycerol stock of BL21 (DE3) transformed with pCDF-Duet1-CASHT-CBL was used to inoculate a 5 mL LB starter culture, protein was expressed in a 500 mL culture containing 1 % glycerol, 0.05 % antifoam and streptomycin (50 g/ml) and cultures were incubated at 18 °C post induction.
  • a high level of conversion to amide product was achieved at high cell density ( ⁇ ) and the conversion to product decreased with reduced catalyst loading and increasing substrate concentration.
  • the reactions containing 50-100 mM substrate solution contained a significant amount of DMSO which can cause cell lysis and reduce the efficiency of ATP regeneration, this could explain the low conversions observed.
  • Example 13 Preparative scale synthesis of 6-chloro-N-neopentylnicotinamide (35) using whole cell biocatalysts expressing a CoA ligase and an N-acyltransferase
  • 6-chloro-N- neopentylnicotinamide (35) was produced and isolated on a 100 mg scale from a 60 ml reaction.
  • CoA ligase CBL and N-acyltransferase CASHT were co-expressed in a 500 mL culture as described in example 12.2.
  • the cells were harvested by centrifugation (4000 rpm, 20 minutes), the supernatant was removed and the cell pellet was resuspended in 80 mL of fresh LB media which was used directly in the amide formation reaction.
  • 6-chloronicotinic acid (93.6 mg, 0.6 mmol) and neopentylamine (70 ⁇ , 0.6 mmol) were added to the resuspended cells (60 mL) in a 250 mL Erienmeyer flask and the reaction was incubated at 21 °C for 16 hours with shaking (200 rpm).
  • a 200 ⁇ sample was taken from the reaction and 200 ⁇ acetonitrile was added. The sample was vortexed and the cell debris was cleared by centrifugation (1 min at 13,000 rpm). The sample was filtered using a Mini-UniPrep Syringeless Filter (0.45 ⁇ , PVDF, Fisher) and analysed by LC-MS according to the analytical method in example 12.3.1.
  • the conversion (83%) was calculated relative to the remaining acid.
  • the cells were pelleted by centrifugation (4000 rpm, 10 minutes) and the product was extracted from the supernatant using ethyl acetate (2 x 50 ml). The organic phases were combined, washed with saturated NaHCC>3, dried over MgSC and concentrated under reduced pressure to give the product as a white solid (99 mg, 74 % yield).
  • Example 14 Substrate profiling of a panel of N-acyltransferases as cleared lysates in 96-well plates
  • Substrate profiling of a panel of phylogenetically diverse N-acyltransferases was performed in 96-well plates using a panel of structurally diverse amines (36a-i, figure 13) and CoA esters produced in situ from the corresponding acids (3, 5-7. 9, 14-16 & 37, figures 2 and 13) using an appropriate CoA ligase (identified using the methods in example 3 and purified according to example 2).
  • Glycerol stocks of BL21 (DE3) carrying pCDF-Duet-N-acyltransferase constructs were used to inoculate 170 ⁇ TB media containing 50 ⁇ g ml streptomycin in each well of a 96-well microtitre plate, the overnight cultures were sealed with a gas permeable seal and incubated overnight at 37 °C, 200 rpm, 85% humidity. 10 ⁇ of the overnight culture was used to inoculate 390 ⁇ TB media containing 50 ⁇ g ml streptomycin and 0.4 % glycerol in each well of a 2 ml 96-deep well plate.
  • the plates were sealed and incubated at 30 °C, 250 rpm, 85% humidity until they reached an ⁇ ⁇ of 0.6-0.8 (2 hours).
  • 40 ⁇ IPTG (10 mM solution) was added to each well and the cultures were grown for an additional 20 hours at 20 °C, 250 rpm, 85% humidity.
  • the cells were harvested by centrifugation (4000 rpm, 10 minutes, 4 °C) and the supernatant was poured off, cell pellets were stored at -80 °C until required.
  • lysis buffer 50 mM phosphate buffer pH 7.5 containing 1 mg/ml lysozyme, 0.5 mg/ml polymixin B, 0.1 U/ml Benzonase
  • 100 ⁇ of the cleared cell lysate was transferred to a fresh 96-well microtitre plate and the lysates were used directly in the assays.
  • the samples were collected in a 96-well microtitre plate and analysed by UPLC-MS according to the method described in example 5.2 but using a 2 ⁇ injection volume with UV detection being a summed signal from wavelength 210nm to 400nm.
  • CoA esters were purchased from Sigma: Acetyl coenzyme A sodium salt CAS# 102029- 73-2, Malonyl coenzyme A lithium salt CAS# 108347-84-8, Benzoyl coenzyme A lithium salt CAS# 102185-37-5, octanoyl Coenzyme A lithium salt CAS# 324518-20-9
  • Acid and amine solutions (20 mM) were prepared in 50 mM Tris buffer and pH adjusted to 8.0
  • Cinnamoyl CoA assay mix (Volume/well)
  • N-acyltransferases which were active towards either substrate 36a and/or 36b in the preliminary assay were further evaluated for activity towards CoA esters which were produced in situ from acids 3, 5-7, 9, 14-16 & 37 ( Figure 2 & 13), using catalytic CoA.
  • CoA ester assay mix (37.5 ⁇ ) and amine solution (20 mM, 12.5 ⁇ ) were added to each well of a 96- well microtitre plate.
  • N-acyltransferase lysate 50 ⁇ was added and reactions were incubated at 25 °C, 800 rpm, for 18 hours.
  • the final reaction mix contained 2.5 mM Acid, 2.5 mM CoA, 5 ⁇ g CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase lysate loading. The percentage conversion was calculated relative to standard curves of chemically synthesised amides and amine starting materials.
  • N-acyltransferases showed promiscuous activity and accepted a number of structurally diverse thioesters, yielding amide products with high conversions.
  • enzymes were active towards alternative thioesters, for example 01 StAT, 02MsAT, 64ScAT, 35MaAT, 38ShAT, 45SpAT, and 19CpAT did not accept any of the acyl donors screened in this example and are specific for acetyl CoA (described in the preliminary assay).
  • a panel of 21 N-acyltransferases were screened towards amines 36c-36i.
  • a CoA ester substrate was selected for each N-acyltransferase (based on the results in example 14.2.2) which was produced in situ catalysed by a CoA ligase using catalytic CoA.
  • CoA ester assay mix (37.5 ⁇ ) and amine solution (20 mM, 12.5 ⁇ ) were added to each well of a 96- well microtitre plate.
  • N-acyltransferase lysate 50 ⁇ was added and reactions were incubated at 25 °C, 800 rpm, for 18 hours.
  • the final reaction mix contained 2.5 mM Acid, 2.5 mM CoA, 5 ⁇ g CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase lysate loading. The percentage conversion was calculated relative to standard curves of chemically synthesised amides and amine starting materials.
  • N-acyltransferases namely, 32NtAT, 48CaAT, 49StAT, 54SIAT, 55SIAT, 56SIAT, & CASHT were highly promiscuous and accepted a number of amine substrates.
  • Other N- acyltransferases were more specific, for example 05PsAT, 07NfAT and 42GmAT had a preference for aniline analogues (36g table 17, 36a table 16) and tryptamine (36c). Together the panel of N- acyltransferases were able to operate across broad chemical space.
  • Example 15 Synthesis of tertiary amides using a CoA ligase and N-acyltransferase
  • the N-acyltransferase 1 1AtAT which in nature catalyses amide formation between agmatine and cinnamoyi CoA, demonstrated activity towards secondary amine substrates.
  • 1 1AtAT was screened for activity towards a small panel of amines (36k-36o shown in figure 14), using cinnamoyi CoA produced in situ, catalysed by a CoA ligase PhCL.
  • the final reaction mix contained 2.5 mM Acid, 2.5 mM CoA, 5 ⁇ g CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase(1 1 AtAT) lysate loading. The percentage conversion was calculated relative to standard curves of chemically synthesised amides and amine starting materials. 15.2 Results
  • AtAT was active towards a number of secondary amines and yielded tertiary amide products with reasonable yields. The highest activity was achieved with N-methylbenzylamine 36k. Not all secondary amines were accepted and no product formation was detected with proline methyl ester 36o.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

The present invention relates to a method for synthesising amides that is of general applicability. The method may be performed in vitro or in vivo. Cell lines for use in the in vivo methods also form aspects of the invention. The method for synthesising a non-natural amide comprises: a. reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and b. reaction of the product of step a with an amine in the presence of a naturally occurring acyltransferase or a variant thereof; with the proviso that where the CoA ligase and acyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid. Further, a method for producing an active pharmaceutical ingredient by the aforementioned method and host cells for carrying out said methods are envisaged.

Description

METHOD FOR SYNTHESISING AM IDES
FIELD OF THE INVENTION
The present invention relates to a method for synthesising amides that is of general applicability. The method may be performed in vitro or in vivo. Cell lines for use in the in vivo methods also form aspects of the invention.
BACKGROUND OF THE INVENTION
Amide bond formation is one of the most frequently encountered reactions in organic synthesis and amides are commonly found in active pharmaceutical ingredients, biologically active molecules, synthetic polymers, peptides and proteins. In fact, a study by the American Chemical Society Green Chemistry Institute Roundtable found that, out of a random selection of drug candidates, amide- bond formation was used in the synthesis of 84% of drug candidates (Constable et al., Green Chem. 9 (5), 41 1 -420, 2007).
Traditional methods of amide synthesis use carboxylic acid and amine substrates and require stoichiometric coupling reagents. As the reaction proceeds via a highly reactive activated intermediate, undesirable side reactions can occur leading to the formation of unwanted by-products such as ureas. The reaction suffers from poor atom economy and there is often a significant amount of toxic and metal containing waste generated, which results in the process of amide formation being costly. Other drawbacks of traditional methods of amide synthesis include a lack of control over enantio- and chemoselectivity, and the requirement for protection group chemistry.
Chemical catalytic approaches have been developed that eliminate the requirement for
stoichiometric coupling reagents and hence improve atom economy, reducing the amount of waste generated (reviewed in Pattabiraman and Bode, Nature, 480, 471 -479, 201 1 ). Boronic acid and related catalysts have found use in specialized cases, but the high temperatures required limit their widespread use. Redox based methods employing either N-heterocyclic carbenes (NHC) or metal catalysts can proceed at lower temperatures, however NHC catalysts are expensive and are typically used together with hazardous cosolvents. Furthermore, many of these approaches require aldehyde starting materials, which can be more challenging to access than the corresponding carboxylic acids.
Lipases have been used as biocatalysts to generate amide bonds in organic solvents.
Advantageously, these enzymes are typically highly enantioselective (for a review, see Gotor, Bioorg Med Chem, 7, 2189-2197, 1999). However the currently studied lipases would appear to have narrow substrate specificity and furthermore, must be used in dry organic solvents to prevent unwanted hydrolysis. The requirement for dry solvents and molecular sieves makes scaling lipase catalyzed reactions challenging, furthermore they are not compatible with multi-enzyme pathways.
There are some examples of using CoA ligases together with N-acyltransferases in order to synthesise naturally occurring amides. Korean patent application 10-2009-0097388, Kang and Back (Metabolic Engineering, 1 1 : 64-68, 2009), and Park et al. (Appl. Microbiol. Biotechnol., 81 : 43-49, 2008) disclose the production of natural phenylpropanoid amides in host cells expressing 4- coumarate CoA ligase and serotonin N-hydroxycinnamoyltransferase. Moglia and colleagues (Moglia et al., Metabolic Engineering, 12: 223-232, 2010) reported that S. cerevisiae cells transformed with genes encoding tobacco 4-coumarate CoA ligase and globe artichoke hydroxycinnamoyl CoA: shikimate/quinate hydroxycinnamoyltransferase cultured in the presence of p-coumaric acid or caffeic acid unexpectedly led to the production of N-(E)-p- coumaroyl-3-hydroxyanthranilic acid (YAv) and N-(E)-p-caffeoyl-3-hydroxyanthranilic acid (YAvll) respectively.
Dunn et al. (Angew. Chem. Int. Ed., 54: 5137-5141 , 2015) reports that in Pseudoalteromonas sp. two proteins, TmlU and HolE act sequentially in the biosynthetic pathway of thiomarinol. The promiscuity of the HolE/TmlU pair was investigated to generate thiomarinol analogues including, for example, pseudomonic acid C-aminocoumarin.
SUMMARY OF THE INVENTION
In a first aspect, the present invention provides a method for synthesising a non-natural amide comprising:
(a) reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and (b) reaction of the product of step (a) with an amine in the presence of a naturally occurring N- acyltransferase or a variant thereof; with the proviso that where the CoA ligase and N- acyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
The method of the invention overcomes the disadvantages associated with prior art methods of synthesising amides. The method utilises enzymes, which possess molecular recognition elements making them inherently regioselective, removing the requirement to protect other functional groups present in the reactants. Furthermore, enzymes are also often naturally enantioselective. In addition, the method does not utilise, and is indeed incompatible with dry organic solvents. This minimises the amount of waste solvent generated and makes this method compatible with multi- enzyme pathways in vivo.
In a second aspect, the present invention provides a method for producing an active pharmaceutical ingredient, characterised in that the active pharmaceutical ingredient is produced from a non-natural amide intermediate that is synthesised by the method described above.
Cell lines co-expressing CoA ligases and N-acyltransferases for use in the methods of the invention form a further aspect of the invention. Accordingly, in a third aspect, the invention provides a host cell comprising either: (a) an expression vector comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and an expression vector comprising the coding sequence for a naturally occurring N- acyltransferase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring N-acyltransferase or a variant thereof in the host cell; or (b) an expression vector having at least two expression cassettes, a first expression cassette comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and a second expression cassette comprising the coding sequence for naturally occurring N-acyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring N-acyltransferase or a variant thereof in the host cell; or (c) an expression vector having one expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof fused in frame to a linker and then to the coding sequence for naturally occurring N-acyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the fusion protein in the host cell; with the proviso that where the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring N-acyltransferase, the CoA ligase is not a 4-coumarate CoA ligase and the N-acyltransferase is not a serotonin N-hydroxycinnamoyl transferase; and with the proviso that where the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring N-acyltransferase, the CoA ligase is not tobacco 4-coumarate CoA ligase 2 where the acyltransferase is the globe artichoke hct gene having accession number DQ104740 amplified using primers 5'- TCTCCATGGGTAAGATCGAGGTGAGAGAATCAACGATG -3' and
5TCTCTCGAGTTAGATATCATATAGGAACTTGCTG-3'; and with the proviso that the expression vector of (c) does not comprise pepper serotonin N-hydroxycinnamoyl transferase fused in frame with the self-processing FDMV 2A sequence followed by 4-coumarate ligase 2 from Arabidopsis thaliana.
BRIEF DESCRIPTION OF THE DRAWINGS
FIGURE 1 shows stained SDS gels of fractions generated following Ni-NTA chromatography purification of CoA ligases and N-acyltransferases, the gels demonstrate the purity of the expressed enzymes.
FIGURE 2 shows the structures of a number of carboxylic acid substrates referred to in the examples.
FIGURE 3 is a graph showing the substrate specificity of nine CoA ligases measured using the EnzChek pyrophosphate detection assay
FIGURE 4 is an example of a HPLC trace, showing CoA ligase (PhCL) catalysed formation of a CoA ester (cinnamoyl-CoA)
FIGURE 5 is a graph showing the effect of CoA concentration on the activity of CoA ligases phi, PhCL, CBL and ipfF in the presence of N-acyltransferase HolE measured using the EnzChek pyrophosphate detection assay
FIGURE 6 shows the structures of a number of amine substrates referred to in the examples.
FIGURE 7 is a graph showing the amine substrate specificity of four N-acyltransferases CASHT, HolE, HCBT-MBP and HpA3 measured using the Ellman's assay
FIGURE 8 is a graph showing the effect of CoA concentration and the ratio of the enzymes CASHT and PhCL upon conversion as measured by HPLC. FIGURE 9 shows LC-MS traces showing CoA ligase and N-acyltransferase catalysed amide bond formation
FIGURE 10A is a stained gel showing coexpression of N-acyltransferase CASHT and four different CoA ligases phi, PhCL, CBL and ipfF in £. co// cells. FIGURE 10B is a western blot corresponding to the stained gel and shows coexpression of particular CoA ligases and N-acyltransferase CASHT in E. coli cells.
FIGURE 1 1 is a stained gel showing coexpression of N-acyltransferase CASHT and CoA ligase CBL, generated from E. coli cells transformed with a pCDF-Duet vector carrying both CASHT and CBL genes.
FIGURE 12 shows a reaction scheme for the formation of 6-chloro-N-neopentylnicotinamide
FIGURE 13 shows the structures of a number of amine and carboxylic acid substrates referred to in the examples
FIGURE 14 shows the structures of a number of secondary amines referred to in the examples
DETAILED DESCRIPTION OF THE INVENTION
As outlined above, the present invention provides a method for synthesising a non-natural amide comprising: (a) reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and (b) reaction of the product of step (a) with an amine in the presence of a naturally occurring N-acyltransferase or a variant thereof; with the proviso that where the CoA ligase and N- acyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
In the context of the invention, a non-natural amide is a compound comprising an amide bond that is not the product of metabolism of any species and therefore, does not exist in nature.
The non-natural products N-(E)-p-coumaroyl-3-hydroxyanthranilic acid (YAv) and N-(E)-p-caffeoyl- 3-hydroxyanthranilic acid (YAvll) were disclosed in Moglia et al., Metabolic Engineering, 12: 223- 232, 2010.
The proviso that the naturally occurring CoA ligase and naturally occurring N-acyltransferase are not derived from the same source species and do not act sequentially in a metabolic pathway is intended to exclude enzyme pairs where the natural product of the CoA ligase is a substrate of the N-acyltransferase in vivo.
The method of the invention is one of general applicability and it is envisaged that substantially any amide could be formed by selection of the appropriate carboxylic acid and amine substrates. The flexibility of the claimed method is achieved by careful selection of enzymes having appropriate substrate specificities. In other words, for the reaction described in step (a), a CoA ligase is employed that has specificity for the carboxylic acid substrate. For the reaction described in step (b), an N-acyltransferase with specificity for the product of step (a) and the amine substrate is required. Most enzymes, including CoA ligases and N-acyltransferases catalyse particular reactions in vivo. However, the high level of specificity observed in vivo results, at least in part, from the fact that, in vivo, enzymes are only exposed to the "correct" substrate(s). However, enzymes can be promiscuous and accept a range of substrates. Examples 3 and 14 clearly demonstrate that CoA ligases are capable of accepting multiple carboxylic acid substrates. By way of example, the CoA ligase phi catalyses the formation of CoA thioesters from free CoA and carboxylic substrates 3-7, 9, 11 and 15. Similarly, Examples 7, 9, 14 and 15 demonstrate that N-acyltransferases are capable of accepting multiple CoA thioesters and amine substrates. By way of example, HolE accepts octanoyl CoA and the CoA thioesters generated by carboxylic acids 5, 6, 7 and 16 and amines 19, 21 , 24-26 and 28 including amines containing both aromatic moieties and non-aromatic
heterocycles. Of course, any particular CoA ligase or N-acyltransferase will not accept all substrates. However, the panel of CoA ligases exemplified herein is capable of catalysing the ligation of carboxylic acids across of broad range of chemical space including acids containing aromatic, heteroaromatic, allylic and aliphatic groups. The panel of N-acyltransferases exemplified herein is similarly capable of accepting a broad range of thioester and amine substrates, including both primary and secondary amines. To synthesise any particular amide, it will be apparent that it is first necessary to identify enzymes capable of accepting the carboxylic acid and amine substrates. Where the substrate(s) is (are) identical to the natural substrate(s) for a known enzyme or to substrates shown to be accepted by a particular enzyme in the Examples of the present application, it is clear that the known enzyme could be used. In many cases, however, it will not be clear which enzymes will be suitable. In such cases, it would be possible to screen a panel of enzymes to identify those with activity. Performing these screens would be routine to one of ordinary skill in the art, and suitable screens are described in Examples 3 and 6, which describe a screen for CoA ligases utilising the commercially available EnzChek pyrophosphate (PPi) assay kit; Example 4, which describes a HPLC screen for CoA ester formation; Examples 5, 8, 1 1 and 14 which describe LC-MS screens for amide formation; and example 7 which describes a screen for N- acyltransferases using an Ellman's assay. CoA ligases are considered to have activity for a particular substrate in the EnzCheck pyrophosphate (PPi) assay if the mean Vmax in the presence of the substrate is greater than the mean Vmax in the absence of any substrate. In one
embodiment, a CoA ligase is considered active at a particular substrate when Vmax in the presence of the substrate is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus one standard deviation. In another embodiment, a CoA ligase is considered active at a particular substrate when Vmax in the presence of the substrate is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus two standard deviations.
An alternative technique for screening activity of CoA ligases is monitoring the CoA thioester product of reaction (a) by HPLC as described in Example 4. Accordingly, in one embodiment, a CoA ligase may be considered to have activity if a peak corresponding to the CoA thioester product is present in the HPLC trace. In one embodiment, the area % total of the CoA thioester peak should be greater than or equal to 1. In another embodiment, the area % total of the CoA thioester peak should be greater than or equal to 5.
N-Acyltransferases may be considered to have activity for the product of reaction (a) and amine, if a peak corresponding to the amide product is detected by LC-MS. In one embodiment, the area % total of the amide peak should be greater than or equal to 1 . In another embodiment, the area % total of the amide peak should be greater than or equal to 5. An alternative technique for screening activity of N-acyltransferases is use of an Ellman's assay. Accordingly, in one embodiment, an N- acyltransferase is considered to have activity for the product of reaction (a) and amine if Vmax in the presence of the product of reaction (a) and amine is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus one standard deviation. In another embodiment, an N- acyltransferase is considered active towards a particular substrate when the Vmax in the presence of the product of reaction (a) and amine is greater than or equal to the sum of the mean Vmax in the absence of any substrate plus two standard deviations.
In the context of the present invention, a CoA ligase is an enzyme which catalyses the formation of CoA thioesters from free CoA and carboxylic acids at the expense of ATP. Certain naturally occurring CoA ligases are known in the literature or described herein. These include the
phenylacetate CoA ligase (phi) and aminoacyl CoA ligase (phl2) from Penicillium chrysogenum: (Uniprot 074725 and B6HL15), the cinnamate CoA ligase from Petunia hybrid (PhCL) (Uniprot I3PB37), the 4-chorobenzoate CoA ligase (CBL) from Alcaligenes sp. ALP83: (Uniprot Q8GN86), the CoA ligase from Sphingomonas lbu-2 (ipfF) (Uniprot A1 E027), the CoA ligase from
Streptomyces carzinostaticus (ScCL) (Uniprot Q84HC5), the CoA ligase from Photorhabdus luminescens (stIB) (Uniprot Q7N526), the CoA ligase from Rhodopseudomonas palustris (RpCL) (Uniprot 007454), the CoA ligase from Leptothrix cholodnii (LcCL) (Uniprot B1Y4L8), the CoA ligase from Acinetobacter radioresistens (ArCL) (Uniprot C6RPQ0), the CoA ligase from Mycobacterium smegmatis (MsCL) (Uniprot A0QZQ6), the cinnamate CoA ligases from, Streptomyces coelicolor A3(2)(see J Bacteriol, 185(1): 20-27, 2003), soybean (four isoforms; see J Biol Chem 278, 2781- 2786, 2003) and Arabidopsis thaliana (three isoforms; see J Bacteriol, supra). Further naturally occurring CoA ligases may be identified by searching protein or DNA databases. Enzymes in protein databases are often assigned an EC number based on their similarity to known proteins. EC number 6.2.1 is assigned to ligases that form carbon to sulphur bonds, and covers both ATP dependent CoA ligases (which are useful in the present invention) and GTP dependent CoA ligases (which are not used). There are several subdivisions within EC number 6.2.1 (e.g. 6.2.1.1 refers to acetate CoA ligases). Accordingly, putative CoA ligases may be identified by searching within protein databases for proteins having particular EC numbers. The skilled person will appreciate that the subdivisions within EC 6.2.1 may give an indication of likely substrate specificity.
Protein or DNA databases can be searched to identify protein or DNA sequences similar to known CoA ligases. The skilled person might expect sequence identity between CoA ligases with similar activity to be high. However, CoA ligases with activity for different substrates might exhibit lower sequence identity. Example 1 shows that levels of sequence identity between CoA ligases can be low (the cyclohexanoic acid CoA ligase from Rhodopseudomonas palustris having uniprot ID 007454 and the cyclohexane carboxylate CoA ligase from Mycobacterium smegmatis having uniprot ID A0QZQ6 share just 38% sequence identity at a DNA level). Accordingly searching DNA databases using a known CoA ligase as a query sequence can be used to identify other putative CoA ligases. In one embodiment, searches could be used to identify DNA sequences having at least 40% sequence identity to the query sequence. Alternatively, other putative CoA ligases can be identified by searching protein databases using a known CoA ligase as a query sequence. In one embodiment, searches could be used to identify protein sequences having at least 70% sequence identity to the query sequence. Further CoA ligases may be identified by DNA hybridisation using a suitable cDNA or genomic DNA library (derived from any species) and a single stranded DNA probe of at least 100 bp derived from a query CoA ligase gene or cDNA.
DNA hybridisation is affected by the hybridisation conditions as outlined in the following relationship: __[Na+]__\
Tm = 81 .5 + 16.6log10 1 .0 + 0.7[Na+] + 0.41 (%[G+C]) - SffiL- P - F
n where Tm = the temperature at which 50% of the probe molecule is ssDNA in °C
[Na+] = Molar concentration of sodium ions
%[G+C] = percentage of G+C bases in probe sequence
n = length of probe sequence in bases
P = temperature correction for % mismatched base pairs (~1 °C per 1 % mismatch)
F = correction for formamide concentration (= 0.63°C per 1 % formamide)
When it is desired to identify a CoA ligase having very different substrate specificity to the query CoA ligase, the conditions for DNA hybridisation should not be highly stringent. Where the substrate specificity required is not too dissimilar, more stringent conditions could be used. Low stringency conditions to identify alternative CoA ligases would involve hybridisation at a temperature of 40- 48°C below the Tm (calculated assuming no mismatched base pairs) for any particular sodium ion concentration/formamide concentration combination. More stringent conditions would involve hybridisation at a temperature closer to the Tm (calculated assuming no mismatched base pairs) for any particular sodium ion concentration/formamide concentration combination. In practice, the skilled person would appreciate that the hybridisation reaction could take place with stepwise increasing temperature or reduced salt/formamide concentrations in order to reduce the number of hits to a manageable number. The hybridising clones could then be expressed, the proteins purified and screened according to methods well known in the art and exemplified herein.
In some embodiments, the CoA ligase employed is a naturally occurring CoA ligase. In the context of the present invention, a naturally occurring CoA ligase is one that naturally occurs in any species and includes all allelic variations (variant forms of the enzymes that are coded by different alleles at the same locus).
In another embodiment, the CoA ligase is a variant of a naturally occurring CoA ligase. In the context of the present invention, a variant of a naturally occurring CoA ligase is an enzyme that has an amino acid sequence that differs from any naturally occurring CoA ligase, but which has activity for the substrate carboxylic acid as determined by the methods outlined above. Certain variant CoA ligases differ from naturally occurring CoA ligases simply by the inclusion of an N or C terminal tag whose inclusion facilitates purification e.g. a His tag. In other embodiments, the CoA ligase has been modified to give improved properties, for example improved activity for a particular substrate. The process of modifying enzymes to improve enzymatic characteristics (e.g. substrate specificity) is known as directed enzyme evolution.
Techniques for directed enzyme evolution are reviewed by McLachlan et al. in chapter 3 of
Biocatalysis for the Pharmaceutical Industry: Discovery, Development and Manufacturing (Ed. J Tao et al., 2009, John Wiley and Sons Asia (Pte) Ltd.) and are well known in the art. Briefly, libraries of genes encoding variant enzymes are created which are then screened to identify enzymes with improved characteristics. DNA libraries can be made using numerous techniques and the method selected is often dependent upon the capacity of the available high throughput screening methods. Random libraries can be produced using techniques such as error prone PCR, gene shuffling and mutator strains. Screening random libraries requires assays methods which can quickly process very large numbers of variants (e.g. 106-108 variants) such as microfluidic assays or fluorescence activated cell sorting. Commercially available fluorescent assays could be exploitedin microfludics such as abcams pyrophosphate assay kit (ab1 12155) to measure CoA ligase activity or abcams thiol quantification assay kit (ab1 12158) to detect acetyltransferase activity. For FACS, an enzyme coupled assay could be developed to provide a fluorescence based response using similar enzymes to those used in the commercially available PiPer pyrophoshate assay kit (Invitrogen P22062). An alternative approach is to generate smaller more focused libraries using structure- guided saturation mutagenesis. This involves targeting specific amino acid positions within the protein which are believed to have a function in substrate binding, enzyme activity and/or stability, and randomising those positions with all 20 canonical residues or a reduced amino acid set.
Following expression of a library of CoA ligase mutants produced in this way, variants with activity towards a novel substrate could be identified using the methods outlined herein (the EnzCheck pyrophosphate (PPi) assay/UPLC-MS) or other methods known in the art.
Amino acids responsible for substrate specificity of at least certain CoA ligases have been identified using sequence alignments, reviewing X-ray crystal structures and in vitro mutagenesis studies (see in particular, Stuible and Kombrink, J Biol Chem., 276(29) 26893-26897, 2001 ; Stuible et al., FEBS Letts, 467: 1 17-122, 2000; Kaneko et al., J Bacterid., 185(1 ) 20-27, 2003; Conti et al., 16(14) 4174- 4183, 1997 and Lindermayr et al., J Biol Chem, 278(5): 2781 -2786, 2003). Key residues affecting the substrate specificity of 4 coumarate CoA ligases include the residues at positions 256, 293, 294, 320, 322, 346 and 354, 355 of the Arabidopsis thaliana 4-coumarate CoA ligase isoform 2. The corresponding residues in other CoA ligases could be identified by alignment of their sequences with the sequence of Arabidopsis thaliana 4-coumarate CoA ligase isoform 2 using commercially available computer software (e.g. the PILEUP program of the Genetics Computer Group program package, version 10.0).
An example of modifying the substrate specificity of a CoA ligase by site directed mutagenesis is described by Kaneko et al. (supra). One mutated enzyme (a 4-coumarate CoA ligase from
Streptomyces coelicolor A3 (2) having the double substitution A294G/A318G) was capable of using ferulate as a substrate, although the parent enzyme was incapable of doing this. A further example is provided by Gm4CL3dVal367 (a mutated version of soybean 4-coumarate CoA ligase isoform 3 in which valine 367 has been deleted), which had activity for sinapate and 3,4-dimethoxy
cinnamate, even though the parent enzyme was not capable of using either substrate. It will be evident to the skilled reader that the techniques for directed enzyme evolution described herein could be used to improve activity for a particular carboxylic acid substrate or even to engineer substrate specificity for a related carboxylic acid substrate.
In the context of the present invention, an N-acyltransferase is an enzyme which catalyses the transfer of an acyl group from a thioester onto an amine or hydrazine group of a second molecule to form an amide bond. Certain naturally occurring N-acyltransferases are known in the literature or described herein. These include the holothin N-acetyl transferase (HolE) from Pseudoalteromonas sp having uniprot ID F8J3H2, hydroxycinnamoyl-CoA: serotonin N-transferase from Capsicum annuum (uniprot ID Q9ATJ3), hydroxycinnamyl/ benzoyl-CoA:anthranilate transferase from
Dianthus caryophyllus (uniprot ID 024645), L-azetidine-2-carboxylic acid N-acetyl transferase (MpR1 ) and D-amino acid N-acyltransferase (HpA3) from Saccaromyces cerevisiae (Uniprot IDs E9P8D2 and P39979 respectively) and an aryl amine N-acyltransferase from Bacillus cereus (BcAT) (Uniprot Q81 AS3). Other N-acyltransferases include enzymes having the following Uniprot IDs: Q00267, 086309, Q9HUY3, Q5YYQ3, A9ZPJ7, Q9FNP9, A9ZPJ6, 080467, P21340, Q5CPU3, Q94521 , G6FA50, Q81 MQ2, Q836H8, Q7A2S0, P80969, Q9SMB8, P9WP21 , G3XD76, Q4JQJ5, A6VCX3, P30419, P16426, Q9R381 , D8FSU9, B7SP66, D8FSU8, Q09927, Q9ZV05, Q5D8C0, Q8H9D9, P761 12, V4HKD0, A0A0F5VBE7, Q8RXB6, Q8RXB8, Q8RXB7, E3HPZ9, L8EWB7, V6JJA0, Q08649 and Q03330.
This application claims priority from US provisional application no. 62/371960 filed 8 August 2016. This provisional application refers to acetyltransferases instead of N-acyltransferases. The definition of acetyltransferases given therein is "an enzyme which catalyses the transfer of an acyl group from a thioester onto an amine or hydrazine group of a second molecule to form an amide bond" which is identical to the definition of N-acyltransferase given above. It is also noted that several examples of acetyltransferases listed in this provisional application are identical to those listed above. It is thus clear that these terms are intended to be synonymous.
In one embodiment, the N-acyltransferase used in the methods or host cells of the invention is an acetyltransferase defined as "an enzyme which catalyses the transfer of an acyl group from a thioester onto an amine or hydrazine group of a second molecule to form an amide bond".
Thus, in one aspect, the invention provides the following embodiments: Embodiment 1. A method for synthesising a non-natural amide comprising:
a. reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and
b. reaction of the product of step a with an amine in the presence of a naturally occuring acetyltransferase or a variant thereof;
with the proviso that when the CoA ligase and acetyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and
with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
Embodiment 2. A method according to embodiment 1 , wherein steps a and b take place in vitro, and wherein step a takes place in the presence of ATP and CoA.
Embodiment 3. A method according to embodiment 2, wherein the product of step a is not purified prior to step b.
Embodiment 4. A method according to embodiment 2 or embodiment 3, wherein the naturally occurring CoA ligase or a variant thereof is attached to a solid substrate.
Embodiment 5. A method according to any one of embodiments 2 to 4, wherein the naturally occuring acetyltransferase or a variant thereof is attached to a solid substrate Embodiment 6. A method according to embodiment 1 , wherein steps a and b take place in vivo in a host cell expressing the naturally occurring CoA ligase or variant thereof and the naturally occuring acetyltransferase or variant thereof.
Embodiment 7. A method according to embodiment 6, wherein the host cell is a prokaryotic host cell.
Embodiment 8. A method according to any preceding embodiment, which further comprises a step of purification of the non-natural amide product.
Embodiment 9. A method for producing an active pharmaceutical ingredient, characterised in that the active pharmaceutical ingredient is produced from a non-natural amide intermediate that is synthesised as defined in any one of embodiments 1 to 8.
Embodiment 10. A host cell comprising either:
a. an expression vector comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and an expression vector comprising the coding sequence for a naturally occurring acetyltransferase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring acetyltransferase or a variant thereof in the host cell; or
b. an expression vector having at least two expression cassettes, a first expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and a second expression cassette comprising the coding sequence for naturally occurring acetyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring acetyltransferase or a variant thereof in the host cell; or
c. an expression vector having one expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof fused in frame to a cleavable linker and then to the coding sequence for naturally occurring acetyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the fusion protein in the host cell;
with the proviso that where the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring acetyltransferase, the CoA ligase is not a 4- coumarate CoA ligase where the acetyltransferase is a serotonin N-hydroxycinnamoyl transferase; and with the proviso that where the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring acetyltransferase, the CoA ligase is not tobacco 4-coumarate CoA ligase 2 where the acetyltransferase is the globe artichoke hct gene having accession number DQ104740 with the proviso that the expression vector of (c) does not comprise pepper serotonin N-hydroxycinnamoyltransferase fused in frame with the self processing FDMV 2A sequence followed by 4-coumarate ligase 2 from Arabidopsis thaliana.
Embodiment 1 1. A host cell according to embodiment 10 which is a prokaryotic cell.
Further naturally occurring N-acyltransferases (or acetyltransferases as defined herein) may be identified by searching protein or DNA databases as outlined above. EC number 2.3.1 is assigned to acyltransferases. Putative acyltransferases may be identified by searching within protein databases for proteins in this class. The skilled person will appreciate that the subdivisions within EC 2.3.1 may give an indication of likely substrate specificity.
Protein or DNA databases can be searched to identify protein or DNA sequences similar to known N-acyltransferases (or acetyltransferases as defined herein). Kang et al. (Plant Physiol, 140, 704- 715, 2006) teaches that the amino acid sequences derived from a variety of plants have between 73 and 76% identity and that pepper serotonin N-hydroxycinnamoyl transferase has 83%, 80% and 71 % amino acid identify with tomato, potato and tobacco tyramine N-hydroxycinnamoyltransferases. N-Acyltransferases (or acetyltransferases as defined herein) from very different organisms or having very different substrate specificity are likely to have even lower sequence specificity. Accordingly, searching protein or DNA databases using a known N-acyltransferase (or known acetyltransferase as defined herein) as a query sequence can be used to identify other putative N-acyltransferases (or acetyltransferases as defined herein). In one embodiment, searches could be used to identify DNA sequences having at least 40% sequence identity to the query sequence. In another embodiment, searches could be used to identify protein sequences having at least 70% sequence identity to the query sequence.
Further N-acyltransferases (or acetyltransferases as defined herein) may be identified by DNA hybridisation using a suitable cDNA or genomic DNA library (derived from any species) and a single stranded DNA probe of at least 100 bp derived from a query N-acyltransferase gene or cDNA in the manner described above for CoA ligases. As explained above, the skilled person would appreciate that the hybridisation reaction could take place with stepwise increasing temperature or reduced salt/formamide concentrations in order to reduce the number of hits to a manageable number. The hybridising clones could then be expressed, the proteins purified and screened according to methods well known in the art and exemplified herein.
In some embodiments, the N-acyltransferase (or acetyltransferase as defined herein) employed is a naturally occurring N-acyltransferase (or acetyltransferase as defined herein). In the context of the present invention, a naturally occurring N-acyltransferase (or acetyltransferase as defined herein) is one that naturally occurs in any species and includes all allelic variations (variant forms of the enzymes that are coded by different alleles at the same locus).
In another embodiment, the N-acyltransferase (or acetyltransferase as defined herein) is a variant of a naturally occurring N-acyltransferase (or acetyltransferase as defined herein). In the context of the present invention, a variant of a naturally occurring N-acyltransferase (or acetyltransferase as defined herein) is an enzyme that has an amino acid sequence that differs from any naturally occurring N-acyltransferase (or acetyltransferase as defined herein), but which has activity for the CoA thioesters and amine substrates as determined by the methods outlined above. Certain variant N-acyltransferases (or acetyltransferases as defined herein) differ from naturally occurring N- acyltransferases (or acetyltransferases as defined herein) simply by the inclusion of an N or C terminal tag whose inclusion facilitates purification e.g. a His tag. Example 2 describes the use of Hydroxycinnamyl/ benzoyl-CoA:anthranilate transferase from Dianthus caryophyllus that is an N- terminal 6-His-MBP (maltose binding protein) fusion which is used for increased protein solubility.
In other embodiments, the N-acyltransferase (or acetyltransferase as defined herein) has been modified to give improved properties, for example improved activity for a particular substrate in the same manner as described above in relation to CoA ligases.
Amino acids responsible for substrate specificity of at least certain N-acyltransferases (or acetyltransferases as defined herein) have been identified by sequence alignments, reviewing X-ray crystal structures and in vitro mutagenesis studies (see e.g. Kang et al., Plant Physiol, 140, 704- 715, 2006). Key residues affecting the substrate specificity of pepper serotonin N- hydroxycinnamoyl transferase are residues 129 to 165 and the key residues affecting the substrate specificity of tyramine N-hydroxycinnamoyl transferase are residues 125 to 160. The corresponding residues in other N-acyltransferases (or acetyltransferases as defined herein) could be identified by sequence alignment as described above in relation to CoA ligases.
An example of modifying the substrate specificity of an N-acyltransferase (or an acetyltransferase as defined herein) by site directed mutagenesis is described by Kang et al. (supra). One mutated enzyme (the pepper serotonin N-hydroxycinnamoyl transferase having the substitution Y149F) used tyramine as a substrate instead of serotonin. It will be evident to the skilled reader that the techniques for directed enzyme evolution described herein could be used to evolve N- acyltransferase (or acetyltransferase as defined herein) variants with specificity for particular CoA thioesters and amine substrates.
The amide formation reaction that is the subject of the present invention may take place in vitro or in vivo.
In one embodiment, steps (a) and (b) take place in vitro in the presence of ATP and CoA. In one embodiment, purified enzyme preparations are utilised. In the context of this invention, a purified enzyme preparation has less than 5% by weight other proteins, in one embodiment this is less than 1 % by weight. Where naturally occurring enzymes are used, the native enzymes may be purified from tissue derived from the source species. More typically however, the enzymes are produced recombinantly according to known techniques. In brief, the enzymes may be produced by transfection of a host cell with an expression vector comprising the coding sequence for the enzyme operatively linked to conventional regulatory control sequences capable of controlling the expression in and optionally secretion from a host cell. Following transfection, the transfected cell is then cultured by conventional techniques to produce the enzymes, followed by harvesting and purification according to known techniques (e.g. chromatography). In some embodiments, the enzymes could be expressed together with a signal sequence resulting in their secretion into the growth media to facilitate purification.
Prokaryotic cells may be used as host cells. For example, various strains of E. coli, B. subtilis, Streptomyces, and other bacilli are well known as host cells in the field of biotechnology. Eukaryotic cell lines may also be used as host cells e.g. strains of yeast, insect cells as well as mammalian cells. Suitable expression vectors for use in any particular host cell are commercially available or could be synthesised by well-known techniques.
In order to exhibit enzymatic activity, the enzymes must be correctly folded. Occasionally, during overexpression, incorrectly folded proteins are formed (for example in inclusion bodies). Modification of the host cell type, vector or expression conditions can affect the folding of the expressed protein. Techniques for refolding proteins are also known. Accordingly, the skilled person would have no difficulty in preparing correctly folded enzymes for use in the invention.
In some embodiments, the enzymes could be attached to a solid substrate (e.g. beads) or immobilized according to known methods. The skilled person would recognise that this facilitates purification of the products of the biocatalytic reaction.
In some embodiments, the product of step (a) is purified before step (b). In other embodiments, the product of step (a) is not purified prior to step (b). In such embodiments, CoA should act in a catalytic manner (this is because it is utilised in step (a) but regenerated in step (b)). Examples 5 and 6 explore the requirement for CoA for particular CoA ligase/N-acyltransferase
(CoA acetyltransferase) pairs. For most enzyme pairings, the reaction rate increased with increasing concentration of CoA. However, the overall conversion was higher with lower concentrations of CoA as determined by LC-MS. Any particular method can be optimised for levels of CoA utilising the methods outlined in the examples. Similarly, any particular method can be optimised for the best ratio of CoA ligase to N-acyltransferase (or acetyltransferase as defined herein). Other conditions (e.g. buffers etc.) may also be optimised according to example 12 and other methods known in the art.
In certain embodiments, the method also comprises a step of purification of the amide product. In the context of this invention, the purified amide product contains less than 5% impurities by weight, more particularly, less than 1 % impurities by weight.
In a separate embodiment, steps (a) and (b) take place in vivo in a host cell expressing the naturally occurring CoA ligase or variant thereof and the naturally occurring N-acyltransferase or variant thereof (or naturally occurring acetyltransferase as defined herein, or variant thereof).
In brief, the enzymes may be produced by co-transfection of a host cell with either two expression vectors, each comprising the coding sequence for one enzyme operatively linked to conventional regulatory control sequences capable of controlling the expression in the host cell, by transfection of a host cells with a single vector having two expression cassettes, each comprising the coding sequence for one enzyme operatively linked to conventional regulatory control sequences capable of controlling the expression in the host cell, or by transfection of host cells with a single vector having one expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof fused in frame to a cleavable linker and then to the coding sequence for naturally occurring N-acyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the fusion protein in the host cell. Following transfection, the transfected cell is then cultured by conventional techniques to produce the enzymes. Linkers capable of cleaving to liberate two separate enzymes are known in the art (see e.g. Chen et al. Adv. Drug. Deliv. Rev., 65, 1357-1369, 2013)
Prokaryotic cells may be used as host cells. For example, various strains of E. coli, B. subtilis, Streptomyces, and other bacilli are well known as host cells in the field of biotechnology. Eukaryotic cell lines may also be used as host cells e.g. strains of yeast, insect cells as well as mammalian cells. Suitable expression vectors for use in any particular host cell are commercially available or could be prepared by well-known techniques. Where the method takes place in vivo, the only process step is to add the carboxylic acid and amine substrates to the culture medium. It is noted that ATP and CoA will be produced by the host cell itself, so this does not need to be added as a supplement. In one embodiment, the method also comprises a step of purification of the amide product. In the context of this invention, the purified amide product contains less than 5% impurities by weight, more particularly, less than 1 % impurities by weight.
It will be appreciated that the non-natural amide products may have a variety of uses, for example as active pharmaceutical ingredients for human or veterinary use, as plant protection products or in the fine chemical industry. The non-natural amide products may also form intermediates in the synthesis of other products, such as active pharmaceutical ingredients for human or veterinary use or plant protection products. Accordingly, the invention also comprises a method for producing an active pharmaceutical ingredient for human or veterinary use or a plant protection product which comprises a step of synthesising a non-natural amide intermediate as described above. It will be appreciated that the active pharmaceutical ingredient for human or veterinary use or plant protection product may be a multi-step process and the step of non-natural amide formation can take place at any point in the multi-step process. In other words, the active pharmaceutical ingredient for human or veterinary use or plant protection product need not be directly synthesised from the non-natural amide product of the claimed invention. Example 13 shows that this method can be worked on a preparative scale to prepare active pharmaceutical ingredient-like molecules. The product of Example 13 can be used as an intermediate in the production of the active pharmaceutical ingredient, losmapimod.
EXAMPLES
Example 1 : Sequence information and cloning
1.1 CoA ligases
Eight CoA ligases were identified from a review of literature and these were labelled as phi, PhCL, CBL, ipfF, ScCL, phl2, stIB and RpCL. A search of the Uniprot database for proteins labelled as cyclohex-1 -ene-1 carboxylate CoA ligases returned 94 sequences and three of these sequences were chosen at random. The putative proteins LcCL, ArCL and MsCL have varying percentage identity to a known cyclohex-1 -ene-1 carboxylate CoA ligase labelled as RpCL (77%, 60% and 38% respectively). All CoA ligase genes were synthesized at Genscript and the DNA sequences were codon optimised for E. coli expression. The genes were cloned into pET28 using Ndel and Notl restriction sites so that the expressed protein contains an N-terminal 6-His tag: phi from Penicillium chrysogenum: (Uniprot 074725) Folia. Microbiol, 201 1 , (56), 246-252
MGSSHHHHHHSSGLVPRGSHMVFLPPKESGQLDPIPDNIPISEFMLNERYGRVRHASSRDPYTCGI
TGKSYSSKEVANRVDSLARSLSKEFGWAPNEGSEWDKTLAVFALNTIDSLPLFWAVHRLGGVLTPA
NASYSAAELTHQLLDSKAKALVTCVPLLSISLEAAAKAGLPKNRIYLLDVPEQLLGGVKPPAGYKSVS
ELTQAGKSLPPVDELRWSAGEGARRTAFVCYSSGTSGLPKGVMISHRNVIANTLQIKAFEQNYRDG
GGTKPASTEVALGLLPQSHIYALWIGHAGAYRGDQTIVLPKFELKSYLNAIQQYKISALFLVPPIIIHM
LGTQDVCSKYDLSSVTSLFTGAAPLGMETAADFLKLYPNILIRQGYGLTETCTVVSSTHPHDIWLGS
SGALLPGVEARIVTPENKEITTYDSPGELWRSPSWLGYLNNEKATAETFVDGWMRTGDEAVIRRS
PKGIEHVFIVDRIKELIKVKGLQVAPAELEAHILAHPDVSDCAVIAIPDDRAGEVPKAIWKSASAGSDE
SVSQALVKYVEDHKARHKWLKGGIRFVDAIPKSPSGKILRRLIRDQEKEARRKAGSKI PhCL from Petunia hybrida: (Uniprot I3PB37) The Plant Cell, 2012 (24), 2015-2030
MGSSHHHHHHSSGLVPRGSHMPMETETNQGDLIFRSKLPDIYIPKHLPLHSYCFENISEFSSRPCLI
NGANNHIYTYADVELTSRKVAAGLNKLGIQQKDTIMILLPNSPEFVFAFMGASYLGAISTMANPLFTP
AEVVKQAKASNAKLIITQACFVNKVKDYAFDNNLNVICIDSAPEGCIHFSELTQADEHDIPDVKIQSDD
VVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENANLYMHSEDVLMCVLPLFHIYSLNSVLLCG
LRVGAAILIMQKFDIVQFCELIEKYKVTIGPFVPPIVLAIAKSPVVDNYDLSSVRTVMSGAAPLGKELE
DAVRIKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFDIKSGACGTVVRNAEMKIVDPDTGCSLPRN
QPGEICIRGDQIMKGYLNDPAATTRTIDKEGWLHTGDIGYIDNDDELFIVDRLKELIKYKGFQVAPAEL
EALLLNHPNISDAAVVPMKDEQAGEVPVAFVVRSNGSDITEDEVKDFVSKQVIFYKRIKRVFFVETV
PKSPSGKILRKDLRARLAAGVPN
CBL from Alcaligenes sp. ALP83: (Uniprot Q8GN86) Biochemistry, 2007, (46), 14487-14499
MGSSHHHHHHSSGLVPRGSHMQTVNEMLRRAATRAPDHCALAVPARGLRLTHAELRARVEAVAA
RLHADGLRPQQRVAWAPNSADWIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQ
VADAIFQSGSGARIIFLGDLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESR
VLFMSTQVGLRHGRHNVVLGLMPLYHVVGFFAVLVAALALDGTYVWEEFRPVDALQLVQQEQVT
SLFATPTHLDALAAAAAHAGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSL
YMRQPKTGTEMAPGFFSEVRIVRIGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATAEKLQDG
WYRTSDVAVWTPEGTVRILGRVDDMIISGGENIHPSEIERVLGTAPGVTEVWIGLADQRWGQSVT
ACWPRLGETLSADALDTFCRSSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQVSS ipfF from Sphingomonas lbu-2: (Uniprot A1 E027) Microbiology, 2013 (159), 621 -632
MGSSHHHHHHSSGLVPRGSHMLARDLVKRCARNYPTKTAYLCGERSRSWREMDQRSDRFGVAL
QQLGHRPGEAVAI LTQESIEVYEHFFACMKIAAPRVGLNTGYVWPEMLHVLKDSEVKFLLLDTRCR
HLLAERLGELKALGITLIGYGAGHGLERDYESLLATAEGEPHWPALAPDDILFVSYTSGTTGVPKGV
MLTQEGGVNCILHSLISFGFGPDDVWYMPAASAWWVILNAFGLGNGMTTVIPDGGYQLQAYLRDI
ERFRVTVGMLVPTMLQRAIVEIQTNPVYDLSSLRMWYGSSPATPKLIRDARATFKGIKLLQAYAMT
EATGGWISYLTDADHEHALREEIELLKSVGRIGIHYDCSIRDESGQPVPIGQSGEIWLRGNTMMKGY
RNLPEATAEAMPDGWLRTNDIGRLDERGYLYLLDRQKFLIITGAVNVFPTTVEAILVEHPAVEEVAVV
GVPHPEWGEAVVAWVRKPSHRDVTVQALIDFCHGKLSRPETPKHVVFVDELPKTSNAKLKKGELK
KWLSGGAVPLPWQLEVA
ScCL from Streptomyces carzinostaticus: (Uniprot Q84HC5) J. Am. Chem. Soc. 2007, (129), 7728-7729
MGSSHHHHHHSSGLVPRGSHMHETAAAPAPAGFVPWPDDVAARYTAAGHWEGRSLGTHLAEAA
RKVPEAVCLVDGPVRMSYSELMARADGAAVRMRGLGIRPADRVVVQLPNCWEHVWTMACLRLG
ALPIWALPQYRHRELSGWTHARASALVVPDVYREFDHQALAHEVAEAQPTVRHVLVAGSDVRPD
SVDLRALCEPLDADEAARVAAELDRSAPRGEEVAMLKLSGGTTGLPKLVARTHNDLSYMIKRAAQV
CGFGRDTVYLAVLPLGHGFPNTGPGVLGTLLAGGRVVISGSPAPEAAFALMERERVTATSVVPAIV
MRWLQYRDERPGADLGSLELMQVGASRLEPEVARQVGPKLGCRLQQVFGMAEGLLCLTRLDDPD
DVVHYTQGRPISPDDEIRVVDPEGRTVGVGEPGALLTRGPYTPRGYYDSPSANARAFTPDGWYRT
GDLVRRTPDGNLIWGREKDLINRGGEKINAEEVEGFAVQVDGVLQAAAVGLPDSELGERICLFWL
ADGTRVELADVRKVMENAETASFKLPERLITLPSLPTTPMGKIDKKALRAAAGRMSET
Phl2 from Penicillium chrysogenum: (Uniprot B6HL15) FEBS Lett, 201 1 , (585) 893-8
MGSSHHHHHHSSGLVPRGSHMPTIYRSPYPDLDIQSVDLVSYLFSNPFNTPLDRPMYINAISGEQY
TFGDWQRTRSLSNGLRQSIGLKPNDVVALFSPNTIDYPVVCHAIVGSRAIVAPTSAALTALELNAQL KTSGARFIVVHSTLLETAQKAAKGTSVEKVLLIDGQTPVNGQPTCNYLANTFAPDDLLTVDPAEADR
QPTFICFSSGTSGAAKGVITTHQNITSNLQQWRQHMLESGLPSQRPRRQSAIAFLPFSHIYGLNLFM
CQCLIWGTTVWMPRFDLDLYLSCIQKYRPDELALVPPIALMLVKDPRVSKYDLSSVRKIMSAGAPL
TIELSSALEAKFTEICKTEVFCTQSWGLTETSPMATAVPNDRMDKRNTGVGCIAPNMQLRFVDPES
MKDAAVKPDGSTEPAEIWCRGPNWMGYYNNEKATKEAFHVDEDGTRWFRTGDIGTIDGDGYVTI
QDRIKEMIKYKGLQVIPSELEGKLVDHPDVEDAAVTGMWVDDMATELPVGFWLSPQAKDRDQKA
VLDGIHAWLNERIANHKRLRGGIHVLSQIPKSPSGKILRRQLRDLLKSQAPKARL stIB from Photorhabdus luminescens: (Uniprot Q7N526) Angew. Chem. Int. Ed. 2008, 47, 1942- 1945
MGSSHHHHHHSSGLVPRGSHMEKVWLKHYPADVPAEIDPDRYASLVEMFENAVAHYADQPAFIN
MGEIMTFRKLEERSRAFAAYLQNGLGLSKGDRVALMMPNLLQYPVALFGVLRAGMIWNVNPLYTP
RELEHQLNDSGTSAIVIVSNFAHTLEKIVFNTKVKHVILTRMGDQLSRPKGTLVDFAVKYIKRLVPKY
NLPDAISFRCAIQKGYRMQYVKPEINGNDLAFLQYTGGTTGVAKGAMLTHRNILANLEQAKAVYSPL
LRVGQELIVTALPLYHIFALMVNCLLLIYLGGCNLLITNPRDITGTAKELGRYPFTSVTGVNTLFNAWL
NNEEFKKLDFSTLRLWGGGMPVQKAVAEKWAKVTGTNLLEGYGLTECSPLVSCNPYNSKHYTGS
IGFPVSSTEIKLVDDDGNEVEMGQQGELWIRGPQVMAGYWNRPDATEEVLKDGWVATGDIANVNE
QGSIHIVDRKKDMILVSGFNVYPNEVEDVVSAHPKVLESAAIGVSSESSGETVKVFVVRIDPGLTEDE
LKTHCRRYLTGYKVPKIIEFRDELPKSNVGKILRRELRDEEEKVRNVA
RpCL from Rhodopseudomonas palustris: (Uniprot 007454) Kuver et al., Arch. Microbiol. 1995, 164, 337-345
MGSSHHHHHHSSGLVPRGSHMEFDAVLLPPRRAASIAAGLWHDRTINDDLDACVAHCPDKVALTA
VRLDGGAVRRFSYRELATLADRVAVGLNRLGVGRGDVVAMQLPNWWQFTVLYLACSRIGAVLNPL
MPIFRERELSFMLKHGDAKVLVVPKSFRGFDHEAMARSLQPDLPALRTIVVVDGGGADDFDTLLTT
PEWEKQPDAAAI LQGSRPSPDDITQLIYTSGTTGEPKGVMHSANTLMANIVPYAQRLALRESDVILM
ASPMAHQTGFMYGLMMPIMLRASAVLQDIWEPTKAAELIRTERVTFTMASTPFLTDLTRWKESGE
PVPSLKTFLCAGAPIPGPLVEQAQAGLGAKIVSAWGMTENGAVTLIKLDDDDKLASTTDGCPLPGVE
VKVIDGDGKTLPPNQIGRLVVRSCSNFGGYLKRPHWNGTDADGWFDTGDLAYMTADGYIRISGRS
KDVIIRGGENIPVVEVEALLYKHPAVAQVAIVAYPDERLGERACAVWPKTGASIDFAAMVEFLKAQK
LALQYIPERLVVRDAMPATPSGKIQKFRLREMLQHNDL
LcCL from Leptothrix cholodnii: (Uniprot B1Y4L8)
MGSSHHHHHHSSGLVPRGSHMNFDTVLLPPRRAASVAAGHWFDRTINDDLDACVAACPDKVALT
AVQVESGEVRRFTYRELAAMADRVAVGLSRLGVGRNDWAMQLPNGWQFTVVYLACSRIGAWN
PLMHIFRERELTFMLGHGEAKVLIVPKTFRGFDHERMVDTIRPDLPKLQQWVVGGSGANSFEALLC
GPAWENEPDAHEVLTRSRPGPDDVTQLIYTSGTTGEPKGVMHTANTVMANIIPYAERLHLGSDDW
LMASPMAHQTGFMYGLMMPIMLRASAVLQDLWDARRAVELIRSEGATFTMASTPFLSDLAKTVAET
GTSVPTLRTFLCAGAPIPGALVEQARKVLGTKIVSAWGMTENGAVTLIKLDDDDQRAFTTDGCPLP
GVELKVVDADGAELPAGQAGKLLVRAASNFGGYLHRPQWNGTDADGWFDTGDLARIDAQGYIRIS
GRSKDVIIRGGENIPVVEVEALLYRHPAVAQVAIVAYPDERLGERACAFITTKPGQSLDFAGMVEFLK
AQKLAIQYIPERLWRDALPSTPSGKLQKFKLREMVRDGSI
ArCL from Acinetobacter radioresistens. (Uniprot C6RPQ0)
MGSSHHHHHHSSGLVPRGSHMDFDAVLIPARKEAMLKQGYWLNQTILDFLRSAVEKNPDKTALVS VKVENQTEQTFSYQQLWNMTNKIALGLKQLGIEKNDVVSCQLPNWWEFTLLYLACSRIGAVLNPLM PIFRERELEFMLKRGESKVFVVPKTFRNFNHEQLANQLQNKLDSLKHVWVNGEGENNFDHLLLNH SLEQDASAVAELDNMESGPDDITQLIFTSGTTGEPKGVMHTANTLFSNIVPYAERLHLTENDVVLMA SPMAHQTGFMYGLMMPIQLNTKWLQDVWDVAKAVDLIHQHQVNFTMASTPFLNDLSNTVAEQHD KVDSLKIFLCAGAPIPGPLVQKARETLGVKVISAWGMTECGAVTLTRPEDKDERSFNTDGIALPGVEI KIVDKKGQSKTVNEAGRLMIRSCSSFGGYLKRPDLNDTNVEGWFDTGDIAYQDEQGYIRICGRKKD VIIRGGENIPVAEIESLLYKHPNIAVVALVAYADERLGERACAIIKLKDPAQLLSLNELVDFLKTHNLAIQ YIPERLEIWEEIPMTPSGKIQKFKLRELLQ
MsCL from Mycobacterium smegmatis. (Uniprot A0QZQ6)
MGSSHHHHHHSSGLVPRGSHMTAPTERRLANVLNGQYTPIDDDTAANWRAAGWWENRSIRSLLA
DAAQAHPDRIALVGRRADGGRVARTYQEFDRNANQVASVLASLGVRPDDAWVMLPNWVEYPEF
LFGINELGAIYAGIPVAYGDQQAAAILRRSRARVLVIPRRWRGNNILEQSRRLRDQIPTLQQVIVLDD
DGTDLRDGESLWSDHAHVAARQFPPPDPGQICYLGFTSGTTGEPKGAMHSHNTLIYSARRQAEHI
GTEAFGEPWNLVASPMGHHTGYVWGGVFTVMLAGTAVHVDRWDPTWGAQVVREEGVTTFFGA
PTFLQDIIRTELAGDPACPLRCMWAGAPVPRNLPAQAAEALGAYVAPAWGMTECSILTSCTPDEP
DAILRTDGSVFAGSEVKIVDDTGAAVAAGWGDLLMRGPGWYGYYDRPDATRDAYLPGLWFKTG
DRADVDENGWLRLRGRSKDIIIRGGENIPVTDVESAIFDHPDVLNAAVIGLPDERLGERVCAVLVTKS
GCPELTVDTLGEYLLGQGLSKHYLPEKVVHLDELPMTPSGKIQKFKLREQYS
1.2 N-Acyltransferases
A panel of phylogenetically diverse N-acyltransferase were identified by reviewing the proteins in the Expasy database (EC 2.3.1 ). These genes were synthesized at Genscript and the DNA sequences were codon optimised for E. coli expression. The genes were cloned into pCDF-Duet vectors using BamHI and Hindi 11 restriction sites so that the expressed protein contains an N-terminal 6-His tag. HCBT1 did not express solubly and was expressed as an MBP-fusion (maltose binding protein fusion).
HolE from Pseudoalteromonas sp: (Uniprot F8J3H2) Angew. Chem. Int. Ed. 2015, (54), 1 -6
MGSSHHHHHHSQDPMSEKLDSYKLMQEHQTWTSKPASLEEWQIVNEWAIAEKWDLGLGDTERFF
NIDEEGFYLGYVNDEPVASVSWNYTDEYAYAGFYLVAPGARGKGYGLRLSYDAFRHCDKRSVGL
DGMPEQEENYKKGGFVTHYETSRLVGIHNQQVDAPDGVQNITADNIDEVIKFDEKITGYPRAALLKD
WFSGEGRHGFVINSGDGVIGWGIRRSTDGYRLGPLYSENQAVCDKLFAMALAQVPQGTQVTIDA
PTLDLGFINGLKKMGFEEIFHTFRMYRGKEPQGEKHKIQAIASLELG
CASHT from Capsicum annuum: (Uniprot Q9ATJ3) Plant Physiology, 2004 (135) 346-356
MGSSHHHHHHSQDPMASAPQPPTLSEKTTNLSPENDNVTITGKIYTRVRLATKSDLHHAYQLFYQI
HAYHNQFHLFKATESSLSDLFFKENPLPLFYGPTLLLLEVSPTAFTEPKNNKDEGFKPVFTALDLKFP
VVEGQVEEFRSKYDDGTDKRDVFIAGYAYFFASYSLFGNDKPGIHFDSLYFRESYRKLGMGKLLFG
TVASIAANNGFAAVEGIVAVWNKKSYDFYVSMGVEMHDDFRFGKLDGENLQKYADKEKNGAGSC
HCBT1 -MBP from Dianthus caryophyllus: (Uniprot 024645) Plant Mol. Biol., 1997, (35), 777-789
MGHHHHHHGMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGD
GPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLP
NPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAK
AGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSK
PFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMEN
AQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGDPMSIQIKQSTMVRPAEETPNK
SLWLSNIDMILRTPYSHTGAVLIYKQPDNNEDNIHPSSSMYFDANILIEALSKALVPFYPMAGRLKING
DRYEIDCNAEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDYSKGISSFPLLMVQLTRFRCGG
VSIGFAQHHHVCDGMAHFEFNNSWARIAKGLLPALEPVHDRYLHLRPRNPPQIKYSHSQFEPFVPS LPNELLDGKTNKSQTLFILSREQINTLKQKLDLSNNTTRLSTYEWAAHVWRSVSKARGLSDHEEIKL IMPVDGRSRINNPSLPKGYCGNVVFLAVCTATVGDLSCNPLTDTAGKVQEALKGLDDDYLRSAIDH TESKPGLPVPYMGSPEKTLYPNVLVNSWGRIPYQAMDFGWGSPTFFGISNIFYDGQCFLIPSRDGD GSMTLAINLFSSHLSRFKKYFYDF
Be AT from Bacillus cereus: (Uniprot Q81AS3) J. Bio. Chem. 2013, (288), 22493-22505
MGSSHHHHHHSQDPMTDFQKQFFARLHIEEKDTVSFEDLSNIMYAMAQTVPFENLNILEKNFKEISK
ENLKEKILVNNRGGLCYELNPTMYYFLKDSGFDVHLVSGTVYNAANSIWAVDSGHIATVLTHHNELY
LIEVGFGSYLPLAPVPFLGEVIHSATGDYRIRKEMTEKGNYILEMRKNNEFLDQSAADDWTLGYAFYI
EEVDEEKANTAQKIIVEHEGSPFNKVPLIVKLTEDGHASLTKDSLTVAKNGKKTKETVTDMQYTNLL
HSKFGITL
HpA3 from Saccharomyces cerevisiae: (Uniprot P39979) Arch. Microbiol., 2004, (182), 396-403 MGSSHHHHHHSQDPMKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWK EYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDL YVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY
01 StAT : (Uniprot Q00267)
MGSSHHHHHHSQDPMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPFENLDVLLPREIQLD
ETALEEKLLYARRGGYCFELNGLFERALRDIGFNVRSLLGRVILSHPASLPPRTHRLLLVDVEDEQWI
ADVGFGGQTLTAPLRLQAEIAQQTPHGEYRLMQEGSTWILQFRHHEHWQSMYCFDLGVQQQSDH
VMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTRYHQGHAVEQVNVPDVPSLYQLLQ
QQFGLGVNDVKHGFTEAELAAVMAAFDTHPEAGK
02MsAT : (Uniprot 086309)
MGSSHHHHHHSQDPMAMDLGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFENLDPLLGIPVADL
SAEALFAKLVDRRRGGYCYEHNGLLGYVLEELGFEVERLSGRVVWMRADDAPLPAQTHNVLSVAV
PGADGRYLVDVGFGGQTLTSPIRLEAGPVQQTRHEPYRLTRHGDDHTLAAQVRGEWQPLYTFTTE
PRPRIDLEVGSWYVSTHPGSHFVTGLTVAVVTDDARYNLRGRNLAVHRSGATEHIRFDSAAQVLDA
IVNRFGIDLGDLAGRDVQARVAEVLDT
05PsAT : (Uniprot Q9HUY3)
MGSSHHHHHHSQDPMTPLTPEQTHAYLHHIGIDDPGPPSLANLDRLIDAHLRRVAFENLDVLLDRPI
EIDADKVFAKWEGSRGGYCFELNSLFARLLLALGYELELLVARVRWGLPDDAPLTQQSHLMLRLYL
AEGEFLVDVGFGSANPPRALPLPGDEADAGQVHCVRLVDPHAGLYESAVRGRSGWLPLYRFDLR
PQLWIDYIPRNWYTSTHPHSVFRQGLKAAITEGDLRLTLADGLFGQRAGNGETLQRQLRDVEELLDI
LQTRFRLRLDPASEVPALARRLAGLISA
07NfAT : (Uniprot Q5YYQ3)
MGSSHHHHHHSQDPMSKPDDPAYHWNGAELDLDAYLARIGFAGERAPTLATLRELVYRHTTAIPF
ENLEAVLGRPVRLDLATLQDKLVHSRRGGYCYENAGLFAAALERLGFGVTGHTGRVTMGAGGLRP
ATHALLRVTTADDDRVWMCDVGFGRGPLRPYELRPQPDEFTLGDWRFRLERRTGELGTDLWVLH
QFGRDGWVDRYTFTTAPQYRIDFEVGNHFVSTSPRSPFTTRPFLQRFHSDRHHVLDGLTLITERPD
GSADIRALTPGELPEVINELFDIELPGPDLDALTTGSWLERVAAGTP
I OHVAT : (Uniprot A9ZPJ7)
MGSSHHHHHHSQDPMKITVHSSKAVKPEYGACGVAPGCTADWPLTVLDKANFDTYISVIYAFHPP
APPNAVLEAGLGRALVDYREWAGRLGVDANGDRAILLNDAGARFVEATADVALDSVMPLKPTSEV
LSLHPSGDDGPEELMLIQVTRFACGSLWGFTAQHLVSDGRATSNFFLAWSQATRGVAVDPVPVH
DRASFFHPREPLHVEYEHRGVEFKPYEKAHDVVCGADGDEDEWVNKVHFSREFISKLKAQASAG
APRPCSTLQCWAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTT
AGELVDRPVKHAVELISREVARINDGYFKSFIDFANSGAVEKERLVATADAADMVLSPNIEVDSWLRI
PFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVDAYVPLFSRDMNTFKNCCYSLD
11 At AT : (Uniprot Q9FNP9)
MGSSHHHHHHSQDPMALKVIKISRVSPATASVDPLIVPLSFFDLQWLKLNPTEQVFFYKLTESSSSR
DVFYSSILPKLERSLSLILTHFRLFTGHLKWDSQDPKPHLVVLSGDTLSLTVAETDADFSRISGRGLR
PELELRPLIPELPIYSDSGAWSLQVTLFPKQGFCIGTTAHHVVLDGKTAEKFNKAWAHTCKHGTIPK
ILPTVLDRSWNVPAGLEQKMLELLPYLTEDDKENGRTLKLPPVKEINAKDNVLRITIEISPENIEKLKE
RAKKESTRAELHLSTFVVTFAHVWTCMVKARSGDPNRPVRFMYAADFRNRLEPPVPVTYFGTCVL
AMDFYKYKAKEFMGEDGFVNTVEILSDSVKRLASQGVESTWKVYEEGTKTMKWGTQLLVVNGSN
QIGMYETDFGWGRPIHTETMSIYKNDEFSMSKRRDGIGGVEIGISLKKLEMDTFLSLFYKWIGN
12HvAT : (Uniprot A9ZPJ6)
MGSSHHHHHHSQDPMKITVHSSKAVKPEYGACGLAPGCTADWPLTVLDKANFDTYISVIYAFHAP
APPNAVLEAGLGRALVDYREWAGRLGVDASGGRAILLNDAGARFVEATADVALDSVMPLKPTSEV
LSLHPSGDDGPEELMLIQVTRFACGSLWGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVPVHD
RASFFHPREPLHVEYEHRGVEFKPCEKAHDVVCGADGDEDEWVNKVHFSREFISKLKAHASAGA
PRPCSTLQCWAH LWRSMTMARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTA
GELVTRPVKHAVELISREVARINDGYFKSFIDFANSGAVEKERLVATADAADMVLSPNIEVDSWLRIP
FYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVDAYVPLFSRDMNTFKNCCYSLD
14At AT : (Uniprot 080467)
MGSSHHHHHHSQDPMPIHIGSSIPLMVEKMLTEMVKPSKHIPQQTLNLSTLDNDPYNEVIYKACYVF
KAKNVADDDNRPEALLREALSDLLGYYYPLSGSLKRQESDRKLQLSCGGDGGGVPFTVATANVEL
SSLKNLENIDSDTALNFLPVLHVDIDGYRPFALQVTKFECGGFILGMAMSHAMCDGYGEGHIMCALT
DLAGGKKKPMVTPIWERERLVGKPEDDQPPFVPGDDTAASPYLPTDDWVTEKITIRADSIRRLKEAT
LKEYDFSNETITTFEVIGAYLWKSRVKALNLDRDGVTVLGLSVGIRNWDPPLPDGYYGNAYIDMYV
PLTAREVEEFTISDIVKLIKEAKRNAHDKDYLQEELANTEKIIKMNLTIKGKKDGLFCLTDWRNIGIFGS
MDFGWDEPVNIVPWPSETARTVNMFMRPSRLESDMVGGVQIVVTLPRIAMVKFKEEMEALE
18BsAT : (Uniprot P21340)
MGSSHHHHHHSQDPMSVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLE
KELSNMSSQFFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIAL
ERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLI 19CpAT : (Uniprot Q5CPU3)
MGSSHHHHHHSQDPMISSFEVRKATIDDYFELRNLICDVTRCTETLSREQAEERFRYNTYHPYCLV DTENGRIVGYAGFYIIPHLGRKNDSRIEHVIISKEYRNRGLGRLLCKQIIEDAKNKFNCGRIDLTVESHI AKKLYSSLEFEKVNTEVMRNSFLDLTPKSD
23DmAT : (Uniprot Q94521 )
MGSSHHHHHHSQDPMEVQKLPDQSLISSMMLDSRCGLNDLYPIARLTQKMEDALTVSGKPAACPV
DQDCPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLKPLPDNCSYKAVNKKGEII
GVFLNGLMRRPSPDDVPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGKILSVDTNY
RGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQFADYKPQGEVVFKPA
APHVGIQVMAKEVGPAKAAQTKL
24LIAT : (Uniprot G6FA50)
MGSSHHHHHHSQDPMNEITYTQIMPNDIDDVIRIERATFSENEALSVESMIERINLIPDSFIAARNSEG TVVGYVSGPVTEGRYLDDESFERTEANPKTGGFQKIISLTVDPDYQGLGIATNLLLLLEKEAKSKKRL GISLTCHDYLVPYYEKHGFTNEGLSESKFGGETWYNMVMEF
28BaAT : (Uniprot Q81 MQ2)
MGSSHHHHHHSQDPMKMMDANEIISFIQKSEKKTPVKVYIKGDLKEVTFPETVQAFVNKKSGVLFG EWSEIKTILDENSKYIVDYWENDRRNSAIPMLDLKGIKARIEPGAIIRDHVEIGDNAVIMMNATINIGA VIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDWIGANWVLEGVTVGK G AVVAAG AWT E D VP P YTVVAGT P ARVI KEIDEKTKAKTEIKQELRQLNPEK
29EfAT : (Uniprot Q836H8)
MGSSHHHHHHSQDPMDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFGDWA DVKPFLEANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAWG AGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEWIGANAVVLEGVRVGEGAV VAAG AVW E D V P AH TVVAG VP AKV I KQIDDKTKSKTEILEELRKL
30SaAT : (Uniprot Q7A2S0)
MGSSHHHHHHSQDPMVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCE ADDWKPFYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAWMMGATINIGA VVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAVILEGVRVGKG AIVAAGAIVTQDVPAGAWAGTPAKVIKQASEVQDTKKEIVAALRKLND
31 NtAT : (Uniprot P80969)
MGSSHHHHHHSQDPMATTNNKNLTITEKVYVRVRLANEADISHIYKLFYQIHEYHNYTHLYKATESS LCDLLFKANPNPLFYGPSVLLLEVSPTPFENTKKDEKFKPVLKTFDLRATVEDKEAEEFKSKSCGDE KEDVFIAGYAFFYANYSCFYDKAGIYFESLYFRESYRKLGMGGLLFGTVASIAANNGFASVEGIVAV WNKKSYDFYVNMGVEIFDEFRYGKLVGDALQKYADKEKV
32NtAT : (Uniprot Q9SMB8)
MGSSHHHHHHSQDPMATTNNKNLTITEKVYVRVRLANEADISHIYKLFYQIHEYHNYTHLYKATESS LCDLLFKANPNPLFYGPSVLLLEVSPTPFENTKKDEKFKPVLKTFDLRATVEDKEAEEFKSKSCGDE KEDVFIAGYAFFYANYSCFYDKAGIYFESLYFRESYRKLGMGSLLFGTVASIAANNGFASVEGIVAV WNKKSYDFYVNMGVEIFDEFRYGKLVGDALQKYADKEKA 33MtAT : (Uniprot P9WP21 )
MGSSHHHHHHSQDPMSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVEL
AALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNWWTN
HGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYWPTGVRIADADRVRLGAHLAPGTTVMHE
GFVNYNAGTLGASMVEGRISAGWVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGIS
LGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDL
HAN
34PaAT : (Uniprot G3XD76)
MGSSHHHHHHSQDPMSQSLFSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAAVAPILGYAAGN
QALTFTSQQAYQLADALKGIDAAQSALLSRLAESQKPLVATLLAEDAAPSSTAEAYLKLHLLSHRLVK
PHAVNLSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLLEVFSVDKFPKMTDYVVPAGVRIADT
ARVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTMGTLSGGGN
IVISVGEGCLIGANAGIGIPLGDRNIVEAGLYITAGTKVALLDEQNALVKVVKARDLAGQPDLLFRRNS
QNGAVECKTNKTAIELNEALHAHN
35MaAT : (Uniprot Q4JQJ5)
MGSSHHHHHHSQDPMLPDKTALPIITLSQPTAEVGAQVHRLISKCPPLDPNSMYCNLLQSSHFSET
AVAAKIGDELVGFVSGYRIPQRPDTLFVWQVAVGEKARGQGLATRMLKAILARPVNQDINRIETTITP
NNKASWALFEGLAKKLDTQIGSAVMFDKTRHFADQHETEMLVKVGPFKAVQA
36PaAT : (Uniprot A6VCX3)
MGSSHHHHHHSQDPMSASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQ GYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGL HVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
37HsAT : (Uniprot P30419)
MGSSHHHHHHSQDPMADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSP
ANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASK
RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNEN
YVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRWSSRKLVGFISAI PANIHIYDTEKKMVEI
NFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSH
LSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQ
ENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKG
FDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ
38ShAT : (Uniprot P16426)
MGSSHHHHHHSQDPMSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQEWTDDLV RLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGSTLYTHLLKSLEA QGFKSWAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGFWQLDFSLPVPPRPVLPV TEI
39SeAT : (Uniprot Q9R381 )
MGSSHHHHHHSQDPMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMA DGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDT SPENTISQKVHQALGFEETERVIFYRKRC 41GmAT : (Uniprot D8FSU9)
MGSSHHHHHHSQDPMADRIRYSKSQLEKYYDRIAFPASDRRYDISNLSSEDQRSYLDTLTKQQILT
VPFENLTLHYSWHRTVDVNADHLYDKIVNERRGGYCMENNTFFNTVLLSLGYHTYMVGSRVFNPD
ADRFGGTSHCLSLVIIDGKTLAVDVGFGGRNPTEPLEVEHERVHTGSSGFQMRLRYDAIAQNVSNQ
KLWIYEYRSRDGAEWVPQWCFMDFEVLPEDIRVFNLSPSKSPSSFFTFKWSVQFTSEKEDYSDG
SARDLNNVGGDVDGAFVIDGELFKYRKGGETKWERTFKSEDERLAALRKYYGVEVTKENERAIGG
TAGAISYRRTGS
42GmAT : (Uniprot B7SP66)
MGSSHHHHHHSQDPMARLEDPTALTQLPDESARVRYTSSELQDYFETLKFPQRFLDLGNSVLKDP
SLARTKENGLPLLQAITRYHTCNVPFENLVLHYDPHKIVTLDPAELYTKIVTRRRGGRCMENNIFLGT
ALRSLGYEVRNCGGRVSRAMSPYPEVRKNQSATYDGWNHMLLLVFLGDEWYGVDVGMGSMGP
NLPFPLQDGFESLSIAPREIRIQKRSISETHATGPSHATKMWCYDVCYNPAESKKTWTPVYCFTETE
FLPQDYEVMSWFTSTNPRSFFTRYITCTKMIMDEDKEVIIGNLTLFKDTVRETIGSDRKWKKFETEE
ERIKGLVEIFDVNLTEEEKNSLPQEKRLA
43GmAT : (Uniprot D8FSU8)
MGSSHHHHHHSQDPMSAIYSEAQVAGFLKHLQIPQEFYVGNEAILDHAFLKVLHQHMIATVPYDNL
TLHYSSHRNITLEPQALYQKIVGDGRGRGGYCMESNLFFCYMLRALGFQVYPVGVRVRLRNNGIPF
GGYPGWVHIVNIVTLPDNSRWVMDASFGGDGPTQPMPLVEGAEWHNMGTQTARLIKDFIPGQTEL
TSGRRLWIYQCRNSPDLPWTSFYAFSHSVEWLPADFEITNCYTGTSPRSFQTSTVLIVKFLLRESKT
SPTGEEIYGKRMLINDVVKENPGGKTKVLKELKTEDERVEALKEYFDIDLTTEEREAIKGFQTEIKSE
45SpAT : (Uniprot Q09927)
MGSSHHHHHHSQDPMKDPNTIPPWRCTDFNAWCIAVDKSTNVKNKEELLSTLTYFINYEIEMGQTY PIDIKMTRNEAEDFFFKFCTVICVPVESETSPAPDLATASIDWKTSLLGAFYIKPNYPGRCSHICNGG FLVSPSHRSKGIGRNLANAYLYFAPRIGFKSSVFNLVFATNIKSIRLWERLNFTRAGIIKDAGRLKGHE GYVDAYIYQYHFPSLEDALK
47 At AT: (Uniprot Q9ZV05)
MGSSHHHHHHSQDPMAPPTAAPEPNTVPETSPTGHRMFSRIRLATPTDVPFIHKLIHQMAVFERLT HLFVATESGLASTLFNSRPFQAVTVFLLEISPSPFPTTHDASSPDFTPFLETHKVDLPIEDPDREKFL PDKLNDWVAGFVLFFPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVAKQAVKLGVGRVEWI VIDWNVNAINFYEQMGAQVFKEWRLCRLTGDALQAIDKLNI
48CaAT : (Uniprot Q5D8C0)
MGSSHHHHHHSQDPMASAISETITTNGPSENNNLTITGKIHTRVRLATKSDLHHIYQLFYQIHAYHNF THLYKATESSLGDLLFKENPLPLFYGPSVLLLEVSPTPFTQPKNNKDEGFKPVLTTFNLKFPWEGQ VEEFQSKYDDGNDKRDVFIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGRLLFGTVASIA ANNGFVSVEGIVAVWNKKSYDFYIDMGVEIFDEFRYGKLHGENLQKYADKQKNEGGNC
49StAT : (Uniprot Q8H9D9)
MGSSHHHHHHSQDPMAPAPQQPTPSETIITDASSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIH VYHNFTHLYKATESSLEGLLFKENPLPLFYGPSVLLLEVSPTPFNEPKNTTDEGFNPVLTTFDLKFPV VEGQVEEFRSKYDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSI AADNGFVSVDGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADKGKIEEETC 51 EcAT : (Uniprot P761 12)
MGSSHHHHHHSQDPMSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYP VLVSEENGVVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVM VAGIESQNQASLHLHQSLGFWTAQMPQVGTKFGRWLDLTFMQLQLDERTEPDAIG
52PIAT : (Uniprot V4HKD0)
MGSSHHHHHHSQDPMSEKLDSYKLTQDHQSWTSKPATLEEWQIVNEWALAEKWDLGLGDTECFF
NIDDQGFYLGYVNGEPVASVSWNYSDEYAYAGFYLVAPGARGKGYGLRLSYDAFHHCDKRSVGL
DGMPEQEENYKKGGFVTHYETSRLVGVHNQQVDAPQGVQNISADNIEAVIEFDAQITGYSRAALLQ
NWFSGEGRHGFLIDSGDGVLGVVGIRRSTDGYRLGPLYAENQAVSEKLFAMAMAQVPLGTQVTID
APTLDLGFINTLKALGYEEIFHTFRMYRGTEPQGEKHKIQAIASLELG
53PhAT : (Uniprot A0A0F5VBE7)
MGSSHHHHHHSQDPMDIVKNKTETETSNSVWRVESANLAEWQAVIAWAKDEGWDMGIGDANAFF
EVDDQGFFIGYLGKEPVAAMSWNYSSRFSFLGHYLVSPAYRGQGYGLKLCQSAFYHGGERCMG
LDGMPAQVDNYAKWGFAGDRYNLRMVGQVQQDYHCPDHIALVQAADIDALIAYDQSCTGIDRSAL
LKHWFIGETRYGFICRSGQEVTGIIGVRQSQEGYRVGPLFANSPDLVEPLFIAALSAVPQGGKVTLD
VPEKADRTLISLAETHGFESIFQTLRMYRGEPPKEQEHKVWCIASLELG
54SIAT : (Uniprot Q8RXB6)
MGSSHHHHHHSQDPMASSLSETITTDASSENNNVTITGKIYTRLRLATKSDLSHIYQLFYQIHAYHN NTHLYKATESSLANLLFKENPLPLFYGPSVLLLEVSPTPFNEPTNEGFKPVLTTFDLKFPWEGQVEE FRSKYDDKSDVYIAGYAFFYVNYSCFSDKPGFYFESLYFRESYRKLGMGSLLFGTVASIAANNGFV SVEGIVAVWNKKSYDFYVNMGVEIFDEFRYGKLHGENLQKYANDKEKNDGGN
55SIAT : (Uniprot Q8RXB8)
MGSSHHHHHHSQDPMAPALEQAITSDASSDVTITGKIYTRVRLATKSDLSHIYRLFYQIHEYHNYTH LYKATESSLANLLFKENPLPLFYGPSVLLLEVSPTPFDEPKNTTDEGFKPVLTTFDLKFPVVEGEVEE FRSKYDDKSDVYIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGSLLFGTVASIAANNGFV SVEGIVAVWNKKSYDFYVNMGVEIFDEFRYGKLHGENLQKYAHN
56SIAT : (Uniprot Q8RXB7)
MGSSHHHHHHSQDPMAPTSQQPTPSPSLSDSLTTDASSDVTITGKIYTRVRLATKSDLSHIYKLFYQ IHEYHNFTHLYKATESSLEGLLFKENPLPLFYGPSVLLLEVSPTPFNEPTNQAFKPVLTTFDLKFPVV EGQVEEFRSKHDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSIA ANNGFVSVDGIIAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYAHNKGKTEEETC
58AxAT : (Uniprot E3HPZ9)
MGSSHHHHHHSQDPMAEQPSITVTPERALIDVAREIRVSGFPAYAFITITASMTMCGAPWRSQAVF
VAGHDGSLDLARDCPVSGSYAEPSAMGIVWSMACEDIASWFPPDRTEPLAIHIEASDGRHTATAT
LVQEFQADGVTHRAVREQVGGMTLSGELYTPAGPGPHPLVIYMNGSSGGVNAPRAALFASRGYQ
CLALAIFNYEGRPKYLNDMPLEYFQHVLRWARAELAPRDGFVALSGISRGGETSLLVASHYPELVS
AWAYVPSPVMHGVVSAGAPGTGRDAQVWTKAGEPLPHLWQDNASANWDAAYASQPPYRQTHA
FLSATRDSAAFERARIPVENYPGPVLLISASDDGFWPSTAYSEIVMRRRQEHGLPTFHHVCMGAGH
HVHYPCLPATLISKPHAMSGLLLDAGGTPSANAAGNEGSYLAVLEFLGRVGGVAW 61SrAT : (Uniprot L8EWB7)
MGSSHHHHHHSQDPMTSPGEIPRQPVPTEAAAPSGPAPGTATATLTAGPDAPAGFTVRPATLDE
WREVAAWAAAESWNPGRADVDCFHPTDPDGFFVGHLDGQLVSSVSVVNYSAAYAFLGYYLVHPD
FRGRGLGLATWRAAVAHAGDRTIGLDAVPAQEATYRRSGFTTAYRTTRYRGRPVRPGTPAVPVVP
VTADRLDEIADFDRQCFPAERRAFLERWLTAAGHHAYAQIRDGRVAGYGVLRPAQDGYRLGPLFA
DTSRGAEAVFDALTSHLGPEDEVHIDIPDPHHSARSLALSRGLEPDSHTMRMYTGPVPPARAEHGY
AVTSLELG
62SrAT : (Uniprot V6JJA0)
MGSSHHHHHHSQDPMTPAAPHDLVVTQATLADWPVIAGWAAAEGWNPGLSDGPAFFAQDADGF
FLGRIDGEPVSAISVVNYGSDYAFLGCYLVRPDLRGHGHGLTTWKTALAHAGDRTVGLDGWAQQ
DNYRQSGFELAYRTIRFTGAAPRAEVPVGVRPAGPADLAAITAYDSACYPADRPRFLAEWLTGPGH
RAFVRHDGARLTGYGVLRPGRDTLRIGPLFADTADDAHALFAALTTEAAGSEVAIDVPEPHAAGVAL
AEEAGFQASFETARMYTGPVRAYAQHRVFGVTTLELG
63ScAT : (Uniprot Q08649)
MGSSHHHHHHSQDPMSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFY
VHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDEDNKKQKKKKATNTSETPQDSLQDGVDGFSRE
NTDVMDLDNLNVQGIKDENISHEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPI
ELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLL
SKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLI
EFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKT
LNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPVFTASQLRFAW
64ScAT : (Uniprot Q03330)
MGSSHHHHHHSQDPMVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKENK
GKFEKETERIGGSEWTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKIEFRWNNDNTKENMMVL
TGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVR
GYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCS
MLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNIKPIDPMTIPGLKEAGWTPEMDA
LAQRPKRGPHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQK
MEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID
Example 2: General protocol for the production of CoA ligases and N-acyltransferases
2.1 General protocol for the expression of CoA ligases and N-acyltransferases
For all pET28 constructs, kanamycin (50 g/ml) was used in all LB agar plates and media
For pCDF-Duet constructs, streptomycin (50 g/ml) was used in all LB agar plates and media
Chemically competent BL21 (DE3) cells were transformed with plasmids carrying the constructs for CoA ligase or N-acyltransferase expression. Cells were plated onto LB agar and incubated at 37 °C overnight.
LB media (5-20 ml) was inoculated with a single colony and incubated at 37°C overnight (typically 18 hours) with shaking at 200 rpm. LB media (500 ml) containing 1 % glycerol and 0.05 % antifoam was inoculated with the overnight seed culture (5 ml). Cultures were grown in 2.5 L ultraflasks with AirOTop seals at 37 °C, 200 rpm. When the cell density reached an Ο βοο 0.6-1 .0 the culture was cooled to room temperature and the protein expression was induced with the addition of IPTG to a final concentration of 0.3 mM. The cultures were incubated for a further 18-24 hours at 18 °C. The cells were harvested by centrifugation (20 mins, 4000 rpm, 4°C) and either purified directly or stored at - 20 °C until required.
The general protocol was followed for proteins phi, PhCL, CBL, ipfF, ScCL, phl2, stIB, RpCL, LcCL, ArCL, MsCL, HolE, CASHT, HCBT1 -MBP, BcAT, HpA3 with the following exceptions: stIB and PhCL: For expression of the genes PhCL and stIB, Rosetta2(DE3) cells were used and chloramphenicol (34 μg ml) was added to the LB media in addition to kanamycin (50 g/ml).
CASHT: Cells expressing the CASHT gene were incubated at 28 °C following the addition of IPTG
HCBT1-MBP: Protein was cultured in Terrific Broth, inoculated with IPTG to a final concentration of 0.5 mM and incubated at 15 °C post induction.
There was a power failure during expression of RpCL, LcCL, ArCL and MsCL and it is presumed that the cultures warmed to room temperature at some point with no shaking.
2.2 General protocol for the batch purification of CoA ligases and N-acy transferases
Cell pellets were resuspended in 35 ml lysis buffer (50 mM Tris, 150 mM NaCI, 10 % glycerol, pH 7.4- 8.0). The cells were lysed by sonication using a 13 mm probe for a total of 5 minutes (9 sec on, 9.0 sec off) at 40 % amplitude. The lysates were cleared by centrifugation (39,191 g, 4°C, 45-60 minutes).
Ni-NTA resin was equilibrated with lysis buffer. Briefly, the resin was resuspended in 3-4 volumes of lysis buffer, the resin was pelleted by centrifugation (4000 rpm, 5 minutes, 4 °C) and the supernatant was decanted. This wash step was repeated three times and then the resin was resuspended in lysis buffer to give a 50 % slurry. The equilibrated resin (2-3 ml) was added to the cell free lysate and incubated on a blood roller at 4°C overnight. The matrix was packed into a 10 ml polypropylene column collecting the flow through.
The resin was washed with 7-8 ml wash buffer (50 mM Tris, 150 mM NaCI, 10 % glycerol, 20-25 mM imidazole, pH 7.4-8.0) and the wash was collected in two fractions. The protein was eluted in buffer (50 mM Tris, 150 mM NaCI, 10 % glycerol, pH 7.4-8.0) containing 50 mM imidazole (2 x 3-4 ml fractions), 100 mM imidazole (2 x 3-4 ml fractions), 200 mM imidazole (2 x 3-4 ml fractions) and then 400 mM imidazole (2 x 3-4 ml fractions).
Fractions were analysed by SDS-PAGE (gel images for certain enzymes are shown in figure 1 ). Fractions containing protein with the expected molecular weight were pooled and concentrated using a centrifugal concentrator (10-30 kDa cut off) to 2.5 ml final volume. Proteins were loaded onto a PD10 column (GE Healthcare) pre-equilibrated with 25 ml storage buffer (50 mM Tris containing 300 mM NaCI, 10 mM MgC , 10 % glycerol, pH 7.4). The flow through was discarded and the protein was eluted in 3.5 ml storage buffer. Protein concentration was determined using a Bradford assay according to the manufacturers protocol (Bio-Rad). The proteins were diluted in storage buffer to a working concentration of 0.5 mg/ml and stored at -80°C until required.
The general protocol was followed for phi, PhCL, CBL, ipfF, ScCL, phl2, stIB, RpCL, LcCL, ArCL, MsCL, HolE, CASHT, HCBT1 -MBP, BcAT, HpA3 proteins with the following exceptions:
For phi, PhCL, CBL, ipfF, ScCL, phl2, stIB, HolE, CASHT, MpR1 , BcAT, HpA3 and HCBT-1 -MBP the lysis buffer additionally contained a 1/200 dilution of protease inhibitor cocktail.
For RpCL, LcCL, ArCL, MsCL proteins, the equilibrated Ni-NTA resin (2-3 ml) was added to the cell free lysate and incubated on a blood roller at 4°C for 1.5 hours.
Example 3: Pyrophosphate detection assay for the evaluation of CoA ligase substrate specificity
The activity of nine CoA ligases (phi, PhCL, CBL, ipfF, stIB, RpCL, LcCL, ArCL and MsCL purified as described in Example 2) towards a panel of 16 carboxylic acid substrates (structures shown in Figure 2) were screened using the EnzChek pyrophosphate (PPi) assay kit (Invitrogen) according to the manufacturers protocol.
3.1 Materials and Method
Assay solution
430 μΙ water
50 μΙ 20 x reaction buffer (1 .0 M Tris-HCI, 20 mM MgCI2, pH 7.5, containing 2 mM sodium azide)
200 μΙ MESG (2-amino-6-mercapto-7-methylpurine ribonucleoside) solution (1 mM stock)
10 μΙ purine nucleoside phosphorylase solution (from 100 U/ml stock solution)
10 μΙ inorganic pyrophosphatase solution (made just prior to use by ten-fold dilution of the inorganic pyrophosphate stock solution (30 U/ml) in 1 x reaction buffer)
Substrate solution
1 .6 mM substrate (1 -16), 1.6 mM ATP, 1.6 mM Coenzyme A in 50 mM Tris pH 7.5
5 μΙ CoA ligase solution (0.5 mg/ml) and 25 μΙ assay solution were mixed in a 384 well plate (clear bottom). To initiate the reaction, 10 μΙ of substrate solution was added to each well and the change in absorbance was measured at 360 nm every minute over 40 minutes. Reactions were performed in triplicate.
The Vmax (milli OD units/min) was calculated using Softmax Pro software and was taken over 5 points. The Vmax values were blank corrected and the average is shown in the graph in figure 3.
3.2 Results and Conclusion
The CoA ligases assayed have complimentary substrate profiles and together catalyse the ligation of acid molecules across a broad range of chemical space. CoA ligases were identified which accept structurally diverse acids containing aromatic, heteroaromatic, allylic and aliphatic functionality. Example 4: The activity and substrate promiscuity of CoA ligases
The activity of CoA ligases phi, PhCL, CBL and ipfF towards a panel of nine acids (3, 5-9, 11 , 14 & 16) were evaluated using HPLC analysis. Nine reactions were prepared each with a different acid and CoA ligase pair according to table 1.
4.1 Materials and Method
Biotransformations were prepared as follows in 50 mL falcon tubes:
600 μΙ Tris pH 8.0 (0.5M)
300 μΙ ATP solution (50 mM solution prepared in water)
300 μΙ MgC solution (50 mM solution prepared in water)
750 μΙ Acid substrate solution (20 mM prepared in 50 mM Tris buffer pH 8.0)
300 μΙ CoA solution (50 mM prepared in water)
3.25 ml water
The solutions were pH adjusted to pH 8.0 prior to the addition of the CoA ligase solution (500 μΙ, 0.5 mg/ml). The reactions were incubated at 21 °C, 150 rpm for 48 hours in a Kuhner Climo Shaker.
TABLE 1 : Acid and CoA ligases pairs evaluated
Figure imgf000028_0001
4.2 HPLC analysis
For HPLC analysis, a 500 μΙ sample was removed from each reaction at 24 hour and 48 hour time points and 50 μΙ HCI (5M) was added to quench the reaction. The reaction was vortexed for 30 seconds and the precipitated protein was cleared by centrifugation (13000 rpm, 1 minute). The supernatant was injected onto the HPLC.
HPLC analysis was conducted on an Agilent 1290 infinity II, Zorbax SB-C18 column (50 mm x 3.0 mm, i.d. 1.8 μηη packing diameter). The solvents employed were A = water + 0.1 % formic acid and B = Acetonitrile + 0.1 % formic acid and a gradient method was used according to table 2. Flow rate: 1 .5 ml/min, Temperature: 60 °C, Injection volume: 2 μί, UV detection: 220 nm TABLE 2: Solvent gradient used for the detection of CoA ester products
Figure imgf000029_0001
4.3 Results and Conclusion
Table 3 shows the peak area for each of the starting materials (acid and CoA) and the product (CoA ester) as a percentage of the summed peak areas. ATP does not bind to the column and elutes in the solvent front. Figure 4 shows an example of a HPLC trace for the PhCL catalysed formation of cinnamoyl-CoA.
TABLE 3: Conversion of acid to CoA ester product catalysed by CoA ligases
Figure imgf000029_0002
The conversion of acids 3, 5, 8, 14 & 16 to the corresponding CoA-esters increased between 24 and 48 hours. After 24 hours incubation CoA-ester product generated from acids 6, 7, 9, and 11 was detected, however after 48 hours incubation the thioester hydrolysed to acid starting material. It is possible that in these reactions, the CoA ligase is no longer active after 24 hours and the product can hydrolyse chemically to the corresponding acid. Example 5: The effect of coenzyme A concentration on amide formation in vitro
To demonstrate that in vitro amide formation catalysed by CoA ligases and N-acyltransferases is catalytic in CoA, small scale reactions were performed using a range of CoA concentrations, which were analysed by LC-MS
5.1 Method
Reactions were prepared in 1.5 ml Eppendorf tubes according to table 4. Reactions were incubated overnight at 21 °C with shaking at 700 rpm in an Eppendorf thermomixer.
TABLE 4: Reaction components for in vitro amide formation catalysed by CoA ligase PhCL and N- acyltransferase CASHT
Figure imgf000030_0001
5.2 LC-MS analysis
For LC-MS analysis, a 500 μΙ sample was taken from each biotransformation and acetonitrile (500 μΙ) was added to solubilise the amide product and to precipitate any proteins. The samples were cleared by centrifugation (1 min at 13,000 rpm). A 400 μΙ sample of the supernatant was filtered using a filter vial (Fisher, part no. 1 1969414, Mini-UniPrep Syringeless Filter, 0.45 μηι, PVDF filtration) and injected directly onto the LC-MS.
The LC analysis was conducted on an Acquity UPLC CSH C18 column (50mm x 2.1 mm, i.d. 1.7μηι packing diameter). The solvents employed were A = 10 mM Ammonium Bicarbonate in water adjusted to pH 10 with Ammonia solution and B = Acetonitrile and a gradient method was used according to the table 5. Flow rate: 1 ml/min, Temperature: 40 °C, Injection volume: 0.3 μί. The UV detection was a summed signal from wavelength 210nm to 350nm. MS analysis was performed using a Waters ZQ, lonisation mode: Alternate-scan positive and negative electrospray, Scan Range: 100 to 1000 AMU, Scan Time: 0.27 seconds, Inter scan Delay: 0.10 seconds
TABLE 5: Solvent gradient used for the detection of amide products
Figure imgf000030_0002
5.3 Results and Conclusions
Table 6 gives the peak areas of each component as a percentage of the summed peak areas.
Significant amide formation was observed at each CoA concentration evaluated. When CoA was not supplemented into the reaction, amide formation was still detected. It is possible that CoA present in E. coli binds to the protein during expression and remains bound during purification, which is sufficient to catalyse the reaction in vitro. In any event, the results suggest that only a catalytic amount of CoA is required for amide formation, for example <0.01 eq or 1 mol%.
TABLE 6: Conversion to amide product using various concentrations of CoA substrate
Final CoA peak area (%)*
CoA
concentration
equivalents Amine Amide Other
(mM)
1 2.5 17.9 78.5 4.41
0.5 1 .25 23.27 71.24 5.5
0.25 0.6 19.9 74.94 5.15
0.1 0.25 14.55 82.03 3.43
0.01 0.025 1 1.75 85.62 2.62
0 0 13.09 83.43 3.48
*acid elutes at 0.41 min, amine elutes at 0.81 min, amide product elutes at 1 .1 1 min, ES+ 333.2, ES- 331 .2
Example 6: The effect of Coenzyme A concentration on the rate of CoA ester formation
To investigate the effect of coenzyme A concentration on the rate of CoA ester formation, reactions were analysed using the EnzChek pyrophosphate (PPi) assay kit (Invitrogen) as described in Example 3 but with the addition of an N-acyltransferase (HolE) and amine.
6.1 Materials and Method
Assay solution
430 μΙ water
50 μΙ 20 x reaction buffer (1 .0 M Tris-HCI, 20 mM MgCI2, pH 7.5, containing 2 mM sodium azide)
200 μΙ MESG (2-amino-6-mercapto-7-methylpurine ribonucleoside) solution (1 mM stock)
10 μΙ purine nucleoside phosphorylase solution (from 100 U/ml stock solution)
10 μΙ inorganic pyrophosphatase solution (made just prior to use by ten-fold dilution of the inorganic pyrophosphate stock solution (30 U/ml) in 1 x reaction buffer)
Substrate solution
1 .6 mM acid substrate (3, 7 or 9), 1 .6 mM amine 17, 1 .6 mM ATP and varying concentrations of Coenzyme A in 50 mM Tris pH 7.5
5 μΙ HolE (0.5 mg/ml), 5 μΙ CoA ligase phi, PhCL, CBL or ipfF (0.5 mg/ml), 25 μΙ assay solution and 10 μΙ substrate solution were added to a 384-well plate and the change in absorbance was measured at 360 nm every minute over 10 minutes. Wells containing no ATP and no acid served as negative controls and reactions were performed in duplicate. The Vmax (milli OD units/min) was calculated using the Softmax Pro software and was taken over 5 points, the average Vmax is reported in the graph in figure 5. 6.2 Results and Conclusions
In general, the rate of ATP turnover and therefore CoA ester formation increased at high concentrations of CoA. In agreement with the results in example 5, PhCL demonstrated activity when no CoA was supplemented into the reaction and a similar result was also achieved using ipfF. This suggests that CoA is bound to the enzyme in the protein preparation. In contrast, CBL and phi were not active in the absence of CoA addition, which may indicate the KM for CoA is higher for these proteins.
Example 7: Amine substrate profiling of N-acyltransferases using an Ellman's Spectrophotometric assay
The activity of a number of N-acyltransferase enzymes towards a panel of amine substrates (see figure 6) using commercially available CoA esters was investigated using an Ellman's assay. Ellman's reagent (5,5'-dithiobis-2-nitrobenzoic acid) reacts with free thiols to give a product which absorbs at 412nm and can be used to detect the formation of CoA produced in the amide formation reaction.
7.1 Materials and method
Assay solution was prepared as follows:
500 μΙ_ purified enzyme (0.5 mg/mL)
200 μΙ_ CoA ester solution (2.5 mM) prepared in 50 mM Tris buffer pH 8.0
200 uL Ellmans Reagent (2.5 mM) prepared in 50 mM Tris buffer pH 8.0
45 μΙ_ assay solution was added to 5 μΙ_ amine solution (18-31 see figure 6) (5mM prepared in 50 mM Tris buffer pH 8.0) in a 384-well plate. The change in absorbance was measured at 412nm every 20 seconds for 30 minutes. Reactions were performed in triplicate and wells containing no amine served as negative controls. The Vmax (milliOD units/min) was calculated over 10 points using the SoftMaxPro software. The Vmax was blank corrected and the average is reported in the graph in figure 7.
7.2 Conclusion
CASHT demonstrated high activity towards amines 23 and 30, HoLE was active towards substrates 25 and 26, whilst HCBT was specific for 21. Although these proteins don't appear to be highly promiscuous, they have complimentary activities and together give access to a structurally diverse set of amide products
Example 8: Optimisation of one-pot CoA Ligase and N-acyltransferase biotransformations
To establish optimal conditions for a one-pot biotransformation using purified CoA ligases and N- acyltransferases, two concentrations of coenzyme A (1 and 0.1 equivalents) were screened using varying enzyme concentrations.
8.1 Materials and Method
Reactions were prepared in 1 .5 ml Eppendorf tubes according to table 7. Reactions were incubated overnight at 21 °C with shaking at 700 rpm in an Eppendorf thermomixer. TABLE 7: Reaction components for in vitro amide formation catalysed by CoA ligase PhCL and N- acyltransferase CASHT
Figure imgf000033_0001
Samples were analysed according to the method in example 5.2
8.2 Results and Conclusions
Table 8 shows the conversion to amide product and the peak areas are reported as a percentage of the summed peak areas. In addition the results are represented graphically in figure 8. The results suggest that using 0.1 equivalents of CoA yields higher conversion to the amide product than using 1 CoA equivalent and that the optimal ratio of CASHT:PhCL is approx. 2:1.
TABLE 8: Conversion to amide product using 0.1 and 1 CoA equivalent and various protein concentrations
protein (μΜ) ratio peak area (%)
CASHT PhCL CASHT/PhCL Amine Amide Other
1 CoA equiva ent
1 .8 0.08 22.5 38.29 49.84 10.33
1 .8 0.16 1 1.25 28.98 62.59 8.42
1 .8 0.8 2.25 17.9 78.5 4.41
0.36 0.8 0.45 21.8 70.54 6.28
0.18 0.8 0.225 22.63 57.72 6.39
0 0 0 74.13 0 22.37
0.1 CoA equivalents
1 .8 0.08 22.5 35.27 54.81 9.92
1 .8 0.16 1 1.25 23.49 69.59 6.92
1 .8 0.8 2.25 14.55 82.03 3.43
0.36 0.8 0.45 27.02 66.41 6.56
0.18 0.8 0.225 14.31 81.48 4.21
0 0 0 76.15 0 23.85
Example 9: In vitro amide formation using a CoA ligase and N-Acyltransferase
Biotransformations were performed in vitro using CoA ligases (phi, PhCL, CBL and ipfF) in combination with N-acyltransferases (CASHT and HolE) as purified proteins. The enzyme activity was evaluated towards a small panel of acids and amines (figure 2 & 6). 9.1 Materials and Method
Reactions were prepared in 1.5 ml Eppendorf tubes according to table 9 and incubated overnight at 21 °C with shaking 700 rpm in an Eppendorf thermomixer. Reactions containing no N-acyltransferase served as a negative control.
TABLE 9: Reaction components for in vitro amide formation catalysed by a CoA ligase and N- acyltransferase.
Figure imgf000034_0001
Reactions were analysed according the method described in example 5.2
9.2 Results and Conclusion
A summary of the reactions evaluated is presented in table 10, the associated LC-MS traces for successful reactions which yielded amide product are shown in figure 9. There was a background chemical reaction between the CoA ester corresponding to acid 7 with amines 23, 30 and 32, which was observed in the negative control. There was no detectable increase over the background in the corresponding N-acyltransferase (HolE) reactions; therefore amines 23, 30 and 32 are not substrates for HolE. Nonetheless, sixteen of the reactions screened were successful and yielded structurally diverse amide products in good yields.
TABLE10: Summary of in vitro amide bond forming biotransformations evaluated.
Figure imgf000034_0002
16 14 PhCL 17 CASHT Yes
17 16 phi 17 CASHT No
18 7 ipfF 17 HolE Yes
19 7 ipfF 22 HolE No
20 7 ipfF 23 HolE No*
21 7 ipfF 24 HolE Yes
22 7 ipfF 26 HolE Yes
23 7 ipfF 27 HolE No
24 7 ipfF 28 HolE Yes
25 7 ipfF 30 HolE No*
26 7 ipfF 32 HolE No*
27 7 ipfF 33 HolE No
28 5 phi 25 HolE Yes
29 6 phi 25 HolE Yes
30 8 ipfF 25 HolE No
31 9 CBL 25 HolE No
32 14 PhCL 25 HolE No
33 16 phi 25 HolE Yes
*Amide formation was detected but was comparable to that detected in the negative control
Example 10: Co-expression of a CoA ligase and N-acyltransferase in E. coli
10.1 Preparation of co-transformed E. coli cells
Chemically competent BL21 (DE3) and Rosetta2(DE3) cells were transformed with pCDF-Duetl vectors carrying the gene for CASHT expression. Cells were plated onto LB agar containing streptomycin (50 g/ml) and incubated at 37 °C overnight. Colonies were picked and used to inoculate 5 ml LB containing streptomycin (50 g/ml). Cultures were grown overnight at 37 °C with shaking (200 rpm). The starter culture was used as a 1 % inoculum to inoculate 20 ml LB containing streptomycin (50 g/ml) in a 100 ml Erlenmeyer flask. The cultures were grown at 37°C, 200 rpm until they reached an OD600 of 0.5 (2-5 hours). Samples (2 ml) were taken from each culture and harvested by centrifugation (13,000 rpm, 4 °C, 2 min). The cells were resuspended in 1 ml filter sterilized 0.1 M CaC and the cells were then pelleted by centrifugation. The cells were resuspended in 200 μΙ of the 0.1 M CaC solution and again the cells were pelleted by centrifugation. The cells were resuspended in a final volume of 60 μΙ CaC and incubated on ice. The Rosetta2(DE3)-pCDF-CASHT strain was transformed with pET28-PhCL and the BL21 (DE3)-pCDF-CASHT strain was transformed with pET28- phl, pET28-CBL and pET28-ipfF. The transformations were plated onto LB agar containing kanamycin (50 g/ml) and streptomycin (50 g/ml) and incubated at 37°C overnight.
10.2 Co-expression of CoA ligase and N-acyltransferase genes
Colonies of the co-transformed cells were picked and used to inoculate 10 ml LB containing kanamycin (50 g/ml) and streptomycin (50 g/ml), the Rosetta2(DE3) cultures also contained chloramphenicol (34 μg ml). The starter cultures were grown overnight at 37°C with shaking 200 rpm. LB media (200 ml) containing the appropriate antibiotics and 1 % glycerol was inoculated with 4 ml of each starter culture (2 % inoculum). The cultures were grown at 37 °C until they reached an Οϋβοο of 0.6-0.8 (3 hours). Expression was induced with the addition of IPTG to a final concentration of 0.3 mM. The cultures were incubated at 18 °C, 200 rpm overnight (18 hours). Protein production was analysed by SDS-PAGE. A sample was taken from each culture and the cells were pelleted by centrifugation. The cells were resuspended in 1/10th OD of bugbuster containing 1 U/ml benzonase. Cell suspensions were incubated at room temperature for 15 minutes. A sample (30 μΙ) of the total cell lysate was removed and the remaining cells were pelleted by centrifugation (13,000 rpm, 10 minutes). A second sample (30 μΙ) was taken from the soluble supernatant. Samples (30 μΙ) were mixed with 4x SDS loading buffer (10 μΙ) and heated to 95 °C for 5 minutes. The samples were run on SDS-gels 4-20% according to the manufacturer's protocol. The presence of CoA ligase and N-acyltransferase proteins was confirmed by Western blot analysis (figure 10).
Western blot analysis:
Protein bands were transferred from the gels to PVDF membranes using the iBIot system (according to the manufacturer's protocol). The membranes were incubated at room temperature in blocking buffer (5% non-fat milk powder in PBS + 0.1 % tween) for 2 hours and then washed with PBS + 0.1 % tween. The membrane was incubated in blocking buffer plus anti-polyhistidine-HRP conjugate for 1 hour at room temperature and then washed thoroughly with PBS + 0.1 % tween. The anti-polyhistidine- HRP conjugate was imaged using Super Signal West extended duration substrate (Pierce) according to the manufacturer's protocol.
10.3 Results
The co-expression of CASHT with PhCL and phi yielded high levels of soluble protein. Under the same conditions, CBL and ipfF protein was largely in the insoluble fraction, however the soluble expression could be further improved by optimisation of the expression conditions.
Example 11 : In vivo amide bond formation using a CoA ligase and N-acyltransferase
Amide formation using whole cell catalysts expressing a CoA ligase and N-acyltransferase was investigated to determine the requirements for extracellular ATP and CoA. Four strains were evaluated each expressing the N-acyltransferase CASHT and one of the four CoA ligases phi, PhCL, CBL or ipfF.
11.1 Method for the preparation of whole cell catalysts
Whole cell catalysts co-expressing a CoA ligase and N-acyltransferase were prepared in 200 mL cultures according to example 10.2. Cells were harvested by centrifugation (400 rpm, 20 minutes, 4°C) and resuspended in PBS to a total volume of 35 ml. Samples (500 μί) from each culture were transferred to 1.5 mL eppendorf tubes and pelleted by centrifugation (13,000 rpm, 2 min, 4 °C). Samples were either used directly in biotransformations (termed 'resting cells'), frozen in dry ice and stored at -80 °C for 3 days (termed 'frozen cells') or frozen in dry ice then lyophilized under vacuum for 18 hours and stored at -80 °C for 3 days (termed 'lyophilized cells').
Cell pellets were resuspended in 50 mM Tris buffer pH 8.0 (1 ml) containing either 2.5 mM or 20 mM of acid and amine 17, with and without the addition of glucose (2 % v/v). Reactions were incubated at 21 °C overnight (16 hours) in an Eppendorf thermocycler with shaking at 700 rpm. Samples were analysed according to the method in example 5.2
11.2 Results and Conclusions
Reactions performed at 20 mM substrate concentration did not yield any amide product. However at 2.5 mM substrate concentration all four strains successfully produced the expected amide product (table 1 1 ). All strains yielded high conversions when used as 'resting cells' but were not as active after freezing and/or lyophilisation.
TABLE 1 1 : Amide formation using different cell preparations
Figure imgf000037_0001
[1 ] Peak area of acid and amine starting materials and amide product as a percentage of the summed peak areas
These results highlight that whole cells co-expressing carefully selected CoA ligases and N- acyltransferases can be used to access a selection of non-naturally occurring amides without supplementation with extracellular CoA or ATP.
Example 12: Optimisation of in vivo 6-chloro-N-neopentylnicotinamide (35) production
CoA ligase CBL and N-acyltransferase CASHT catalyse the formation 6-Chloro-N- neopentylnicotinamide (35) from 6-chloronicotinic acid (33) and neopentylamine (34) substrates (figure 12). This reaction has been optimised by recloning the genes into a single Duet vector. The effect of reaction media, substrate loading and catalyst loading on the yield of the amide product has also been evaluated.
12.1 Generation of a pCDF-Duet-CASHT-CBL construct
The CoA ligase construct pET28a-CBL and N-acyltransferase construct pCDF-Duetl -CASHT were generated at Genscript as described in Example 1. For co-expression of CBL and CASHT in E. coli, the CBL gene was recloned into the second expression cassette of the pCDF-Duetl -CASHT construct.
3-4 μg of each construct pET28a-CBL and pCDF-Duetl -CASHT was digested in a 100 μΙ reaction containing 10 μΙ outsmart buffer, 4 μΙ Ndel and 4 μΙ Xhol (restriction enzymes, NEB). Digests were incubated at 37 °C for 3 hours. The entire restriction digest was run on a 1 % w/v agarose gel and the DNA fragments corresponding to the CBL gene and digested pCDF-Duetl -CASHT vector were excised. The DNA was purified using a gel extraction kit (Qiagen) according to the manufacturer's protocol.
The CBL gene insert was ligated into pCDF-Duetl-CASHT in a 3:1 ratio using 50 ng of vector and T4 DNA ligase. The ligation reaction was used to transform E. coli NEB 5a chemically competent cells which were plated onto LB agar containing streptomycin (50 g/ml). The plates were incubated at 37 °C overnight.
Successful clones were identified by colony PCR and the sequence was verified by double strand sequencing using the following primers:
pCDF_seq 1 taaggagatataccatgg
pCDF_seq 2 ctttctgttcgacttaag
pCDF_seq 3 cttaagtcgaacagaaag
pCDF_seq 4 gtaaccagacctttg
pCDF_seq5 caaaggtctggttac
pCDF_seq6 cggtttctttaccag
12.2 Co-expression of CBL and CASHT in E. coli
The pCDF-Duet-CASHT-CBL construct generated in example 12.1 was used to transform
chemically competent E. coli BL21 (DE3). The cells were plated onto LB agar containing
streptomycin (50 g/ml) and incubated at 37 °C overnight. Colonies were used to inoculate 5 mL LB media containing streptomycin (50 g/ml) and the culture was incubated at 37 °C overnight with shaking 200 rpm.
The overnight culture (2 ml) was used to inoculate LB media (200 mL) containing streptomycin (50 μg ml). The culture was incubated at 37 °C with shaking (200 rpm) until an Ο βοο 0.6-0.8 was reached (2.5 hours). Expression was induced with the addition of IPTG to a final concentration of 0.3 mM. The culture was incubated at 28 °C, 200 rpm overnight (18 hours) to give a final Ο βοο of 3.9.
To analyse the level of protein production, cells were lysed and analysed by SDS-PAGE. A 1 ml sample was taken from the culture and the cells were pelleted by centrifugation. The cells were resuspended in 400 μΙ bugbuster containing 1 U/ml benzonase and 0.1 mg/ml lysozyme from chicken egg white. Cell suspension was incubated at room temperature for 20 minutes. A sample (20 μΙ) of the total cell lysate was removed and the remaining cells were pelleted by centrifugation (13,000 rpm, 10 minutes). A second sample (20 μΙ) was taken from the soluble supernatant (soluble fraction). Samples (20 μΙ) were mixed with SDS loading buffer (10 μΙ) and heated to 95 °C for 5 minutes. The samples were run on SDS-gels 12-20% according to the manufacturer's protocol. The stained gel is shown in figure 1 1 and show successful co-expression of both proteins.
12.3 Optimisation of in vivo 6-chloro-N-neopentylnicotinamide (35) production: Reaction media and substrate loading
Cultures of E. coli co-expressing CBL and CASHT were produced according to Example 12.2. A 200 mL culture was divided between 6 x 50 mL falcon tubes and the cells were pelleted by centrifugation (20 minutes, 4000 rpm). The cell pellets were resuspended in 5 mL reaction media (see table 13) containing either 2.5 mM or 10 mM 6-chloronicotinic 33 acid and neopentylamine 34. Biotransformations were incubated at 21 °C overnight (16 hours) with shaking at 200 rpm.
12.3.1 LC-MS analysis
For analysis, a sample (500 μΙ) was taken from each biotransformation and acetonitrile (500 μΙ) was added to solubilise the amide product and to precipitate any proteins. The samples were cleared by centrifugation (1 min at 13,000 rpm). The supernatant was filtered using a filter vial (Fisher, part no. 1 1969414, Mini-UniPrep Syringeless Filter, 0.45 μηη, PVDF filtration) and injected directly onto the LC-MS.
LC analysis was conducted on an Acquity UPLC CSH C18 column (50mm x 2.1 mm, i.d. 1.7μηι packing diameter). The solvents employed were A = 0.1 % v/v solution of Formic Acid in Water and B = 0.1 % v/v solution of Formic Acid in Acetonitrile and a gradient method was used according to table 12. Flow rate: 1 ml/min, Temperature: 40 °C, Injection volume: 0.5 μί. The UV detection was a summed signal from wavelength 210 nm to 350 nm. MS analysis was performed using a Waters ZQ, lonisation mode: Alternate-scan positive and negative electrospray, Scan Range: 100 to 1000 AMU, Scan Time: 0.27 seconds, Inter scan Delay: 0.10 seconds
TABLE 12: Solvent gradient used for the detection of amide products
Figure imgf000039_0001
12.3.2 Results and Conclusion
When reactions were performed in LB media the reactions went to completion at both 2.5 mM and 10 mM substrate concentrations (table 13). When the reactions were performed in Tris buffer the reactions did not go to completion. These results may suggest that in LB media the resting cells are able to regenerate ATP more effectively and therefore higher yields of the amide product can be achieved.
TABLE 13: The conversion to amide product under different reaction conditions
Figure imgf000039_0002
* Amide formation is reported as a peak area relative to the remaining acid (peak area (%) = amide peak area/(amide peak area+acid peak area)*100. 12.4 Optimisation of in vivo 6-chloro-N-neopentylnicotinamide (35) production: Catalyst loading and substrate concentration
Fresh cell paste was produced according to Example 12.2 with the following exceptions: A glycerol stock of BL21 (DE3) transformed with pCDF-Duet1-CASHT-CBL was used to inoculate a 5 mL LB starter culture, protein was expressed in a 500 mL culture containing 1 % glycerol, 0.05 % antifoam and streptomycin (50 g/ml) and cultures were incubated at 18 °C post induction.
Cells were harvested by centrifugation (20 mins, 4000 rpm, 4 °C) and resuspended in 50 mL LB. Stock solutions of 6-chloronicotinic 33 and amine neopentylamine 34 (1 M) were prepared in DMSO. Reactions were made up to 5 mL in LB media and contained varying amounts of cell culture and substrate as detailed in table 14. Biotransformations were incubated at 21 °C overnight (16 hours) with shaking at 200 rpm.
TABLE 14: The conversion to amide product under different reaction conditions
Figure imgf000040_0001
*amide peak area = area of amide/(area of amide + acid)
Reactions were analysed according to the method in example 12.3.1 .
12.4.1 Results and Conclusion
A high level of conversion to amide product was achieved at high cell density (Οϋβοο) and the conversion to product decreased with reduced catalyst loading and increasing substrate concentration. The reactions containing 50-100 mM substrate solution contained a significant amount of DMSO which can cause cell lysis and reduce the efficiency of ATP regeneration, this could explain the low conversions observed.
Example 13: Preparative scale synthesis of 6-chloro-N-neopentylnicotinamide (35) using whole cell biocatalysts expressing a CoA ligase and an N-acyltransferase
To demonstrate that this methodology can be used on a preparative scale, 6-chloro-N- neopentylnicotinamide (35) was produced and isolated on a 100 mg scale from a 60 ml reaction.
CoA ligase CBL and N-acyltransferase CASHT were co-expressed in a 500 mL culture as described in example 12.2. The cells were harvested by centrifugation (4000 rpm, 20 minutes), the supernatant was removed and the cell pellet was resuspended in 80 mL of fresh LB media which was used directly in the amide formation reaction.
6-chloronicotinic acid (93.6 mg, 0.6 mmol) and neopentylamine (70 μΙ, 0.6 mmol) were added to the resuspended cells (60 mL) in a 250 mL Erienmeyer flask and the reaction was incubated at 21 °C for 16 hours with shaking (200 rpm). To analyse the final conversion, a 200 μΙ sample was taken from the reaction and 200 μΙ acetonitrile was added. The sample was vortexed and the cell debris was cleared by centrifugation (1 min at 13,000 rpm). The sample was filtered using a Mini-UniPrep Syringeless Filter (0.45 μηη, PVDF, Fisher) and analysed by LC-MS according to the analytical method in example 12.3.1.
The conversion (83%) was calculated relative to the remaining acid. Next, the cells were pelleted by centrifugation (4000 rpm, 10 minutes) and the product was extracted from the supernatant using ethyl acetate (2 x 50 ml). The organic phases were combined, washed with saturated NaHCC>3, dried over MgSC and concentrated under reduced pressure to give the product as a white solid (99 mg, 74 % yield).
1H NMR (CDCIs): δ 8.7 (d, J=2.09 Hz, 1 H), 8.1 (dd, J=8.31 , 2.52 Hz, 1 H), 7.4 (d, J=8.31 Hz, 1 H), 6. (br. s, 1 H), 3.3 (d, J=6.40 Hz, 2H), 1 .0 (s, 9H)
Example 14: Substrate profiling of a panel of N-acyltransferases as cleared lysates in 96-well plates
Substrate profiling of a panel of phylogenetically diverse N-acyltransferases (described in example 1 .2) was performed in 96-well plates using a panel of structurally diverse amines (36a-i, figure 13) and CoA esters produced in situ from the corresponding acids (3, 5-7. 9, 14-16 & 37, figures 2 and 13) using an appropriate CoA ligase (identified using the methods in example 3 and purified according to example 2).
14.1 General protocol for the preparation of N-acyltransferase cleared lysates
All transfer and aliquotting steps were performed using a Beckman Biomek FX liquid handling robot.
Glycerol stocks of BL21 (DE3) carrying pCDF-Duet-N-acyltransferase constructs were used to inoculate 170 μΙ TB media containing 50 μg ml streptomycin in each well of a 96-well microtitre plate, the overnight cultures were sealed with a gas permeable seal and incubated overnight at 37 °C, 200 rpm, 85% humidity. 10 μΙ of the overnight culture was used to inoculate 390 μΙ TB media containing 50 μg ml streptomycin and 0.4 % glycerol in each well of a 2 ml 96-deep well plate. The plates were sealed and incubated at 30 °C, 250 rpm, 85% humidity until they reached an Ο βοο of 0.6-0.8 (2 hours). For induction, 40 μΙ IPTG (10 mM solution) was added to each well and the cultures were grown for an additional 20 hours at 20 °C, 250 rpm, 85% humidity. The cells were harvested by centrifugation (4000 rpm, 10 minutes, 4 °C) and the supernatant was poured off, cell pellets were stored at -80 °C until required.
For cell lysis, plates were thawed on the bench for 1 hour, 200 μί lysis buffer (50 mM phosphate buffer pH 7.5 containing 1 mg/ml lysozyme, 0.5 mg/ml polymixin B, 0.1 U/ml Benzonase) was added to each well and the cell pellets were resuspended with shaking (850 rpm) for 2 hours at room temperature. Cell debris was cleared by centrifugation (4000 rpm, 4 °C, 10 minutes). 100 μΙ of the cleared cell lysate was transferred to a fresh 96-well microtitre plate and the lysates were used directly in the assays.
14.2 Assays to evaluate N -acyltransferase substrate promiscuity
All reactions were composed of 50% lysate loading and a final concentration of 2.5 mM amine and 2.5 mM Acid or CoA ester, and were incubated at 25 °C, 800 rpm, for 18 hours. To quench, 100 μΙ acetonitrile was added to each well and the plate was incubated on a plate shaker for 1 hour at 850 rpm. Precipitated protein was removed by filtration using Acroprep Filter plates, (96-well, 350 μΙ, 0.2 μηη, GHP) and centrifuged at 4000 rpm for 5 minutes. The samples were collected in a 96-well microtitre plate and analysed by UPLC-MS according to the method described in example 5.2 but using a 2 μΙ injection volume with UV detection being a summed signal from wavelength 210nm to 400nm.
14.2.1 Preliminary assay: Activity towards a panel of amines 36a-d
Cleared cell lysates were screened for activity towards amines 36a-d using either 1 ) commercial CoA esters or 2) Cinnamoyl CoA produced in situ from cinnamic acid and CoA ligase, PhCL.
14.2.1.1 Materials and Method
Commercial CoA esters were purchased from Sigma: Acetyl coenzyme A sodium salt CAS# 102029- 73-2, Malonyl coenzyme A lithium salt CAS# 108347-84-8, Benzoyl coenzyme A lithium salt CAS# 102185-37-5, octanoyl Coenzyme A lithium salt CAS# 324518-20-9
Acid and amine solutions (20 mM) were prepared in 50 mM Tris buffer and pH adjusted to 8.0
Commercial CoA assay mix (volume/well)
5 μΙ CoA ester (50 mM in water)
32.5 μΙ_ buffer (50 mM Tris, pH 8.0)
Cinnamoyl CoA assay mix (Volume/well)
5 μΙ CoA (50 mM in water, adjusted to pH 5 with NaOH)
6 μΙ_ ATP (50 mM in water)
12.5 μΙ_ Cinnamic acid (20 mM solution in 50 mM Tris pH 8.0)
10 μΙ_ purified PhCL (0.5 mg/ml)
4 μΙ_ buffer (50 mM Tris, pH 8.0)
Amine solution (12.5 μΙ) and CoA ester assay mix (37.5 μΙ) were added to each well of a 96-well microtitre plate. Using the Biomek FX liquid handling robot, N-acyltransferase lysate (50 μΙ) was added and reactions were incubated at 25 °C, 800 rpm, for 18 hours. The final reaction mix contained either 2.5 mM CoA ester, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase lysate loading or 2.5 mM Acid, 2.5 mM CoA, 5 μg CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase lysate loading. Conversion was calculated as a percentage relative to the amine peak (Conversion = product peak area/(product peak area + amine peak area)*100)
14.2.1.2. Results
Out of the N-acyltransferases screened, 31 enzymes yielded amide product using one or more of the amines screened. Amines 36a and 36b were most widely accepted and were later used as amine partners to investigate the CoA ester promiscuity of the N-acyltransferase panel.
Table 15. Activity of the N-acyltransferase panel towards amines 36a-d Percentage Conversion (%)
Enzyme CoAester Amine Amine Amine Amine
36d 36c 36a 36b
OI StAT acetyl nd[11 0.0 51.1 nd[11 2MsAT acetyl nd[11 0.0 18.9 nd[11
05PsAT acetyl nd[11 19.4 92.5 nd[11
07NfAT acetyl nd[11 67.9 89.8 nd[11 1 GmAT acetyl nd[11 24.8 90.0 nd[11 2GmAT acetyl nd[11 23.8 57.0 nd[11 3GmAT acetyl nd[11 0.0 24.7 nd[11
Be AT acetyl nd[11 82.1 86.1 nd[11
63ScAT acetyl nd[11 0.0 0.0 nd[11
64ScAT acetyl nd[11 0.0 4.4 nd[11
39SeAT acetyl nd[11 0.0 0.0 nd[11 3DmAT acetyl nd[11 100.0 21.2 nd[11
35MaAT acetyl nd[11 0.0 3.3 nd[11
36PaAT acetyl nd[11 0.0 3.5 nd[11
38ShAT acetyl nd[11 0.0 3.5 nd[11
45SpAT acetyl nd[11 0.0 3.1 nd[11
47 At AT acetyl nd[11 0.0 0.0 nd[11
Hp A3 acetyl nd[11 0.0 0.0 nd[11
51 EcAT acetyl nd[11 0.0 0.0 nd[11
18BsAT acetyl nd[11 4.4 0.0 nd[11
19CpAT acetyl nd[11 0.0 3.3 nd[11
"I OHVAT cinnamoyl 0.0 0.0 0 4.5
1 1 At AT cinnamoyl 0.0 0.0 0.0 31.8
12HvAT cinnamoyl 0.0 0.0 0 4.0
14AtAT cinnamoyl 0.0 0.0 0.0 0.0
24LIAT cinnamoyl 0.0 0.0 0.0 0.0
31 NtAT cinnamoyl 18.2 1 1.9 0 26.9
32NtAT cinnamoyl 18.5 8.5 0 30.2
48CaAT cinnamoyl 49.1 24.7 8.0 31.6
49StAT cinnamoyl 49.5 21.6 8.8 33.7
54SIAT cinnamoyl 81.6 5.2 0 24.8
55SIAT cinnamoyl 48.4 25.7 6.4 30.5
56SIAT cinnamoyl 43.6 12.5 0 36.2
CASHT cinnamoyl 33.0 24.9 0 31.7
28BaAT malonyl 0.0P1 0.0 0.0 0.0
29EfAT malonyl O.ora 0.0 0.0 0.0
30SaAT malonyl O.Oi2' 0.0 0.0 0.0
33MtAT malonyl O.OPi 0.0 0.0 0.0
34PaAT malonyl O.OPi 0.0 0.0 0.0
HCBT benzoyl 0.0 0.0 0.0 0.0
37HsAT octanoyl 0.0 0.0 0.0 0.0
58AxAT octanoyl 0.0 0.0 0.0 0.0
52PIAT octanoyl 59.1 0.0 29.1 23.5
53PhAT octanoyl 48.9 0.0 49.0 21.3 61 SrAT octanoyl 6.3 0.0 0.0 61.1
62SrAT octanoyl 0.0 0.0 0 0.0
HolE octanoyl 52.1 0.0 14.0 13.6
[1 ] N-acetyl phenylalanine methyl ester and N-acetyl 4-(aminomethyl)benzonitrile product peaks and the corresponding amine substrate peaks were not resolved using this analytical method and the conversion was not determined.
[2] No product peaks were observed using malonyl CoA as an acyl donor, however in the absence of a product standard the product retention time was not known.
14.2.2 N-Acyltransferase CoA ester substrate promiscuity
N-acyltransferases which were active towards either substrate 36a and/or 36b in the preliminary assay were further evaluated for activity towards CoA esters which were produced in situ from acids 3, 5-7, 9, 14-16 & 37 (Figure 2 & 13), using catalytic CoA.
14.2.2.1 Method
CoA ester assay mix (Volume/well)
0.05 μΙ CoA (50 mM in water, adjusted to pH 5 with NaOH)
6 μΙ_ ATP (50 mM in water)
12.5 μΙ_ Acid solution (20 mM, in 50 mM Tris pH 8.0)
10 μΙ_ CoA Ligase (0.5 mg/ml)
6.45 μΙ_ buffer (50 mM Tris, pH 8.0)
CoA ester assay mix (37.5 μΙ) and amine solution (20 mM, 12.5 μΙ) were added to each well of a 96- well microtitre plate. Using the Biomek FX liquid handling robot, N-acyltransferase lysate (50 μΙ) was added and reactions were incubated at 25 °C, 800 rpm, for 18 hours. The final reaction mix contained 2.5 mM Acid, 2.5 mM CoA, 5 μg CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase lysate loading. The percentage conversion was calculated relative to standard curves of chemically synthesised amides and amine starting materials.
14.2.2.2 Results
A large number of N-acyltransferases showed promiscuous activity and accepted a number of structurally diverse thioesters, yielding amide products with high conversions. However not all enzymes were active towards alternative thioesters, for example 01 StAT, 02MsAT, 64ScAT, 35MaAT, 38ShAT, 45SpAT, and 19CpAT did not accept any of the acyl donors screened in this example and are specific for acetyl CoA (described in the preliminary assay).
Table 16. Activity of the N-acyltransferase panel towards CoA esters produced in situ from acids 3,
5-7, 9, 14-16 & 37 and CoA ligases PhCL, ipfF phi, CBL or RpCL
Percentage conversion (°/ Ό)
Enzyme Amine 3 5 6 7 9 14 15 16 37
+PhCL +ipfF +phl +ipfF +CBL +PhCL +ipfF +PhCL +RpCL
OI StAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
02MsAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
05PsATi1> 36a 0.0 25.4 23.7 100.0 0.0 0.0 61.4 0.0 0.0
07NfATi1> 36a 0.0 35.4 45.0 0.0 0.0 0.0 53.4 1 .7 0.0
41 GmATm 36a 27.1 42.8 51.0 73.1 0.0 0.0 45.9 7.4 32.2
42GmATm 36a 0.0 13.3 0.0 24.4 0.0 0.0 1 1.8 0.0 0.0
43GmATi1> 36a 8.2 27.9 26.9 48.7 0.0 0.0 16.4 1 .2 5.1
BcAT[1] 36a 0.0 33.3 0.0 88.2 0.0 0.0 45.0 0.0 0.0
63ScAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
64ScAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
39SeAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
23DmAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2.0
35MaAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
36PaAT 36a 0.0 0.0 7.4 0.0 0.0 0.0 0.0 0.0 0.0
38ShAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
45SpAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
19CpAT 36a 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
I OHVAT 36b 35.7 0.0 0.0 0.0 0.0 0.0 0.0 51.2 0.0
1 1 At AT 36b 92.3 1 1.1 89.7 93.7 88.9 9.3 59.7 77.8 0.0
12HvAT 36b 36.3 0.0 0.0 0.0 0.0 0.0 0.0 68.4 0.0
14AtAT 36b 83.0 14.4 88.4 87.2 51.3 0.0 67.9 66.0 4.2
32NtAT 36b 83.3 24.9 88.4 88.7 64.4 0.0 75.4 68.0 5.6
48CaAT 36b 100.0 23.4 100.0 100.0 97.7 7.5 71.7 86.2 36.4
49StAT 36b 100.0 22.3 100.0 95.0 97.9 9.1 68.4 86.1 29.6
54SIAT 36b 85.5 12.7 85.8 90.3 72.2 0.0 59.7 61.8 9.0
55SIAT 36b 100.0 25.7 100.0 100.0 91.9 6.1 72.5 82.7 41.2
56SIAT 36b 93.9 17.8 88.2 86.9 87.2 0.7 68.2 74.9 19.7
CASHT 36b 93.3 14.4 86.3 81.9 90.8 0.6 64.2 75.0 18.1
28BaAT 36b 0.0 0.0 0.0 0.0 0.0 0.0 55.8 0.0 0.0
53PhAT 36b 0.0 0.0 0.0 0.0 0.0 0.0 52.2 14.5 0.0
61 SrAT 36b 0.0 0.0 0.0 31.2 0.0 0.0 42.2 0.0 0.0
62SrAT 36b 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
HolE 36b 0.0 0.0 0.0 0.0 0.0 0.0 40.4 0.0 0.0
[1 ] Peaks corresponding to the acetylated product were detected by mass spectrometry (positive electrospray), presumably as a result of a competing reaction with endogenous acetyl CoA present in the cell lysate. 14.2.3 N-Acyltransferase amine substrate promiscuity
A panel of 21 N-acyltransferases were screened towards amines 36c-36i. A CoA ester substrate was selected for each N-acyltransferase (based on the results in example 14.2.2) which was produced in situ catalysed by a CoA ligase using catalytic CoA.
14.2.3.1 Method
CoA ester assay mix (Volume/well)
0.05 μΙ CoA (50 mM in water, adjusted to pH -5 with NaOH)
6 μΙ_ ATP (50 mM in water)
12.5 μΙ_ Acid solution (20 mM, made up in 50 mM Tris pH 8.0)
10 μΙ_ CoA Ligase (0.5 mg/ml)
6.45 μΙ_ buffer (50 mM Tris, pH 8.0)
CoA ester assay mix (37.5 μΙ) and amine solution (20 mM, 12.5 μΙ) were added to each well of a 96- well microtitre plate. Using the Biomek FX liquid handling robot, N-acyltransferase lysate (50 μΙ) was added and reactions were incubated at 25 °C, 800 rpm, for 18 hours. The final reaction mix contained 2.5 mM Acid, 2.5 mM CoA, 5 μg CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase lysate loading. The percentage conversion was calculated relative to standard curves of chemically synthesised amides and amine starting materials.
14.2.3.2 Results
A number of the N-acyltransferases, namely, 32NtAT, 48CaAT, 49StAT, 54SIAT, 55SIAT, 56SIAT, & CASHT were highly promiscuous and accepted a number of amine substrates. Other N- acyltransferases were more specific, for example 05PsAT, 07NfAT and 42GmAT had a preference for aniline analogues (36g table 17, 36a table 16) and tryptamine (36c). Together the panel of N- acyltransferases were able to operate across broad chemical space. The enzymes were screened towards both enantiomers of 36d and 36e, those which accepted theses amines were highly selective towards the (S)-enantiomer and no product formation was detected using the (R)-enantiomer. This demonstrates that this methodology can be used to perform kinetic resolutions.
Table 17. Activity of the N-acyltransferase panel towards amines 36c-
Conversion (%)
Enzyme Acid CL (S)- (S)-
36c 36f 36g 36h 36i
36d 36e
05PsAT 7 ipfF 0.0 0.0 0.0 0.0 0.0 60.7 0.0
07NfAT 7 ipfF 10.3 0.0 0.0 0.0 0.0 42.0 0.0
41 GmAT 7 ipfF 0.0 0.0 0.0 0.0 0.0 0.0 0.0
42GmAT 7 ipfF 4.5 0.0 0.0 0.0 0.0 0.0 0.0
43GmAT 7 ipfF 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Be AT 7 ipfF 0.0 0.0 0.0 0.0 0.0 0.0 0.0
23DmAT 37 RpCL 14.3 0.0 0.0 0.0 0.0 0.0 0.0
36PaAT 5 ipfF 0.0 0.0 0.0 0.0 0.0 0.0 0.0
I OHVAT 3 PhCL 12.9 0.0 0.0 0.0 0.0 0.0 0.0
1 1 At AT 3 PhCL 15.1 0.0 24.7 10.3 88.9 20.7 13.7
12HvAT 3 PhCL 23.3 0.0 0.0 0.0 0.0 0.0 0.0
14AtAT 3 PhCL 68.7 75.2 0.0 0.0 94.7 0.0 1 1.4
32NtAT 3 PhCL 75.0 77.4 0.0 1 .6 96.6 0.0 13.5
48CaAT 3 PhCL 92.8 94.5 49.6 8.8 98.6 0.0 22.2
49StAT 3 PhCL 89.6 95.7 64.9 9.4 98.3 0.0 20.5
54SIAT 3 PhCL 55.6 32.9 0.0 1 .4 94.9 0.0 10.7
55SIAT 3 PhCL 96.3 94.4 36.3 8.2 98.8 0.0 24.0
56SIAT 3 PhCL 78.1 92.8 0.0 3.7 96.0 0.0 17.9
CASHT 3 PhCL 95.7 84.3 0.0 2.2 95.5 0.0 9.0
53PhAT 16 PhCL 0.0 65.9 0.0 0.0 0.0 0.0 0.0
61 SrAT 7 ipfF 0.0 0.0 0.0 0.0 0.0 0.0 0.0
Example 15: Synthesis of tertiary amides using a CoA ligase and N-acyltransferase
The N-acyltransferase 1 1AtAT, which in nature catalyses amide formation between agmatine and cinnamoyi CoA, demonstrated activity towards secondary amine substrates. 1 1AtAT was screened for activity towards a small panel of amines (36k-36o shown in figure 14), using cinnamoyi CoA produced in situ, catalysed by a CoA ligase PhCL.
15.1 Method
Cleared cell lysates of 1 1AtAT and reactions were prepared according to the methods in example 14.1 and 14.2. CoA ester assay mix (37.5 μΙ containing cinnamic acid 3 as the acid substrate) and amine solution (20 mM, 12.5 μΙ) were added to each well of a 96-well microtitre plate. Using the Biomek FX liquid handling robot, N-acyltransferase lysate (50 μΙ) was added and reactions were incubated at 25 °C, 800 rpm, for 18 hours. The final reaction mix contained 2.5 mM Acid, 2.5 mM CoA, 5 μg CoA ligase, 3 mM ATP, 2.5 mM Amine in Tris pH 8.0 with 50% acyltransferase(1 1 AtAT) lysate loading. The percentage conversion was calculated relative to standard curves of chemically synthesised amides and amine starting materials. 15.2 Results
1 1 AtAT was active towards a number of secondary amines and yielded tertiary amide products with reasonable yields. The highest activity was achieved with N-methylbenzylamine 36k. Not all secondary amines were accepted and no product formation was detected with proline methyl ester 36o.
Table 18. Activity of N-acyltransferase 1 1 AtAT towards secondary amines 36j-o
Figure imgf000048_0001

Claims

1 . A method for synthesising a non-natural amide comprising:
a. reaction of a carboxylic acid with a naturally occurring CoA ligase or a variant thereof; and
b. reaction of the product of step a with an amine in the presence of a naturally
occurring acyltransferase or a variant thereof;
with the proviso that where the CoA ligase and acyltransferase are both naturally occurring, they are not derived from the same source species and do not act sequentially in a metabolic pathway; and
with the proviso that the non-natural product is not N-(E)-p-coumaroyl-3-hydroxyanthranilic acid or N-(E)-p-caffeoyl-3-hydroxyanthranilic acid.
2. A method according to claim 1 , wherein steps a and b take place in vitro, and wherein step a takes place in the presence of ATP and CoA.
3. A method according to claim 2, wherein the product of step a is not purified prior to step b.
4. A method according to claim 2 or claim 3, wherein the naturally occurring CoA ligase or a variant thereof is attached to a solid substrate.
5. A method according to any one of claims 2 to 4, wherein the naturally occurring
acyltransferase or a variant thereof is attached to a solid substrate
6. A method according to claim 1 , wherein steps a and b take place in vivo in a host cell
expressing the naturally occurring CoA ligase or variant thereof and the naturally occurring acyltransferase or variant thereof.
7. A method according to claim 6, wherein the host cell is a prokaryotic host cell.
8. A method according to any preceding claim, which further comprises a step of purification of the non-natural amide product.
9. A method for producing an active pharmaceutical ingredient, characterised in that the active pharmaceutical ingredient is produced from a non-natural amide intermediate that is synthesised as defined in any one of claims 1 to 8.
10. A host cell comprising either:
a. an expression vector comprising the coding sequence for a naturally occurring CoA ligase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and an expression vector comprising the coding sequence for a naturally occurring acyltransferase or a variant thereof operatively linked to regulatory control sequences capable of controlling expression of the naturally occurring acyltransferase or a variant thereof in the host cell; or b. an expression vector having at least two expression cassettes, a first expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring CoA ligase or a variant thereof in the host cell, and a second expression cassette comprising the coding sequence for naturally occurring acyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the naturally occurring acyltransferase or a variant thereof in the host cell; or
c. an expression vector having one expression cassette comprising the coding sequence for naturally occurring CoA ligase or a variant thereof fused in frame to a cleavable linker and then to the coding sequence for naturally occurring acyltransferase or a variant thereof operatively linked to conventional regulatory control sequences capable of controlling the expression of the fusion protein in the host cell;
with the proviso that where the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring acyltransferase, the CoA ligase is not a 4- coumarate CoA ligase where the acyl transferase is a serotonin N-hydroxycinnamoyl transferase; and with the proviso that where the expression vector of (b) comprises the coding sequence for a naturally occurring CoA ligase and a naturally occurring acyltransferase, the CoA ligase is not tobacco 4-coumarate CoA ligase 2 where the acyltransferase is the globe artichoke hct gene having accession number DQ104740 with the proviso that the expression vector of (c) does not comprise pepper serotonin N-hydroxycinnamoyltransferase fused in frame with the self-processing FDMV 2A sequence followed by 4-coumarate ligase 2 from Arabidopsis thaliana.
1 1. A host cell according to claim 10 which is a prokaryotic cell.
PCT/EP2017/069773 2016-08-08 2017-08-04 Method for synthesising amides Ceased WO2018029097A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662371960P 2016-08-08 2016-08-08
US62/371,960 2016-08-08

Publications (1)

Publication Number Publication Date
WO2018029097A1 true WO2018029097A1 (en) 2018-02-15

Family

ID=59656038

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/069773 Ceased WO2018029097A1 (en) 2016-08-08 2017-08-04 Method for synthesising amides

Country Status (1)

Country Link
WO (1) WO2018029097A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116622514A (en) * 2023-07-21 2023-08-22 南京师范大学 Regulation and control method for improving polyunsaturated fatty acid content in microbial thalli and/or microbial grease and application thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20090097388A (en) 2008-03-11 2009-09-16 전남대학교산학협력단 Recombinant vector containing 4CL gene and SHC gene, Bacteria transformed by it, and method for producing phenylpropanoid amide compound using same
US20130078683A1 (en) * 2010-10-15 2013-03-28 The Regents Of The University Of California Host Cells and Methods for Producing Cinnamoyl Anthranilate and Analogs Thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20090097388A (en) 2008-03-11 2009-09-16 전남대학교산학협력단 Recombinant vector containing 4CL gene and SHC gene, Bacteria transformed by it, and method for producing phenylpropanoid amide compound using same
US20130078683A1 (en) * 2010-10-15 2013-03-28 The Regents Of The University Of California Host Cells and Methods for Producing Cinnamoyl Anthranilate and Analogs Thereof

Non-Patent Citations (20)

* Cited by examiner, † Cited by third party
Title
ANDREA MOGLIA ET AL: "Evaluation of the bioactive properties of avenanthramide analogs produced in recombinant yeast : Bioactive Effects of Yeast Avenanthramides", BIOFACTORS., vol. 41, no. 1, 2 January 2015 (2015-01-02), GB, pages 15 - 27, XP055416543, ISSN: 0951-6433, DOI: 10.1002/biof.1197 *
AYMERICK EUDES ET AL: "Production of tranilast [N-(3',4'-dimethoxycinnamoyl)-anthranilic acid] and its analogs in yeast Saccharomyces cerevisiae", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, SPRINGER, BERLIN, DE, vol. 89, no. 4, 24 October 2010 (2010-10-24), pages 989 - 1000, XP019880520, ISSN: 1432-0614, DOI: 10.1007/S00253-010-2939-Y *
CHEN ET AL., ADV. DRUG. DELIV. REV., vol. 65, 2013, pages 1357 - 1369
CONSTABLE ET AL., GREEN CHEM., vol. 9, no. 5, 2007, pages 411 - 420
DATABASE WPI Week 200974, 2009 Derwent World Patents Index; AN 2009-P04643, XP002774909 *
DUNN ET AL., ANGEW. CHEM. INT. ED., vol. 54, 2015, pages 5137 - 5141
GOTOR, BIOORG MED CHEM, vol. 7, 1999, pages 2189 - 2197
J BACTERIOL, vol. 185, no. 1, 2003, pages 20 - 27
J BIOL CHEM, vol. 278, 2003, pages 2781 - 2786
KANEKO ET AL., J BACTERIOL., vol. 185, no. 1, 2003, pages 20 - 27
KANG ET AL., PLANT PHYSIOL, vol. 140, 2006, pages 704 - 715
KANG; BACK, METABOLIC ENGINEERING, vol. 11, 2009, pages 64 - 68
KIYOON KANG ET AL: "Production of plant-specific tyramine derivatives by dual expression of tyramine N-hydroxycinnamoyltransferase and 4-coumarate:coenzyme A ligase in Escherichia coli", BIOTECHNOLOGY LETTERS, SPRINGER NETHERLANDS, DORDRECHT, vol. 31, no. 9, 29 May 2009 (2009-05-29), pages 1469 - 1475, XP019727618, ISSN: 1573-6776, DOI: 10.1007/S10529-009-0032-3 *
LINDERMAYR ET AL., J BIOL CHEM, vol. 278, no. 5, 2003, pages 2781 - 2786
MCLACHLAN ET AL.: "Biocatalysis for the Pharmaceutical Industry: Discovery, Development and Manufacturing", 2009, JOHN WILEY AND SONS ASIA (PTE) LTD., article "Chapter 3"
MOGLIA ET AL., METABOLIC ENGINEERING, vol. 12, 2010, pages 223 - 232
PARK ET AL., APPL. MICROBIOL. BIOTECHNOL., vol. 81, 2008, pages 43 - 49
PATTABIRAMAN; BODE, NATURE, vol. 480, 2011, pages 471 - 479
STUIBLE ET AL., FEBS LETTS, vol. 467, 2000, pages 117 - 122
STUIBLE, J BIOL CHEM., vol. 276, no. 29, 2001, pages 26893 - 26897

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116622514A (en) * 2023-07-21 2023-08-22 南京师范大学 Regulation and control method for improving polyunsaturated fatty acid content in microbial thalli and/or microbial grease and application thereof

Similar Documents

Publication Publication Date Title
CN111936629B (en) Method for producing vanillin
US20250027130A1 (en) Nucleic Acid Synthesis and Sequencing Using Tethered Nucleoside Triphosphates
Veselá et al. Bringing nitrilase sequences from databases to life: the search for novel substrate specificities with a focus on dinitriles
Ligibel et al. Identification and application of threonine aldolase for synthesis of valuable α-amino, β-hydroxy-building blocks
JP5516664B2 (en) N-acetyl- (R, S) -β-amino acid acylase gene
CA2337843A1 (en) Process for preparing clavam derivatives by using polypeptides having beta-lactam synthetase activity
WO2018029097A1 (en) Method for synthesising amides
Wang et al. Bioconversion of recombinantly produced precursor peptide pqqA into pyrroloquinoline quinone (PQQ) using a cell-free in vitro system
US7399624B2 (en) Cephalosporin C acylases
EP1174499B1 (en) Novel amidase gene
Kawakami et al. First characterization of an archaeal amino acid racemase with broad substrate specificity from the hyperthermophile Pyrococcus horikoshii OT-3
US6686181B1 (en) Method for the production of L-amino acids from their racemic N-aceytyl-D, L-derivatives by enzymatic racemate cleavage by means of isolated recombinant enzymes
US8557558B2 (en) Compositions and methods of producing enterokinase in yeast
Li et al. Chaperonin co-expression and chemical modification enables production of active microbial transglutaminase from E. coli cytoplasm
JP5119783B2 (en) N-acetyl- (R, S) -β-amino acid acylase gene
Liu et al. Construction and co-expression of polycistronic plasmid encoding d-hydantoinase and d-carbamoylase for the production of d-amino acids
US20250002874A1 (en) Method for Cell-Free Production of Unspecific Peroxygenases
EP4151742B1 (en) Transgenic cell line and genetically engineered bacterium expressing fructosamine deglycase, and use of fructosamine deglycase
Wen et al. Expression, purification, and characterization of His-tagged penicillin G acylase from Kluyvera citrophila in Escherichia coli
He et al. Purification and Characterization of Membrane Protein ε-Poly-L-lysine Synthetase from Streptomyces Albulus
TW202509223A (en) Mutant transaminase with increased asymmetric reductive amination activity as well as methods and uses involving the same
Żądło‐Dobrowolska et al. Other Carbon–Nitrogen Bond‐Forming Biotransformations
WO2026019624A1 (en) Synthesis of cyclic oligopeptides
Liu et al. Using native hydantoinase promoter to induce D-carbamoylase soluble expression in Escherichia coli
TW202509221A (en) Method for producing 16-ketokoji mold imide, protein, nucleic acid and morphogen for producing 16-ketokoji mold imide

Legal Events

Date Code Title Description
DPE2 Request for preliminary examination filed before expiration of 19th month from priority date (pct application filed from 20040101)
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17754304

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17754304

Country of ref document: EP

Kind code of ref document: A1