WO2018017443A1 - Immunogenic compositions and methods relating thereto - Google Patents
Immunogenic compositions and methods relating thereto Download PDFInfo
- Publication number
- WO2018017443A1 WO2018017443A1 PCT/US2017/042308 US2017042308W WO2018017443A1 WO 2018017443 A1 WO2018017443 A1 WO 2018017443A1 US 2017042308 W US2017042308 W US 2017042308W WO 2018017443 A1 WO2018017443 A1 WO 2018017443A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- protein
- aspects
- seq
- nanodiscs
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/775—Apolipopeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y40/00—Manufacture or treatment of nanostructures
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/04—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length on carriers
- C07K1/045—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length on carriers using devices to improve synthesis, e.g. reactors, special vessels
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/04—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length on carriers
- C07K1/047—Simultaneous synthesis of different peptide species; Peptide libraries
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
- C12N9/80—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in linear amides (3.5.1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the technology described herein relates to nanodiscs, proteins used to assemble the nanodiscs, and methods of making nanodiscs.
- Small models of the cell membrane can be used to study the structure and behavior of cell membrane proteins, e.g., as part of the development of drugs and/or vaccines.
- Traditionally such models were produced by creating micelles or liposomes.
- Micelles are small spheres which require the use of significant levels of detergents for their creation. These detergents can destabilize and/or inhibit any associated cell membrane proteins, limiting the utility of the micelles.
- Liposomes do not require detergent use, but tend to aggregate and are irregular in size, making them unsuitable for analysis by crystallization and NMR.
- Nanodiscs do not contain detergents and are not prone to aggregation.
- a conventional nanodisc is composed of a nanometer-sized phospholipid bilayer encircled by two copies of a helical, amphipathic membrane scaffold proteins (MSPs) (Denisov et al. J Am Chem Soc. 2004; 126:3477-87 and Bayburt et al. Nano Lett. 2002;2:853-6).
- MSPs amphipathic membrane scaffold proteins
- the inventors have found that by circularizing the membrane scaffold protein, it is possible to obtain nanodiscs of up to 100 nm in diameter with extremely high consistency in the size of each individual nanodisc. Additionally, the nanodiscs made with such circularized membrane scaffold proteins can be designed to be either circular or polygonal in shape. The polygonal nanodiscs are of particular interest as they can increase the likelihood of crystallization.
- a loopable membrane scaffold protein comprising, from N-terminus to C-terminus: i) an N-terminal circularization domain; ii) a plurality of amphipathic alpha helix domains; and iii) a C-terminal circularization domain.
- one circularization domain comprises: a non- polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and the other circularization domain comprises: a sequence LPXTG/A; wherein X represents any amino acid.
- the N-terminal circularization domain comprises: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and the C-terminal circularization domain comprises: a sequence LPXTG/A; wherein X represents any amino acid.
- the non-polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 glycine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 alanine residues. In some embodiments of any of the aspects, the sequence LPXTG/A is covalently bound to the at least one glycine or alanine residue of (i). In some embodiments of any of the aspects, the sequence LPXTG/A is LPGTG/A (SEQ ID NO: 24); LPSTG/A (SEQ ID NO: 25); LPETG/A (SEQ ID NO: 26).
- one circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the other circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- the N-terminal circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the C-terminal circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- at least one intein is flanked by a chitin binding domain (CBD).
- each circularization domain comprises a Cys.
- the amphipathic alpha helix domain comprises: a) an ApoA-I polypeptide; or b) at least one alpha helical polypeptide with secondary amphipathicity or a repeat thereof; c) at least one amphipathic proline-rich polypeptide or a repeat thereof; or d) at least one repeat of the sequence XZXPPP; wherein X is any hydrophobic residue and Z is any hydrophilic residue.
- the alpha helical polypeptide has a sequence selected from the group consisting of: DWFKAFYDKLAEKFKEAF (SEQ ID NO: 27);
- KLALRLALKAFKAALKLA (SEQ ID NO: 29); RLALDLALRAFKAAWKLA (SEQ ID NO: 30); ELAWDLAFEALDAELKLD (SEQ ID NO: 31); FLKLLKKFLKLFKKLLKLF (SEQ ID NO: 32); WLKLLKKWLKLWKKLLKL (SEQ ID NO: 33); LLKFLKRLLKLLKDLWKLL (SEQ ID NO: 34); WEAAFAEALAEAWAEHLAEALAEAVEALAA (SEQ ID NO: 35);
- RAFARALARALKALARALKALAR SEQ ID NO: 37
- GLFEALLELLESLWELLLEA SEQ ID NO: 38
- KLLKLLLKLWKKLLKLLK SEQ ID NO: 39
- DWLKAFYDKVAEKLKEAF SEQ ID NO: 40
- DWFKAFYDKVAEKFKEAF SEQ ID NO: 41
- the protein further comprises a cap sequence N- terminal of the N-terminal circularization domain that can be cleaved to expose the N-terminal circularization domain as the N-terminus of the protein.
- the cap sequence comprises as sequence selected from the group consisting of: a) Leu-Val-Pro-Arg-Gly-Ser (SEQ ID NO: 42); and b) Glu-X-Leu-Tyr- ⁇ -Gln-(p where X is any residue, ⁇ is any large or medium hydrophobic residue and ⁇ is glycine or alanine (SEQ ID NO: 43).
- the cap sequence further comprises an affinity purification tag N-terminal of the cleavage site.
- the protein further comprises a His tag flanking one of the circularization domains.
- the His tag is located C-terminal of the C-terminal circularization domain.
- the protein further comprises a linker flanking one of the circularization domains.
- the linker is located C-terminal of the C-terminal circularization domain.
- the plurality of amphipathic alpha helix domains are separated by flexible linker sequences.
- the flexible linker sequence is selected from the group consisting of: LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
- the protein has the sequence of any of SEQ ID NOs: 1-4 and 6-23.
- a covalently circularized nanodisc comprising: a) a phospholipid bilayer; and b) a looped membrane scaffold protein forming a belt around the bilayer, wherein the looped membrane scaffold protein comprises: i) an N-terminal circularization domain covalently linked to a C-terminal circularization domain; and ii) a plurality of amphipathic alpha helix domains.
- an N-terminal circularization domain covalently linked to a C-terminal circularization domain comprises the sequence LPXT followed by a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; wherein X represents any amino acid.
- the non-polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine.
- the non-polar amino acid sequence consists of 1-5 glycine residues.
- the non-polar amino acid sequence consists of 1-5 alanine residues.
- the sequence LPXT is LPGT (SEQ ID NO: 48); LPST (SEQ ID NO: 49); or LPET (SEQ ID NO: 50).
- the N-terminal circularization domain covalently linked to a C-terminal circularization domain is a cysteine residue.
- the diameter is greater than about 6 nm. In some embodiments of any of the aspects, the diameter is greater than about 15 nm. In some embodiments of any of the aspects, the diameter is greater than about 50 nm. In some embodiments of any of the aspects, the diameter is about 80 nm.
- a method of making a nanodisc as described herein comprising: contacting the loopable membrane scaffold protein described herein with a sortase enzyme; and contacting the looped protein produced in step (a) with solubilized phospholipids.
- the sortase is selected from the group consisting of: Staphylococcus aureus wild type sortase A (Srt A); evolved sortase; eSrtA; eSrtA(2A-9); eSrtA(4S-9); and Streptococcus pyogenes sortase A.
- the contacting step is stopped by quenching the reaction with a sortase inhibitor.
- the sortase inhibitor is AAEK2 or high concentrations of EDTA.
- the sortase is bound to a substrate. In some embodiments of any of the aspects, the sortase further comprises a His tag.
- a method of making a nanodisc as described herein comprising: a) contacting the loopable membrane scaffold protein described herein with a solution having a pH low enough to induce cleavage of the dipeptide sequence of Asn-Cys; and a thiol reagent to induce cleavage at the Cys residue, resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids.
- the thiol reagent is DTT.
- a method of making a nanodisc as described herein comprising a) contacting the loopable membrane scaffold protein described herein with a thiol reagent, resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids.
- the phospholipids are solubilized in detergent.
- step (b) occurs at a temperature of from about 0 C to about 42 C. In some embodiments of any of the aspects, step (b) occurs at a temperature of from about 0 C to about 37 C.
- the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2000 to about 1 :5000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3500 to about 1 :4500; and circular nanodiscs are formed. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :4000; and circular nanodiscs are formed. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids, the ratio of loopable membrane scaffold protein to phospholipids to
- phospholipids is from about 1 :2500 to about 1 :3700; and non-circular nanodiscs are formed.
- the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3100 to about 1 :3400; and non-circular nanodiscs are formed.
- the protein further comprises a cap sequence N- terminal of the N-terminal circularization domain and the method comprises a first step of contacting the protein with an enzyme to cleave the cap sequence.
- the protein further comprises a C-terminal His tag and the method comprises a first step of binding the protein to a substrate.
- the substrate comprises Cu2+, Ni2+ or Co2+.
- the substrate is a chip or bead.
- the substrate is a bead and step (a) is performed in the presence of phospholipids.
- the substrate is a bead and the steps (a) and (b) are performed concurrently.
- the method further comprises, after step (a), a step of eluting the looped protein produced in step (a) from the substrate.
- the loopable membrane scaffold protein is in solution at a concentration of less than 100 uM prior to the contacting step.
- the looped protein formed in step (a) is passed through a column, substrate, and/or solution comprising Cu2+, Co2+ or Ni2+.
- described herein is a vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof.
- the single a-helix transmembrane protein is selected from the group consisting of phospholamban; influenza M2 channel protein; stannin; Vpu; HIV Vpu; parainfluenza 5 fusion protein; parainfluenza fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH.
- the transmembrane domain is the sequence of one of SEQ ID NOs: 95-101, 113, or 114.
- the variant of the transmembrane domain is a sequence with at least 90% homology to one of SEQ ID NO: 95-101, 113 or 114.
- an immunogenic conjugate polypeptide comprising: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein.
- the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide.
- the antigen polypeptide is conjugated to the C-terminus of the vaccine scaffold polypeptide.
- the antigen polypeptide is a viral envelope protein, a cell surface protein, or portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is an HIV protein or portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is the membrane proximal external region (MPER) of Env. In some embodiments of any of the aspects, the antigen polypeptide is the 10E8 epitope or the 4E10 epitope.
- MPER membrane proximal external region
- the immunogenic conjugate polypeptide comprises multiple repeats of the same antigen polypeptide. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple different antigen polypeptides. In some embodiments of any of the aspects, the antigen polypeptides or repeats thereof are separated by a linker.
- the immunogenic polypeptide comprises from 1 to 5 copies of the antigen polypeptide. In some embodiments of any of the aspects, the antigen polypeptide and the vaccine scaffold polypeptide are joined by a linker.
- the linker is hydrophobic. In some embodiments of any of the aspects, the linker is hydrophilic. In some embodiments of any of the aspects, the linker is from 1 to 5 amino acids in length.
- nucleic acid encoding a vaccine scaffold polypeptide or an immunogenic conjugate polypeptide as described herein.
- a polypeptide complex comprising a polymeric complex of a vaccine scaffold polypeptide and/or an immunogenic conjugate polypeptide as described herein.
- a composition comprising a polypeptide complex and/or immunogenic conjugate polypeptide as described herein embedded in the phospholipid bilayer of a liposome or nanodisc.
- the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid. In some embodiments of any of the aspects, the phospholipid bilayer comprises cholesterol. In some embodiments of any of the aspects, each liposome or nanodisc comprises 10 or fewer copies of the antigen polypeptide. In some embodiments of any of the aspects, each liposome or nanodisc comprises 5 or fewer copies of the antigen polypeptide.
- a pharmaceutical composition comprising a polypeptide complex and/or immunogenic conjugate polypeptide as described herein embedded in the phospholipid bilayer of a liposome or nanodisc and a pharmaceutically acceptable carrier.
- the pharmaceutical composition further comprises an adjuvant.
- a method of inducing an immune response in a subject comprising administering to the subject a composition comprising a polypeptide complex and/or immunogenic conjugate polypeptide as described herein embedded in the phospholipid bilayer of a liposome or nanodisc.
- the immune response comprises immunization.
- the subject is further administered an adjuvant.
- the compositions is admixed with the adjuvant prior to administration.
- the administration is a prime administration and/or a boost administration.
- the subject is further administered a second vaccine.
- the method further comprises a step of isolating from the subject:
- nucleic acid encoding an antibody that specifically binds to the antigen polypeptide
- cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide.
- Fig. 1 depicts a schematic representation of a nanodisc.
- Figs. 2A-2E depict schematics of the production of covalently circularized MSP and nanodiscs.
- Fig. 2A depicts a general outline of the constructs that are used for making covalently circularized nanodiscs. Constructs containing a sortase A recognition sequence (LPXTG (SEQ ID NO: 51)) and N-terminal glycine can undergo circularization (intramolecular transpeptidation) after exposing the N-terminal glycine and incubating with evolved sortase.
- Fig. 2A discloses "HHHHHH" as SEQ ID NO: 54.
- Fig. 2B depicts an outline of the procedure for creating circularized proteins over a Cu+2 chip.
- Fig. 2B discloses "GSTFSKL” as SEQ ID NO: 80, "KLNTQLPGTAAALEHHHHHH” as SEQ ID NO: 81, “KLNTQLPGTGSTFSKLR” as SEQ ID NO: 82 and "AALEHHHHHH” as SEQ ID NO: 83.
- Fig. 2C shows SDS-PAGE analysis of NW11 before (lane 1) and after (lane 2) circularization.
- Fig. 2C discloses "LPXTG” as SEQ ID NO: 51 and "HHHHHH” as SEQ ID NO: 54.
- FIG. 2D depicts MS/MS spectrum of a tryptic peptide of cNWl 1 confirming the ligation of the N-terminal residues (GSTFSK (SEQ ID NO: 52)) to the C-terminal LPGTG motif (SEQ ID NO: 53).
- the b and y ions that were identified in the MS/MS spectrum are highlighted in blue and red.
- Fig. 2D discloses "KLNTQLPGTGSTFSK” as SEQ ID NO: 84.
- Fig. 2E depicts the diameter distribution for nanodiscs made using linear MSP (top) and circularized MSP (bottom) and their representative negative stain images.
- Fig. 2E discloses "NTQLPGTAA” as SEQ ID NO: 85 and "NTQLPGTGST” as SEQ ID NO: 86.
- Figs 3A-3C demonstrate the production of large covalently circularized nanodiscs.
- Fig. 3 A demonstrate SDS-PAGE analysis of NW30 before and after circularization. The circularized NW30 migrates slower than the linear form.
- Right: negative-stain EM analysis of the nanodiscs made using circularized NW30 (cNW30) shows the formation of -15 nm nanodiscs.
- Fig. 3B demonstrate SDS- PAGE analysis of NW50 before and after circularization.
- Right: negative -stain EM analysis of the nanodiscs made using circularized NW50 (cNW50) shows the formation of -50 nm nanodiscs.
- Fig. 3C depicts negative stain images showing single nanodisc particles with increasing sizes as indicated.
- Fig. 4A depicts cryo-EM images of individual nanodiscs with different shapes.
- Fig. 4B depicts potential molecular arrangements of scaffold protein molecules in the different shaped nanodiscs.
- Fig. 4C depicts possible crystal packing of nanodiscs with the corresponding shapes.
- the triangular, square and hexagonal shapes should, in principle, provide better crystal packing than pentagonal or circular ones.
- Fig. 4D shows that each triangular disc is made of 3 copies of amphipathic protein that are connected together with a long flexible loop.
- Fig. 5 depicts a schematic of the strategy for making polygonal nanodiscs and and the associated scaffold proteins.
- Fig. 5 discloses "LPXTG” as SEQ ID NO: 51 and "HHHHHH” as SEQ ID NO: 54.
- Figs. 6A-6J depict poliovirus caught in the act.
- Fig. 6A depicts negative -stain EM of 50-nm circularized nanodiscs plus poliovirus.
- a control (nanodiscs without CD155) is shown to illustrate the relative dimensions of the 30-nm poliovirus and the 50-nm nanodisc.
- Fig. 6B depicts an outline of the procedure used to initiate poliovirus bridging and fusion with nanodiscs decorated with CD 155.
- Fig. 6C depicts negative-stain EM images showing individual viruses tethered to nanodiscs.
- Fig. 6D depicts cryo- EM image of 50-nm nanodiscs plus poliovirus.
- FIG. 6E depicts cryo-EM image showing a tilted view of 50-nm nanodisc.
- Fig. 6F depicts cryo-EM images showing individual viruses tethered to nanodiscs.
- Fig. 6G-6H depict cryo-EM images showing the creation of a putative pore in the nanodisc by the poliovirus.
- Fig. 61 depicts cryo-EM image showing three viral particles around a 15-nm nanodisc.
- Fig. 6 J depicts cryo-EM image showing individual viruses ejecting RNA after incubation with CD155-decorated 15-nm nanodiscs.
- Figs 7A-7D demonstrate the analysis of VDAC-1 in different size nanodiscs.
- Fig. 7A depicts 2D-[ 1 H, 15 N]-TROSY spectrum of 2 H, 15 N-labeled VDAC-1 in cNW9 nanodiscs.
- Fig. 7B depicts representative image of negatively stained cNW9 nanodiscs containing single VDAC-1 channel. The stain-filled channels appear as dark spot inside the nanodisc.
- Fig. 7C depicts 2D-[3 ⁇ 4 15 N]-TROSY spectrum of 2 H, 15 N-labeled VDAC- 1 in cNWl 1 nanodiscs.
- Fig. 7D depicts representative image of negatively stained cNWl 1 nanodiscs containing VDAC-1 channels. Each nanodisc appear to contain 2 channels.
- Fig. 8 depicts a schematic outline of the procedure for creating circularized NW proteins over Cu+2 chip. His6- tagged NWs (“His6” disclosed as SEQ ID NO: 54) is attached to Cu+2 chip. Addition of His6-tagged evolved sortase (“His6” disclosed as SEQ ID NO: 54) creates circularized non- His tagged NW (cNW), which can be eluted while cleaved His6- tagged products (“His6” disclosed as SEQ ID NO: 54) and evolved sortase remain bound to the Cu+2 chip.
- His6-tagged NWs (“His6” disclosed as SEQ ID NO: 54) is attached to Cu+2 chip. Addition of His6-tagged evolved sortase (“His6” disclosed as SEQ ID NO: 54) creates circularized non- His tagged NW (cNW), which can be eluted while cleaved His6- tagged products (“His6” disclosed as SEQ ID NO: 54) and evolved sortase remain
- Fig. 8 discloses "GSTFSKL” as SEQ ID NO: 80, "KLNTQLPGTAAALEHHHHHH” as SEQ ID NO: 81, "AALEHHHHHH” as SEQ ID NO: 83 and "LEEYTKKLNTQLPGTGSTFSKLREQL” as SEQ ID NO: 87.
- Fig. 9A depicts a schematic of circularization of NW proteins over Ni2+ beads. His6- tagged linear NW (“His6” disclosed as SEQ ID NO: 54) is attached to Ni-beads followed by adding lipids to NW. Addition of lipids to NW helps to bring the C and N terminal ends close so the circularization pathway will dominate. Adding His6-tagged sortase (“His6” disclosed as SEQ ID NO: 54) creates circularized non- tagged NW (cNW), which can be eluted while cleaved His6- tagegd cleavage product (“His6" disclosed as SEQ ID NO: 54) and sortase remain bound to the beads.
- Fig. 9A discloses
- FIG. 10 depicts a schematic outline of the procedure for creating circularized NW in solution. His6- tagged linear NW (“His6" disclosed as SEQ ID NO: 54) is diluted before adding sortase to favor the circularization. Adding the sortase covalent inhibitor AAEK2 quenches the reaction.
- Fig. 11 depicts a schematic of adding evolved sortase to concentrated NW11 solution in order to multimerize NW11, followed by circularization.
- the oligomeric, circularized species containing variable numbers of NW11 assemble into nanodiscs of various sizes.
- Fig. 11 discloses
- Figs. 12A-12E demonstrate that covalent circularization stabilizes MSPs against thermal unfolding without and with lipids, stabilizes embedded VDAC1 and allows control of the number of channels embedded.
- CD circular dichroism
- POPC/POPG lipids at a molar ratio of 3:2 were used to generate nanodiscs.
- Fig. 12C demonstrates that placement in MSP ID 1 nanodiscs increases the melting temperature of VDAC1 by 9.2 degrees over that of VDAC1 in an LDAO micelle environment, and covalent
- Nanodiscs were made with POPC/POPG lipids at a molar ratio of 3:2. All samples were in 20 mM Tris-HCl, pH 7.5, 100 mM NaCl.
- Fig. 12E depicts analysis of the VDAC1 nanodisc assembly reaction. Top: size-exclusion chromatography and negative-stain EM of VDAC1 in cNW9 nanodiscs. Negative-stain image shows nanodiscs containing a single channel. The stain-filled channels appear as dark spots inside nanodiscs. Bottom: SDS-PAGE analysis of the nanodisc assembly. Fractions 1-6 were collected and analyzed.
- Figs. 13A-13D demonstrate that covalent circularization stabilizes MSPs against digestion by V8 protease without and with lipids.
- Figs. 13A-13B depict SDS-PAGE analysis of the proteolysis of lipid-free MSPAH5 and cNW9. Samples were treated with V8 protease for 0 min (before addition of V8), and for 1, 3 and 18 hours. Lanes are labeled with times of protease treatment. Proteolysis was performed in 20 mM Tris-HCl, pH 7.5, 100 mM NaCl at 37°C and using a proteimprotease ratio (w/w) of 1000: 1.
- MSPAH5 Treatment of MSPAH5 with V8 resulted in the appearance of a large peptide, which is close in size to MSPAH5 and is not discernible until about 18 hours after addition of V8; this peptide may be generated earlier but is not visible due to the low amount or overlap with uncleaved MSPAH5.
- the intensity of the MSPAH5 band decreased by 75% after 3 hours and by 93% after 18 hours.
- the intensity of the cNW9 band decreased by only 20% after 18 hours.
- a band that corresponds to linearized NW9 was observed after 3 hours and increased in intensity after 18 hours.
- Fig. 14 depicts characterization of cNW9 by MS/MS confirms the ligation of the C terminus to the N terminus.
- MS/MS spectrum of a tryptic fragment of cNW9 (SEQ ID NO: 91) showing the ligation of the C-terminal motif (LNTQLPGTG-His6 (SEQ ID NO: 55)) to the N-terminal residues (GSTFSK (SEQ ID NO: 52)).
- Expected masses for b and y ions along with the peptide sequence are listed in the table (SEQ ID NO: 91). The b and y ions that were identified in the MS/MS spectrum are highlighted.
- the full amino acid sequence of linear NW9 is shown at the top (SEQ ID NO: 90).
- Fig. 15 depicts characterization of cNW30 by MS/MS confirms the ligation of the C terminus to the N terminus.
- MS/MS spectrum of a tryptic fragment of cNW30 (SEQ ID NO: 91) showing the ligation of the C-terminal motif (LNTQLPGTG-His6 (SEQ ID NO: 55)) to the Nterminal residues (GSTFSK (SEQ ID NO: 52)).
- Expected masses for b and y ions along with the peptide sequence are listed in the table (SEQ ID NO: 91).
- the b and y ions that were identified in the MS/MS spectrum are highlighted in.
- the full amino acid sequence of linear NW30 is shown at the top (SEQ ID NO: 92).
- Fig. 16 depicts characterization of cNW50 by MS/MS.
- Spectrum of a tryptic fragment of cNW50 (SEQ ID NO: 91) showing the ligation of the C-terminal motif (LNTQLPGTG-His6 (SEQ ID NO: 55)) to the N-terminal residues (GSTFSK (SEQ ID NO: 52)).
- Expected masses for b and y ions along with the peptide sequence are listed in the table (SEQ ID NO: 91). The b and y ions that were positively identified in the MS/MS spectrum are highlighted.
- the amino acid sequence of linear NW50 (after TEV cleavage) is shown at the top (SEQ ID NO: 93).
- Fig. 17 depict a diagram illustrating the production of circularized proteins or poly peptides using the two-intein system.
- the intein has a chitin binding domain (CBD) which allows it to bind to chitin beads.
- CBD chitin binding domain
- the protein splicing of the inteins is then induced by adding DTT and changing the pH.
- the target protein then released from the chitin bound intein.
- the exposed N and C termini of the released protein interact together and result in the circularization of the protein.
- Fig. 18 depicts chemically mediated ligation of scaffold proteins.
- Fig. 19 depicts SDS-PAGE analysis of NW9 3C before (lane 1) and after covalent circularization (lane 2).
- Figs 20A-20B depict phospholamban.
- Fig. 20A depicts the structure of phospholamban (PDB # 1ZLL).
- Fig. 20B depicts the primary amino acid sequence of phospholamban from different species.
- Figs. 21A-21B depict models of PLN nanodisc structures.
- Fig. 21A depicts a cartoon of MPEPv-Phospholamban (PLN)-TM hybrid in bilayer.
- Fig. 2 IB depicts MPER-Phospholamban hybrids displaying different number of MPER copies per complex.
- Figs. 22A-22B depict an EM study of MPER-Phospholamban (PLN)-TM hybrid in complex with 10E8 Fab.
- Fig. 22A demonstrates that negative stain EM reveals multiple arms of 10E8 per complex.
- Fig. 22B depicts a cartoon for MPER-Phospholamban (PLN)-TM hybrid in complex with 10E8 Fab.
- Figs. 23A-23C demonstrate MPER-Phospholamban (PLN)-TM intereactions with antibodies.
- Fig. 23A depicts 2d class averages of MPER-Phospholamban (PLN)-TM hybrid in complex with 10E8 Fab.
- Fig. 23B depicts low resolution 3D reconstruction of the complex based on the negative-stain data.
- Fig. 23C depicts a cartoon of the interaction.
- Fig. 24 depicts a schematic illustration of an example of strategy to produce immunogens incorporated in a nanodisc.
- Figs. 25A-25B depict a schematic illustration of an example of strategy to produce trimer immunogen in nanodisc according to one embodiment of the present invention.
- gp l40 could be covalently linked to MPER-PLB after (Fig. 25A) or before (Fig. 25B) incorporation into nanodisc.
- Figs. 26A-26C depict a schematic illustration of an example of strategy to produce DNA immunogen comprises a DNA Duplex scaffold covalently linked to N terminus of MPER-phospholamban transmembrane fusion protein or 10E8 -phospholamban transmembrane fusion protein.
- DNA scaffold can be covalently linked to MPER-PLB after (Fig. 26A) or before (Fig. 26B) incorporation into nanodisc. (Fig. 26C) some duplex DNA designs that can be used for modifying 2, 3 or 5 MPER-PLB arms.
- Fig. 27 demonstrates that a strong MPER-specific antibody response is generated to nanodisc delivered MPER-immunogen.
- Immulon IB plates were pre- coated with streptavidin followed by washing, blocking and binding of biotinylated MPER-peptide.
- Serially diluted sera collected 19 days following a third and final immunization were tested against naive mouse sera.
- Immunized mice received membrane presented MPER-phospholamban fusion protein displayed on nanodiscs (lOOug of MPER-phospholamban:nanodisc per mouse).
- mice were immunized three times at 3 -week intervals via subcutaneous tail-base injection in conjunction with 5ug/mouse CDN adjuvant-loaded liposomes.
- Non-circularized (open circles) and circularized (filled circles) MSP nanodiscs result in identical IgG antibody titers.
- No MPER-specific IgG antibodies are detected in any naive (filled circle; dashed line) mice. Symbols represent mean with SEM shown.
- N 4 female BALB/c mice; 8 weeks old at time of primary immunization.
- Fig. 28 demonstrates the immunogenicity of MPER-phospholamban
- MPER- and human MSP-specific antibodies titer were measured by ELISA (left panel). 96 well plates were coated with MPER-phospholamban transmembrane in nanodisc
- MPER-binding antibody-forming cells were determined by ELISPOT using liposomes containing MPER-TM, MPER-N (E662-T676) or MPER-C (A667-K683) as the capture antigen.
- nanodiscs which permit previously unachievable sizes, uniformity, and geometry.
- This new approach to nanodisc construction involves the use of circularized membrane scaffold proteins, as opposed to the linear membrane scaffold proteins previously described.
- loopable membrane scaffold proteins are provided herein.
- nanodiscs comprising such proteins, and methods of producing these nanodiscs. Further described herein are methods and compositions relating to the presentation of antigens on nanodics and/or liposome.
- a vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof.
- the vaccine scaffold polypeptide consists of the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof.
- the vaccine scaffold polypeptide consists essentially of the transmembrane domain of a single a-helix transmembrane protein or a variant thereof.
- a polypeptide described herein is engineered.
- single a-helix transmembrane protein refers to a naturally-ocurring protein which comprises one a-helix transmembrane domain.
- a single a-helix transmembrane protein can exist in situ as a monomer or a multimer.
- Single a-helix transmembrane proteins are well known in the art and can be readily identified, e.g., by structure and/or annotation searches of protein and sequence databases.
- Non-limiting examples of suitable single a-helix transmembrane protein can include phospholamban; influenza M2 channel; stannin; Vpu; HIV Vpu; parainfluenza fusion protein; parainfluenza 5 fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH.
- phospholamban refers to a single a-helix transmembrane protein that forms a homopentameric integral membrane protein complex to regulate the Ca2+ pump. Sequences for phospholamban are known for a number of species, including, e.g., human (NCBI Gene ID: 5350) (mRNA, NCBI Seq Ref: NM_002667.4) (polypeptide, NCBI Ref Seq: NP_002658.1).
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of phospholamban.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of phospholamban.
- the transmembrane domain of phospholamban can be the portion of the sequence of a phospholamban corresponding to SEQ ID NO: 1 13 or 1 14.
- the transmembrane domain of phospholamban can be the sequence of SEQ ID NO: 1 13 or 1 14.
- influenza "M2 channel protein” or “matrix-2 (M2) protein” refers to a single a-helix transmembrane protein that forms a homotetramer ion channel in the viral envelop of influenza A. Tetramers comprising the transmembrane domain of M2 channel protein display a structure which widens right before the cytoplasmic side of the plasma membrane, permitting antigenic polypeptides to be spread more widely on the membrane surface.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of M2 channel protein.
- the transmembrane domain of M2 channel protein can be the portion of the sequence of a M2 channel protein corresponding to SEQ ID NO: 95 or 96. In some embodiments of any of the aspects, the transmembrane domain of M2 channel protein can be the sequence of SEQ ID NO: 95 or 96.
- stannin refers to a single a-helix transmembrane protein that forms monomers which cross the plasma membrane at approximately a 20° angle.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of stannin.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N- terminus of the transmembrane domain of stannin. Sequences for stannin are known, e.g., human stannin (NCBI Gene ID: 51061) (polypeptide, NCBI Ref Seq: NP 001290376.1, NP 001310951.1,
- the transmembrane domain of stannin can be the portion of the sequence of a stannin corresponding to SEQ ID NO: 97. In some embodiments of any of the aspects, the transmembrane domain of stannin can be the sequence of SEQ ID NO: 97.
- Vpu or "viral protein U” refers to a single a-helix transmembrane protein that forms pentameric ion channels which are wider at the C-terminus than the N-terminus.
- a Vpu can be an HIV Vpu.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of Vpu, e.g., HIV Vpu.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of Vpu, e.g, HIV Vpu.
- Sequences for Vpu are known, e.g., HIV Vpu (NCBI Gene ID: 155945) (polypeptide, NCBI Ref Seq: NP 057855.1).
- the transmembrane domain of Vpu can be the portion of the sequence of a Vpu corresponding to SEQ ID NO: 98.
- the transmembrane domain of Vpu can be the sequence of SEQ ID NO: 98.
- a "parainfluenza fusion protein” refers to a single a-helix transmembrane protein that forms trimeric complexes.
- the parainfluenza fusion protein can be a parainfluenza 5 fusion protein.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of a fusion protein, e.g., parainfluenza 5 fusion protein.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of a fusion protein, e.g., parainfluenza 5 fusion protein.
- a fusion protein e.g., parainfluenza 5 fusion protein.
- Sequences for fusion proteins are known, e.g., parainfluenza 5 fusion protein (NCBI Gene ID: 3160801) (polypeptide, NCBI Ref Seq: YP 138515.1).
- the transmembrane domain of a parainfluenza fusion protein can be the portion of the sequence of a parainfluenza fusion protein corresponding to SEQ ID NO: 99.
- the transmembrane domain of a parainfluenza fusion protein can be the sequence of SEQ ID NO: 99.
- a "SH” or “Small Hydrophobic” protein refers to a single a-helix
- the SH protein can be a Respiratory syncytial virus (RSV) SH protein.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of a SH protein, e.g., RSV SH.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of a SH protein, e.g., RSV SH.
- the transmembrane domain of a SH protein can be the portion of the sequence of a SH protein corresponding to SEQ ID NO: 100. In some embodiments of any of the aspects, the transmembrane domain of a SH protein can be the sequence of SEQ ID NO: 100.
- a "E" or "Envelope small membrane” protein refers to a single a-helix transmembrane protein that forms pentameric complexes.
- the E protein can be a SARS-Cov E protein.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of an E protein, e.g., SARS-Cov E.
- an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N- terminus of the transmembrane domain of an E protein, e.g., SARS-Cov E.
- E protein e.g., SARS-Cov E.
- Sequences for E proteins are known, e.g., SARS-Cov E (NCBI Gene ID: 1489671) (polypeptide, NCBI Ref Seq: NP_828854.1).
- the transmembrane domain of an E protein can be the portion of the sequence of an E protein corresponding to SEQ ID NO: 101.
- the transmembrane domain of an E protein can be the sequence of SEQ ID NO: 101.
- the vaccine scaffold polypeptide is less than 60 amino acids in length. In some embodiments of any of the aspects, the vaccine scaffold polypeptide is less than 50 amino acids in length. In some embodiments of any of the aspects, the vaccine scaffold polypeptide is less than 40 amino acids in length.
- transmembrane domain refers to a a portion, part, or polypeptide sequence of a protein which forms an a-helix with a least one hydrophobic face.
- the transmembrane domain can target and/or anchor a translated polypeptide comprising the transmembrane domain to the plasma membrane of a host cell.
- the transmembrane domains of a given polypeptide sequence can be predicted and/or identified with any of various computer programs designed to analyze polypeptide sequences, or by consulting the annotation found in various publically -available databases, e.g., NCBI or PDB.
- the transmembrane domain of phospholamban is the sequence of SEQ ID NO: 113 or 114.
- a variant of the transmembrane domain of phospholamban is a sequence with at least 90% homology to SEQ ID NO: 113 or 114.
- a variant of a given transmembrane domain can include sequences in which cysteine residues are substituted with another residue, e.g, serine. Such substitutions can improve the ease with which the vaccine scaffold polypeptide can be manipulated.
- an immunogenic conjugate polypeptide comprising: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein.
- an immunogenic conjugate polypeptide comprising: a) at least one antigen polypeptide conjugated to; b) a transmembrane domain of a single a-helix transmembrane protein.
- an immunogenic conjugate polypeptide consisting essentially of: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein.
- an immunogenic conjugate polypeptide consisting essentially of: a) at least one antigen polypeptide conjugated to; b) a transmembrane domain of a single a- helix transmembrane protein.
- an immunogenic conjugate polypeptide consisting of: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein.
- an immunogenic conjugate polypeptide consisting of: a) at least one antigen polypeptide conjugated to; b) a transmembrane domain of a single a-helix transmembrane protein.
- an "antigen” is a molecule that is specifically bound by a B cell receptor (BCR), T cell receptor (TCR), and/or antibody, thereby activating an immune response.
- An antigen can be pathogen-derived, or originate from a pathogen.
- An antigen can be a polypeptide, protein, nucleic acid or other molecule or portion thereof.
- the term "antigenic determinant” refers to an epitope on the antigen recognized by an antigen-binding molecule, and more particularly, by the antigen-binding site of said molecule.
- An antigen polypeptide can be any antigenic polypeptide sequence.
- the immunogenic conjugate polypeptide is less than 60 amino acids in length. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide is less than 50 amino acids in length. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide is less than 40 amino acids in length.
- the antigen polypeptide is a viral protein or a bacterial protein or antigenic portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is a protein or antigenic portion thereof, obtained from a pathogenic organism. In some embodiments of any of the aspects, the antigen polypeptide is a protein or antigenic portion thereof, specific to a pathogenic organism, e.g., as compared to related nonpathogenic and/or commensal organisms.
- the antigen polypeptide is a viral envelope protein, a cell surface protein, or antigenic portion thereof.
- the antigen polypeptide is encoded by a viral env gene, e.g., the HIV env gene (NCBI Gene ID: 155971). Env genes and corresponding polypeptides for various virii are known in the art, e.g., in the NCBI database.
- the antigen polypeptide is an HIV protein, or antigenic portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is the membrane proximal external region (MPER) of Env, e.g., HIV Env. Exemplary MPER sequences for several HIV isolates are provided in Table 2.
- MPER membrane proximal external region
- the antigen polypeptide is the 10E8 epitope (SLWNWFNITNWLWYIK; SEQ ID NO: 112) or the 4E10 epitope (NWFNITNWLW; SEQ ID NO: 94) of HIV Env.
- the antigen polypeptide can be the ectodomain of HIV gpl60 (e.g., NCBI Gene ID: 155971), influenza HA (e.g., NCBI Gene ID: 956529, 3654620, 3655151, 23308115, 23308115, 1460996, 23104227, or 3655103), hepatitis C El, or hepatitis C E2 protein (see, e.g, NCBI Gene ID: 951475) or an antigenic portion thereof.
- HIV gpl60 e.g., NCBI Gene ID: 155971
- influenza HA e.g., NCBI Gene ID: 956529, 3654620, 3655151, 23308115, 23308115, 1460996, 23104227, or 3655103
- hepatitis C El e.g., NCBI Gene ID: 951475
- conjugated refers to the attachment of at least two entities to form one entity.
- the joining of the two entities can be direct (e.g., via covalent or non-covalent bonds) or indirect (e.g., via linkers etc.). Conjugation can be by means of linkers, chemical modification, peptide linkers, chemical linkers, covalent or non-covalent bonds, or protein fusion or by any means known to one skilled in the art. The joining can be permanent or reversible.
- the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide.
- the antigen polypeptide is conjugated to the C-terminus of the vaccine scaffold polypeptide.
- An immunogenic conjugate polypeptide can comprise more than one occurrena of an antigen polypeptide, e.g, multiple repeats of the same antigen polypeptide and/or multiple different antigen polypeptides. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple repeats of the same antigen polypeptide. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple different antigen polypeptides.
- linker refers to any means, entity or moiety used to join two or more entities.
- Linker moieties include, but are not limited to, chemical linker moieties, or for example a peptide linker moiety.
- the linker is hydrophobic. In some embodiments of any of the aspects, the linker is hydrophilic.
- the linker is from 1 to 5 amino acids in length, e.g., is 1, 2, 3, 4, or 5 amino acids in length.
- the immunogenic conjugate polypeptide comprises from 1 to 5 antigen polypeptides, e.g., 1 to 5 repeats of the same antigen polypeptide and/or 1 to 5 different antigen polypeptides.
- nucleic acid encoding the vaccine scaffold polypeptide as described herein or the immunogenic conjugate polypeptide as described herein is a nucleic acid encoding the vaccine scaffold polypeptide as described herein or the immunogenic conjugate polypeptide as described herein.
- a vector comprising a nucleic acid encoding the vaccine scaffold polypeptide as described herein or the immunogenic conjugate polypeptide as described herein.
- the vaccine scaffold polypeptides and/or immunogenic conjugate polypeptides described herein can exist as multimers, e.g., as polypeptide complexes.
- the potential for multimerization can be controlled by the vaccine scaffold polypeptide selection, e.g., phospholamban-derived vaccine scaffold polypeptides will provide vaccine scaffold polypeptides and/or immunogenic conjugate polypeptides which form pentamers.
- the antigen polypeptide(s) of each immunogenic conjugate polypeptide can be the same or differ.
- the individual vaccine scaffold polypeptides and/or immunogenic conjugate polypeptides of a polypeptide complex are not covalently bound to each other.
- a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc.
- the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid.
- the phospholipid bilayer comprises cholesterol. Suitable lipids discussed in further detail below herein.
- each liposome or nanodisc comprises 10 or fewer copies of the antigen polypeptide. In some embodiments of any of the aspects, each liposome or nanodisc comprises 5 or fewer copies of the antigen polypeptide.
- a pharmaceutical composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc and a pharmaceutically acceptable carrier.
- the pharmaceutical composition can further comprise an adjuvant.
- adjuvant refers to any substance than when used in combination with a specific antigen that produces a more robust immune response than the antigen alone.
- an adjuvant acts generally to accelerate, prolong, or enhance the quality of specific immune responses to the vaccine antigen(s).
- adjuvants include alum, paraffin oil, killed bacteria, squallene, detergents, plant saponins, cytokines, Freund's complete adjuvant, Freund's incomplete adjuvant, adjuvant 65, aluminum hydroxide, aluminum phosphate, and/or calcium phosphate hydroxide.
- nanodisc refers to a discoidal, nanoscale phospholipid bilayer which is “belted” or “ringed” by a membrane scaffold protein.
- the membrane scaffold protein comprises amphipathic alpha helices which provide an hydrophobic surface next to the hydrocarbon tails of the phospholipid bilayer and an external hydrophilic surface.
- covalently circularized nanodisc refers to a nanodisc in which the membrane scaffold protein has been covalently boneded to itself to form continuous polypeptide loop (i.e. it has been circularized).
- a loopable membrane scaffold protein comprising, from N-terminus to C-terminus: i) an N-terminal circularization domain; ii) at least one amphipathic alpha helix domain; and iii) a C-terminal circularization domain.
- a loopable membrane scaffold protein comprising, from N-terminus to C-terminus: i) an N-terminal circularization domain; ii) a plurality of amphipathic alpha helix domains; and iii) a C-terminal circularization domain.
- loopable membrane scaffold protein refers to a protein which is capable of being circularized by a covalent bond in such as way that the interior circumference of the protein provides a hydrophobic environment and the exterior circumference forms a hydrophilic environment. Once circularized, the protein is referred to herein as a “looped membrane scaffold protein.” This circularized protein can accommodate a phospholipid bilayer within the interior circumference.
- circularized or “looped” when used in reference to a polypeptide refers to the fact that the peptide sequence is not linear in nature, e.g., it does not have an N-terminus or C- terminus.
- a polypeptide which is circularized or looped can form any shape, e.g., a circle, an oval, or a polygon.
- a polypeptide or nanodisc referred to herein which is "circular in shape” has a shape or cross-section which forms the shape of a circle.
- a circularization domain refers to a section of a linear polypeptide which upon interaction with a corresponding second circularization domain in the same polypeptide, can cause circularization of the polypeptide.
- the circularization domain can comprise one or more amino acid residues.
- a number of circularization technologies are known in the art and any such technology can be applied to the proteins described herein. Exemplary circularization domains are described below.
- Proteins can be circularized by the action of a sortase enzyme. Sortase recognizes a
- LPXTG/A e.g., LPXTG (SEQ ID NO: 51) or LPXTA (SEQ ID NO: 56) sequence, cleaving the sequence after the threonine.
- the threonine residue can then form a new peptide bond with a glycine or alanine residue found at a second, more N-terminal location in the polypeptide, causing it to be circularized.
- sortase enzymes to circularize polypeptide is described in more detail in, e.g., Cowper et al. ChemBioChem 2013 14: 809-812; Antes et al., Journal of Biological Chemistry 2009 284: 16028-36; and Tsukiji et al.
- one circularization domain comprises: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and the other circularization domain comprises: a sequence LPXTG/A;
- the N-terminal circularization domain comprises: a non-polar amino acid sequence comprising at least one N- terminal glycine or alanine residue; and the C-terminal circularization domain comprises: a sequence LPXTG/A; wherein X represents any amino acid.
- non-polar amino acid sequence refers to a sequence comprising non-polar amino acids, the sequence being at least one amino acid in length. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 20 amino acids in length. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to about 10 amino acids in length. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 10 amino acids in length. In some embodiments of any of the aspects, the non-polar amino acid sequence comprises glycine and alanine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of glycine and alanine residues.
- the non- polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 10 amino acids in length and consists of amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 residues selected from glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 glycine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 alanine residues.
- sequence LPXTG/A can be covalently bound to the at least one glycine or alanine residue of (i).
- the LPXTG/A is LPGTG/A (SEQ ID NO: 24); LPSTG/A (SEQ ID NO: 25); or LPETG/A (SEQ ID NO: 26).
- the LPXTG/A is LPGTG (SEQ ID NO: 53); LPGTA (SEQ ID NO: 57); LPSTG (SEQ ID NO: 58);
- LPSTA SEQ ID NO: 59
- LPETG SEQ ID NO: 60
- LPETA SEQ ID NO: 61
- Proteins can also be circularized by use of two intein domains (e.g., using the pTWIN vectors commercially available from New England Biolabs; Ipswich, MA (e.g., Cat. No. N695 I S)). Inteins can excise themselves from a polypeptide, causing splicing of the remaining sequence (e.g., exteins). When inteins are used to flank a central sequence, the central sequence can be circularized when the inteins excise themselves. Various inteins and their use are described in more detail in, e.g.. Elleuche et al. Applied Microbiology and Biotechnology. 2010 87:479-489; Cowper et al. ChemBioChem 2013 14:809- 812; Ahlmann-Eltze et al. 2015 hdl.handle.net/1721.1/96071 ; Evans et al. Journal of Biological
- one circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the other circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- the N-terminal circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the C-terminal circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- At least one intein is flanked by a chitin binding domain (CBD).
- CBD chitin binding domain
- Proteins can also be circularized by utilizing 2 cysteine residues, one at each end of the sequence to be circularized.
- the C-terminal cysteine is capable of initiating an intramolecular N ⁇ S acyl shift. This results in an S-acyl intermediate that can be intercepted by an added thiol, yielding a C- terminal thioester and liberating cysteine.
- the cysteine at the N terminus interacts with the C-terminal thioester and leads to spontaneous backbone circularization, through intramolecular
- each circularization domain comprises a Cys.
- one of the Cys residues is preceded by a Gly residue.
- one of the Cys residues is the C-terminal residue of the linear polypeptide.
- amphipathic alpha helix domain refers to a domain comprising a continuous amphipathic alpha helix, e.g., an alpha helix with a face which is hydrophobic/non-polar and a second face which is hydrophilic/polar.
- a loopable membrane scaffold protein can comprise a plurality of amphipathic alpha helix domains, e.g., multiple domains separated by non-helical sequences.
- an amphipathic alpha helix can comprise an ApoA-I polypeptide or repeats thereof; at least one alpha helical polypeptide with secondary amphipathicity or a repeat thereof; at least one amphipathic proline-rich polypeptide or a repeat thereof; or at least one repeat of the sequence XZXPPP; wherein X is any hydrophobic residue (e.g., any of A, I, L, F, V, P,W, M, Y and G) and Z is any hydrophilic residue (e.g., any of R, K, D, E, Q, N, H, S,T, or C).
- X is any hydrophobic residue (e.g., any of A, I, L, F, V, P,W, M, Y and G)
- Z is any hydrophilic residue (e.g., any of R, K, D, E, Q, N, H, S,T, or C).
- amphipathic alpha helix domain and/or loopable membrane scaffold protein can comprise a combination of any of the specific sequences and domains described herein.
- ApoA-I (e.g., NCBI Gene ID: 335), also referred to as ApoAl, refers to the major protein component of high density lipoprotein (HDL) in plasma, which also serves a cofactor for lecithin cholesterolacyltransferase (LCAT).
- LCAT lecithin cholesterolacyltransferase
- the sequences for ApoA-I are known for a number of species, e.g., human ApoA-I mRNA (e.g., NCBI Ref Seq: NM_000039.2) and protein (e.g., NCBI Ref Seq:
- the native ApoA-1 protein comprises a 43 residue N-terminal globular domain and a 200 residue C-terminal lipid binding domain (e.g., residues 68-267 of SEQ ID NO: 5) which forms an ampipathic alpha helix.
- ApoA-I polypeptide refers to a polypeptide comprising at least one repeat of the ApoA-I C-terminal lipid binding domain (e.g., residues 68-267 of SEQ ID NO: 5).
- an ApoA-I polypeptide comprises from 1 to 10 repeats of the ApoA-I C-terminal lipid binding domain (e.g., residues 68-267 of SEQ ID NO: 5).
- secondary amphipathicity refers to amphipathicity existing in the secondary structure of a polypeptide, e.g., the polar residues are found on one face of the secondary structure and the nonpolar residues are found on the opposite face of the secondary structure.
- an alpha helical polypeptide with secondary amphipathicity can have a sequence selected from the group consisting of:
- KLALRLALKAFKAALKLA SEQ ID NO: 29
- RLALDLALRAFKAAWKLA SEQ ID NO: 30
- ELAWDLAFEALDAELKLD SEQ ID NO: 31
- FLKLLKKFLKLFKKLLKLF SEQ ID NO: 32
- WLKLLKKWLKLWKKLLKL (SEQ ID NO: 33); LLKFLKRLLKLLKDLWKLL (SEQ ID NO: 34); WEAAFAEALAEAWAEHLAEALAEAVEALAA (SEQ ID NO: 35); WEAKLAKALAKALAKHLAKALAKALKACEA (SEQ ID NO: 36);
- RAFARALARALKALARALKALAR SEQ ID NO: 37
- GLFEALLELLESLWELLLEA JTS 1 peptide
- KLLKLLLKLWKKLLKLLK SEQ ID NO: 39
- DWLKAFYDKVAEKLKEAF (18A peptide) (SEQ ID NO: 40); DWFKAFYDKVAEKFKEAF (4F peptide) (SEQ ID NO: 41); or variants thereof.
- Alpha helical polypeptide with secondary amphipathicity are readily identified by one of skill in the art, e.g., the Helical Wheel Prediction algorithm available at rzlab.ucr.edu/scripts/wheel/ can be used to characterize the secondary amphipathicity of a query polypeptide sequence. Secondary amphipathic peptides are described further in the art at, e.g., S.
- the loopable membrane scaffold proteins described herein can further comprise sequences useful for preparation of the covalently circularized nanodiscs, but which will not be present in the covalently circularized nanodisc itself.
- sequences flanking the N- or C-terminal circularization domains can be used to purify the loopable membrane scaffold proteins and/or to tether them to a substrate or surface for the circularization process. Circularization itself will necessarily remove such flanking sequences from the membrane scaffold protein as it is looped at the circulariation domains.
- the loopable membrane scaffold protein can comprise a cap sequence N-terminal of the N-terminal circularization domain that can be cleaved to expose the N-terminal circularization domain as the N-terminus of the protein.
- the loopable membrane scaffold protein can comprise a a cap sequence N-terminal of the N-terminal circularization domain comprising a non-polar amino acid sequence that can be cleaved to expose the N-terminal circularization domain a non-polar amino acid sequence as the N-terminus of the protein.
- Such cap sequences can comprise and be cleaved by means of any sequence recognized by a protease.
- the cap sequence can comprise the recognition sequence Leu- Val-Pro-Arg-Gly-Ser (SEQ ID NO: 42). This recognition sequence can be cleaved by thrombin between Arg and Gly.
- the cap sequence can comprise the recognition sequence Glu-X-Leu-Tyr- ⁇ -Gln-(p where X is any residue, ⁇ is any large or medium hydrophobic residue (e.g., W, F, M,Y, L, I, or V) and ⁇ is glycine or alanine (SEQ ID NO: 43).
- Glu-X-Leu-Tyr- ⁇ D-Gln-(p (SEQ ID NO: 43) is recognized by TEV protease and cleaved after the Gin residue.
- the cap sequence, or any sequence flanking the circularization domains can further comprise an affinity purification tag.
- the cap sequence can further comprise an affinity purification tag N-terminal of the cleavage site.
- the loopable membrane scaffold protein can comprise an affinity tag flanking one of the circularization domains.
- the loopable membrane scaffold protein can comprise an affinity tag C-terminal of the C-terminal circularization domain.
- the loopable membrane scaffold protein can comprise an affinity tag N-terminal of the N-terminal circularization domain.
- Affinity tags can be used for, e.g., affinity purification or to bind a protein to a desired substrate or surface.
- Affinity tags can be used to bind the loopable membrane scaffold tag to a surface or substrate prior to circularization, or to remove flanking sequences (e.g. cleaved N-terminal cap sequences) after they have been cleaved.
- flanking sequences e.g. cleaved N-terminal cap sequences
- affinity tags can include His tags, Flag tags, or Strep tags.
- Affinity tags can be separated from a circularization domain by a linker. Accordingly, a linker can be located C-terminal of the C-terminal circularization domain and N-terminal of an affinity tag, or N-terminal of the N-terminal circularization domain and C-terminal of an affinity tag.
- linkers include glycine polymers (G) n ; glycine-serine polymers (Gi_ 5 Si_5) n (SEQ ID NO: 63), where n is an integer of at least one, two, three, four, or five; glycine -alanine polymers; alanine-serine polymers; and other flexible linkers known in the art.
- Glycine and glycine- serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between domains of the proteins described herein.
- linkers can be rationally designed using a computer program capable of modeling both DNA -binding sites and the peptides themselves (Desjarlais & Berg, PNAS 90:2256-2260 (1993), PNAS 91 : 1 1099-1 1 103 (1994) or by phage display methods.
- the linker comprises the following amino acid sequence: GSTSGSGKPGSGEGSTKG (SEQ ID NO: 74) (Cooper et al, Blood, 101(4): 1637- 1644 (2003)).
- a covalently circularized nanodisc can, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, be circular in shape. In some embodiments of any of the aspects, a covalently circularized nanodisc can, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, be polygonal (e.g., triangular, rectangular, pentagonal, etc) in shape.
- the shape of the nanodisc can be directed by the ratio of phospholipids to looped scaffold membrane protein. In some embodiments of any of the aspects, the shape of the nanodisc can be directed by the structure of the looped scaffold membrane protein.
- a looped scaffold membrane protein comprising a single amphipathic alpha helix domain or multiple amphipathic alpha helix domains which are joined by sequences with constrained geometry will tend to form nanodiscs which, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, are circular in shape.
- the loopable scaffold membrane protein can comprise a plurality of amphipathic alpha helix domains separated by flexible linker sequences.
- Each linker sequence will tend to allow a sharper bend to be assumed by a looped scaffold membrane protein at that location.
- such variants of the looped scaffold membrane protein can, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, be polygonal in shape.
- the particular polygon assumed by the assembled nanodisc can be directed by the number of separate flexible linker sequences present in the looped scaffold membrane protein, with each forming a corner of a polygon.
- Linker sequences are known to those of skill in the art and can be any sequence of less than about 30 amino acids in length which do not assume a secondary structure.
- the linker sequence can be less than 30 amino acids in length. In some embodiments of any of the aspects, the linker sequence can be less than about 25 amino acids in length. In some embodiments of any of the aspects, the linker sequence can be less than 25 amino acids in length. In some embodiments of any of the aspects, the linker sequence can be less than about 20 amino acids in length. In some embodiments of any of the aspects, the linker sequence can be less than 20 amino acids in length.
- the flexible linker sequence is selected from the group consisting of: LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
- the loopable scaffold membrane protein has the sequence of any of SEQ ID NOs: 1-4 and 6-23.
- Mutation of certain residues to cysteine can, e.g., permit immobilizing nanodiscs to surfaces and/or solid substrates, e.g., by surface plasmon resonance or with use of resins or beads configured to bind to cysteine residues. Provision of cysteine residues can further permit attachment of tags, e.g., small molecule or protein tags for NMR or crystallization applications). Accordingly, in some embodiments of any of the aspects, the loopable scaffold membrane protein can comprise substitution with cysteine at one or more residues.
- the loopable scaffold membrane protein can further comprise a substitution with cysteine at one or more residues corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6, or positions 31, 36, 93, 1 10, 159, and 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at one residue corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at two residues corresponding to positions 31, 36, 137, and/or 153 of SEQ ID NO: 1 or 6.
- the loopable scaffold membrane protein can further comprise a substitution with cysteine at three residues corresponding to positions 31, 36, 137, and/or 153 of SEQ ID NO: 1 or 6. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the four residues corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6.
- the loopable scaffold membrane protein can further comprise a substitution with cysteine at the residue corresponding to positions 31, 36, 93, 1 10, 159, or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the two residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the three residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7.
- the loopable scaffold membrane protein can further comprise a substitution with cysteine at the four residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the five residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the six residues corresponding to positions 31, 36, 93, 1 10, 159, and 175 of SEQ ID NO: 2 or 7.
- the loopable scaffold membrane protein can comprise a sequence of SEQ ID NO: 1 or 6 with a substitution with cysteine at one or more residues corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6.
- the loopable scaffold membrane protein can comprise a sequence of SEQ ID NO: 2 or 7 with a substitution with cysteine at one or more residues corresponding to positions 31, 36, 93, 1 10, 159, and 175 of SEQ ID NO: 2 or 7.
- the loopable scaffold membrane protein can have or comprise the sequence of SEQ ID NO: 62.
- nucleic acid encoding a loopable membrane scaffold protein as described herein is a nucleic acid encoding a loopable membrane scaffold protein as described herein. In one aspect of any of the embodiments, described herein is a vector comprising a nucleic acid encoding a loopable membrane scaffold protein as described herein.
- the loopable scaffold membrane proteins described herein can be circularized and combined with phospholipids to form a covalently circularized nanodisc.
- a covalently circularized nanodisc comprising: a) a phospholipid bilayer; and b) a looped membrane scaffold protein forming a belt around the bilayer, wherein the looped membrane scaffold protein comprises: i) an N-terminal circularization domain covalently linked to a C-terminal circularization domain; and ii) at least one amphipathic alpha helix domains.
- a covalently circularized nanodisc comprising: a) a phospholipid bilayer; and b) a looped membrane scaffold protein forming a belt around the bilayer, wherein the looped membrane scaffold protein comprises: i) an N-terminal circularization domain covalently linked to a C- terminal circularization domain; and ii) a plurality of amphipathic alpha helix domains.
- Suitable exemplary circularization domains and methods of circularizing proteins comprising them are described elsewhere herein. The looped proteins that result from use of these exemplary circularization domains are described herein.
- a loopable membrane scaffold protein can comprise one circularization domain comprising: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and a second circularization domain comprising: a sequence LPXTG/A; wherein X represents any amino acid.
- a first circularization domain covalently linked to a second circularization domain comprises the sequence LPXT followed by a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; wherein X represents any amino acid.
- the sequence LPXT is LPGT (SEQ ID NO: 48); LPST (SEQ ID NO: 49); or LPET (SEQ ID NO: 50).
- a loopable membrane scaffold protein can comprise one circularization domain comprising an intein separated from the domain of (ii) by a Cys; and a second circularization domain comprising an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- a first circularization domain covalently linked to a second circularization domain comprises a cysteine residue.
- each circularization domain of a loopable membrane scaffold protein can comprise a Cys residue.
- one of the Cys residues is preceded by a Gly residue.
- one of the Cys residues is the C-terminal residue of the linear polypeptide.
- a first circularization domain covalently linked to a second circularization domain comprises a cysteine residue.
- the diameter of the nanodisc is greater than about 6 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than 6 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than about 15 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than 15 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than about 50 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than 50 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 80 nm.
- the diameter of the nanodisc is about 6 nm to about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 6 nm to 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is about 15 nm to about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 15 nm to 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is about 50 nm to about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 50 nm to 80 nm.
- nanodiscs described herein comprise phospholipids.
- the term phospholipids As used herein, the term
- phospholipid refers to phosphatidic acids, phosphoglycerides, and phosphosphingolipids.
- Phosphatidic acids include a phosphate group coupled to a glycerol group, which may be mono- or diacylated.
- Phosphoglycerides include a phosphate group intermediate an organic group (e.g., choline, ethanolamine, serine, inositol) and a glycerol group, which may be mono- or diacylated.
- Phosphosphingolipids include a phosphate group intermediate an organic group (e.g., choline, ethanolamine) and a sphingosine (non-acylated) or ceramide (acylated) group.
- the phospholipids useful in the compositions and methods of the invention include their salts (e.g., sodium, ammonium).
- individual geometrical isomers cis, trans
- mixtures of isomers are included.
- Representative phospholipids include phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidylserines, phosphatidylinositols, and phosphatidic acids, and their lysophosphatidyl (e.g., lysophosphatidylcholines and lysophosphatidylethanolamine) and diacyl phospholipid (e.g., diacylphosphatidylcholines, diacylphosphatidylethanolamines,
- diacylphosphatidylglycerols diacylphosphatidylserines, diacylphosphatidylinositols, and
- the acyl groups of the phospholipids may be the same or different.
- the acyl groups are derived from fatty acids having C10-C24 carbon chains (e.g., acyl groups such as lauroyl, myristoyl, palmitoyl, stearoyl or oleoyl groups).
- Representative diacylphosphatidylcholines i.e., l,2-diacyl-sn-glycero-3-phosphocholines
- DOPC dioleoylphosphatidylcholine
- DPPC dipalmitoylphosphatidylcholine
- DLPC dilinoleoylphosphatidylcholine
- POPC palmitoyloleoylphosphatidylcholine
- DDPC didecanoylphosphatidylcholine
- DEPC dierucoylphosphatidylcholine
- DLOPC dilinoleoylphosphatidylcholine
- DMPC dimyristoylphosphatidylcholine
- myristoylpalmitoylphosphatidylcholine MPPC
- myristoylstearoylphosphatidylcholine MSPC
- stearoylmyristoylphosphatidylcholine SMPC
- palmitoylmyristoylphosphatidylcholine PMPC
- palmitoylstearoylphosphatidylcholine PSPC
- stearoylpalmitoylphosphatidylcholine SPPC
- SOPC stearoyloleoylphosphatidylcholine
- diacylphosphatidylethanolamines i.e., l,2-diacyl-sn-glycero-3- phosphoethanolamines
- DOPE dioleoylphosphatidylethanolamine
- DPPE dipalmitoylphosphatidylethanolamine
- DSPE distearoylphosphatidylethanolamine
- DLPE dilauroylphosphatidylethanolamine
- DMPE dimyristoylphosphatidylethanolamine
- DEPE dierucoylphosphatidylethanolamine
- POPE palmitoyloleoylphosphatidylethanolamine
- diacylphosphatidylglycerols include dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG),
- DOPG dioleoylphosphatidylglycerol
- DPPG dipalmitoylphosphatidylglycerol
- DEPG dierucoylphosphatidylglycerol
- DLPG dilauroylphosphatidylglycerol
- DMPG dimyristoylphosphatidylglycerol
- DSPG distearoylphosphatidylglycerol
- POPG palmitoyloleoylphosphatidylglycerol
- diacylphosphatidylserines i.e., l,2-diacyl-sn-glycero-3- phosphoserines
- DLPS dilauroylphosphatidylserine
- DOPS dioleoylphosphatidylserine
- DPPS dipalmitoylphosphatidylserine
- DSPS distearoylphosphatidylserine
- diacylphosphatidic acids i.e., l,2-diacyl-sn-glycero-3-phosphates
- DEPA dierucoylphosphatidic acid
- DLPA dilauroylphosphatidic acid
- DMPA dimyristoylphosphatidic acid
- DOPA dioleoylphosphatidic acid
- DPPA dipalmitoylphosphatidic acid
- DSPA distearoylphosphatidic acid
- Representative phospholipids include phosphosphingolipids such as ceramide
- the nanodics of the invention can comprise one type of phospholipid. In some embodiments of any of the aspects, the nanodics of the invention can comprise two or more different phospholipids. In some embodiments of any of the aspects, the nanodics of the invention can comprise two different phospholipids. In some embodiments of any of the aspects, the nanodics of the invention can comprise three different phospholipids. In some embodiments of any of the aspects, the nanodics of the invention can comprise four different phospholipids.
- the phospholipid can be a native lipid extract. In some embodiments of any of the aspects, the phospholipid can be a headgroup modified lipid, e.g., alkyl phosphates (e.g.
- the phospholipids can further comprise a molecule of interest, e.g., a membrane protein, a receptor, a transmembrane protein or channel, hydrophobic small molecules, hydrophobic drugs, RNA, peptides, and the like.
- a molecule of interest e.g., a membrane protein, a receptor, a transmembrane protein or channel, hydrophobic small molecules, hydrophobic drugs, RNA, peptides, and the like.
- the covalently circularized nanodiscs described herein can be or be utilized as a drug delivery vehicle.
- a method comprising: a) contacting the loopable membrane scaffold protein described herein with a sortase enzyme; b) contacting the looped protein produced in step (a) with solubilized phospholipids.
- sortase enzymes are known in the art, e.g., ones that recognize the various exemplary circularization domain sequences provided herein.
- the sortase can be Staphylococcus aureus wild type sortase A (Srt A); evolved sortase; eSrtA; eSrtA(2A-9); eSrtA(4S-9); or Streptococcus pyogenes sortase A.
- Wild type SrtA and eSrtA recognize LPXTG (SEQ ID NO: 5 1) while eSrtA(2A-9) recognizes LAXTG (SEQ ID NO: 75), LSETG (SEQ ID NO: 76) and accepts glycine nucleophiles and eSrt A(4S-9) recognizes LPXSG (SEQ ID NO: 77), LPXCG (SEQ ID NO: 78), LPXAG (SEQ ID NO: 79) and accepts glycine nucleophiles.
- Evolved sortases are described further in, e.g., Dorr et al. PNAS 2014 1 1 1(37): 13343-8 and Chen et al.
- Streptococcus sortase A recognizes the LPXTA motif (SEQ ID NO: 56) and accepts alanine nucleophiles (see, e.g., P. Race, J. Biol. Chem. 284: 6924-6933; which is incorporated by reference herein in its entirety).
- the contacting step can be stopped by quenching the reaction with a sortase inhibitor.
- Sortase inhibition is known in the art and can include the use of AAEK2 or a high concentration of EDTA.
- a high concentration of EDTA can be from about 100 uM to about 400 mM, e.g., 100 uM to 400 mM, about ImM to about 300 mM, ImM to 300 mM, about ImM to about 200 mM, or ImM to 200 mM.
- a method comprising a) contacting the loopable membrane scaffold protein comprising intein circularization domains with: i) a solution having a pH low enough to induce cleavage of the dipeptide sequence of Asn-Cys; ii) and a thiol reagent to induce cleavage at the Cys residue; resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids.
- the thiol reagent is DTT.
- the loopable membrane scaffold protein comprises a chitin binding domain flanking each circularization domain and is first purified by chitin binding prior to circularization (e.g., the loopable membrane scaffold protein is expressed from a pTWIN vector in E. coli and purified by binding to chitin beads).
- a method comprising a) contacting a loopable membrane scaffold protein comprising circularization domains comprising cysteine residues with a thiol reagent or thiol donor, resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids.
- the thiol can be DTT, sodium 2-mercaptoethane sulfonate (MESNa) or guanidinium hydrocholoride. Circularization via two cysteine residues is described in the art, e.g., Cowper, B et. al.
- a reagent and/or enzyme used to catalyze or permit circularization can be bound to a substrate or surface.
- a reagent and/or enzyme used to catalyze or permit circularization can further comprise an affinity tag to, e.g., permit binding a substrate or to assist in removal of the reagent and/or enzyme when the reaction is to be stopped.
- the affinity tag is a His tag.
- a sortase can further comprise a His tag.
- the loopable membrane scaffold protein can further comprise an affinity tag that permits the protein to be bound to a substrate or surface. In some embodiments of any of the aspects, the loopable membrane scaffold protein can further comprise a His tag that permits the protein to be bound to a substrate or surface. In some embodiments of any of the aspects, the loopable membrane scaffold protein can further comprise a C-terminal affinity tag that permits the protein to be bound to a substrate or surface. In some embodiments of any of the aspects, the method described herein can further comprise a first step of binding a loopable membrane scaffold protein comprising an affinity tag to a substrate or surface.
- the substrate comprises Cu2+, Ni2+ or Co2+. In some embodiments of any of the aspects, the substrate is a column, chip, or bead.
- the loopable membrane scaffold protein is bound to a substrate, e.g., a bead, and the first contacting step is performed in the presence of phospholipids. In some embodiments of any of the aspects, the loopable membrane scaffold protein is bound to a substrate, e.g., a bead, and the first and second contacting steps are performed concurrently.
- the loopable membrane scaffold protein is bound to a substrate, e.g., a bead, and after the first contacting step, the looped membrane scaffold protein is eluted from the substrate.
- the loopable membrane scaffold protein is in solution prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of less than about 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of less than 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of from about 1 uM to about 1 mM prior to the first contacting step.
- the loopable membrane scaffold protein is in solution at a concentration of from 1 uM to 1 mM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of from about 1 uM to about 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of from 1 uM to 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the looped membrane scaffold protein formed after the first contacting step is passed through a column, substrate, and/or solution which can be bound by an affinity tag found on the loopable membrane scaffold protein.
- the looped membrane scaffold protein formed after the first contacting step is passed through a column, substrate, and/or solution Cu2+, Co2+ or Ni2+, which can be bound by an affinity tag (e.g. a His tag) found on the loopable membrane scaffold protein.
- an affinity tag e.g. a His tag
- the loopable membrane protein further comprises a cap sequence N-terminal of the N-terminal circularization domain and the method comprises a first step of contacting the protein with an enzyme to cleave the cap sequence.
- the phospholipids of the second contacting step are solubilized in detergent.
- exemplary detergents can include, but are not limited to Decyl ⁇ -D- maltopyranoside, Deoxycholic acid, Digitonin, n-Dodecyl ⁇ -D-glucopyranoside, n-Dodecyl ⁇ -D- maltoside, N-Lauroylsarcosine sodium salt, Sodium cholate, Sodium deoxycholate , Undecyl ⁇ -D- maltoside, Triton X-100, CHAPS, 5-Cyclohexylpentyl ⁇ -D-maltoside, n-dodecyl phosphatidylcholine, n- octyl ⁇ -d-glucoside, and Brij 97.
- the second contacting step occurs at a temperature of from about 0 C to about 42 C. In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from 0 C to 42 C. In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from about 0 C to about 37 C. In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from 0 C to 37 C.
- the ratio of loopable membrane scaffold protein to phospholipids is from about 1 : 1000 to about 1 : 10,000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from 1 : 1000 to 1 : 10,000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2000 to about 1 :5000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from 1:2000 to 1 :5000.
- the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3500 to about 1 :4500; and nanodiscs which are circular in shape formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is about 1 :4000; and nanodiscs which are circular in shape are formed.
- the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from 1 :3500 to 1 :4500; and nanodiscs which are circular in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is 1 :4000; and nanodiscs which are circular in shape are formed. In some embodiments of any of the aspects, the phospholipids are POPC/POPG lipids.
- the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2500 to about 1 :3700; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3100 to about 1 :3400; and nanodiscs which are polygonal in shape are formed.
- the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from 1 :2500 to 1 :3700; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from 1 :3100 to 1 :3400; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the phospholipids are POPC/POPG lipids.
- the nanodiscs described herein can be used, e.g., in structural and/or functional studies of membrane proteins or as vaccine platforms. It is specifically contemplated that the nanodiscs described herein can be used for solution NMR, cryo-EM studies, crystallization, and 2D lattice of, e.g., membrane proteins in or on the bilayer. Membrane proteins can be studied to examine, e.g., protein-protein interactions with other membrane proteins, or cytosolic or extracellular proteins; behavior and structure of membrane pores; virus entry and inhibition thereof; and cell-free expression of membrane proteins.
- the nanodiscs described herein can also permit study of, e.g., lipid rafts themselves, vesicle fusion, and Residual Dipolar Coupling (RDC) measurements (detergent free, homogenous effect, charge tunable).
- RDC Residual Dipolar Coupling
- a method of inducing an immune response in a subject comprising administering to the subject a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc.
- an "immune response” refers to a response by a cell of the immune system, such as a B cell, T cell (CD4 or CD8), regulatory T cell, antigen-presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil, to a stimulus (e.g., to an adjuvant).
- a cell of the immune system such as a B cell, T cell (CD4 or CD8), regulatory T cell, antigen-presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil
- a stimulus e.g., to an adjuvant.
- the response is specific for a particular antigen (an "antigen-specific response”), and refers to a response by a CD4 T cell, CD8 T cell, or B cell via their antigen-specific receptor.
- an immune response is a T cell response, such as a CD4+ response or a CD8+ response.
- T cell response such as a CD4+ response or a CD8+ response.
- responses by these cells can include, for example, cytotoxicity, proliferation, cytokine or chemokine production, trafficking, or phagocytosis, and can be dependent on the nature of the immune cell undergoing the response.
- Stimulation of an immune response refers to an induction or increase of the immune response.
- An immune response to an antigen can be the development in a subject of a humoral and/or a cell-mediated immune response to molecules present in the antigen or vaccine composition of interest.
- a "humoral immune response” is an antibody-mediated immune response and involves the induction and generation of antibodies that recognize and bind with some affinity for the antigen in the immunogenic composition of the invention, while a "cell-mediated immune response” is one mediated by T-cells and/or other white blood cells.
- a "cell-mediated immune response” is elicited by the presentation of antigenic epitopes in association with Class I or Class II molecules of the major histocompatibility complex (MHC), CD1 or other non-classical MHC-like molecules.
- MHC major histocompatibility complex
- CTLs cytotoxic lymphocyte cells
- CTLs have specificity for peptide antigens that are presented in association with proteins encoded by classical or non- classical MHCs and expressed on the surfaces of cells. CTLs help induce and promote the intracellular destruction of intracellular microbes, or the lysis of cells infected with such microbes.
- helper T-cells act to help stimulate the function, and focus the activity of, nonspecific effector cells against cells displaying peptide or other antigens in association with classical or non-classical MHC molecules on their surface.
- a “cell- mediated immune response” also refers to the production of cytokines, chemokines and other such molecules produced by activated T-cells and/or other white blood cells, including those derived from CD4+ and CD8+ T-cells.
- the ability of a particular antigen or composition to stimulate a cell-mediated immunological response may be determined by a number of assays, such as by lymphoproliferation (lymphocyte activation) assays, CTL cytotoxic cell assays, by assaying for T-lymphocytes specific for the antigen in a sensitized subject, or by measurement of cytokine production by T cells in response to re- stimulation with antigen.
- assays are well known in the art. See, e.g., Erickson et al. (1993) J.
- an immune response can comprise immunization.
- Immunization refers to the process of inducing a high level of antibody and/or cellular immune response in a subject, that is directed against a pathogen or antigen to which the organism has been exposed. Immunization can provide protection against the relevant pathogen, e.g., prevent disease arising from a pathogen comprising the antigen if the subject is exposed to said pathogen after immunization.
- Immunization may be life-long or require booster administrations.
- a subject administered a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc is further administered an adjuvant, e.g, in the same composition or in a different composition, at the same time, or at a separate time.
- the composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc is admixed with the adjuvant prior to administration.
- the administration is a prime administration and/or a boost administration.
- the subject is further administered a second vaccine, e.g., against the same or a different pathogen(s).
- compositions and methods described herein can be administered to a subject in need of vaccination, immunization, and/or stimulation of an immune response.
- the methods described herein comprise administering an effective amount of compositions described herein, e.g. to a subject in order to stimulate an immune response or provide protection against the relevant pathogen the antigen was derived from.
- Providing protection against the relevant pathogen is stimulating the immune system such that later exposure to the antigen (e.g., on or in a live pathogen) triggers a more effective immune response than if the subject was naive to the antigen. Protection can include faster clearance of the pathogen, reduced severity and/or time of symptoms, and/or lack of development of disease or symptoms.
- compositions described herein to subjects are known to those of skill in the art. Such methods can include, but are not limited to oral, parenteral, intravenous, intramuscular, subcutaneous, transdermal, airway (aerosol), pulmonary, cutaneous, injection, or topical, administration. Administration can be local or systemic. In some embodiments of any of the aspects, the administration can be intramuscular or subcutaneous.
- the term "effective amount” as used herein refers to the amount of adjuvant needed to stimulate the immune system, or in combination with an antigen, to provide a protective effect against subsequent infections, and relates to a sufficient amount of pharmacological composition to provide the desired effect.
- the term "therapeutically effective amount” therefore refers to an amount of the adjuvant (and optionally, the antigen) that is sufficient to provide a particular immune stimulatory effect when administered to a typical subject.
- An effective amount as used herein, in various contexts would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom of the disease (for example but not limited to, slowing the progression of a symptom of the disease), or prevent a symptom of the disease.
- an appropriate "effective amount” can be determined by one of ordinary skill in the art using only routine experimentation.
- Effective amounts, toxicity, and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g. , for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dosage can vary depending upon the dosage form employed and the route of administration utilized.
- the dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50.
- Compositions and methods that exhibit large therapeutic indices are preferred.
- a therapeutically effective dose can be estimated initially from cell culture assays.
- a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e.
- the concentration of a composition which achieves a half-maximal inhibition of symptoms or induction of desired responses as determined in cell culture, or in an appropriate animal model.
- Levels in plasma can be measured, for example, by high performance liquid chromatography.
- the effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for antibody titers, among others.
- the dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
- the technology described herein relates to a pharmaceutical composition
- a pharmaceutical composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc as described herein, and optionally a pharmaceutically acceptable carrier.
- the active ingredients of the pharmaceutical composition comprises a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc.
- the active ingredients of the pharmaceutical composition consist essentially of a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. In some embodiments of any of the aspects, the active ingredients of the pharmaceutical composition consist of a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc.
- Pharmaceutically acceptable carriers and diluents include saline, aqueous buffer solutions, solvents and/or dispersion media. The use of such carriers and diluents is well known in the art.
- materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as e
- wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation.
- the terms such as “excipient”, “carrier”, “pharmaceutically acceptable carrier” or the like are used interchangeably herein.
- the carrier inhibits the degradation of the active agent.
- the pharmaceutical composition as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, parenteral dosage forms are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. In addition, controlled-release parenteral dosage forms can be prepared for administration of a patient, including, but not limited to, DUROS ® -type dosage forms and dose-dumping.
- Suitable vehicles that can be used to provide parenteral dosage forms of an adjuvant as disclosed within are well known to those skilled in the art. Examples include, without limitation: sterile water; water for injection USP; saline solution; glucose solution; aqueous vehicles such as but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
- Compounds that alter or modify the solubility of a pharmaceutically acceptable salt of a composition as disclosed herein can also be incorporated into the parenteral dosage forms of the disclosure, including conventional and controlled-release parenter
- Conventional dosage forms generally provide rapid or immediate drug release from the formulation. Depending on the pharmacology and pharmacokinetics of the drug, use of conventional dosage forms can lead to wide fluctuations in the concentrations of the drug in a patient's blood and other tissues. These fluctuations can impact a number of parameters, such as dose frequency, onset of action, duration of efficacy, maintenance of therapeutic blood levels, toxicity, side effects, and the like.
- controlled-release formulations can be used to control a drug's onset of action, duration of action, plasma levels within the therapeutic window, and peak blood levels.
- controlled- or extended-release dosage forms or formulations can be used to ensure that the maximum effectiveness of a drug is achieved while minimizing potential adverse effects and safety concerns, which can occur both from under-dosing a drug (i.e., going below the minimum therapeutic levels) as well as exceeding the toxicity level for the drug.
- the adjuvant can be administered in a sustained release formulation.
- Controlled-release pharmaceutical products have a common goal of improving drug therapy over that achieved by their non-controlled release counterparts.
- the use of an optimally designed controlled-release preparation in medical treatment is characterized by a minimum of drug substance being employed to cure or control the condition in a minimum amount of time.
- Advantages of controlled- release formulations include: 1) extended activity of the drug; 2) reduced dosage frequency; 3) increased patient compliance; 4) usage of less total drug; 5) reduction in local or systemic side effects; 6) minimization of drug accumulation; 7) reduction in blood level fluctuations; 8) improvement in efficacy of treatment; 9) reduction of potentiation or loss of drug activity; and 10) improvement in speed of control of diseases or conditions.
- Controlled-release of an active ingredient can be stimulated by various conditions including, but not limited to, pH, ionic strength, osmotic pressure, temperature, enzymes, water, and other physiological conditions or compounds.
- a variety of known controlled- or extended-release dosage forms, formulations, and devices can be adapted for use with the salts and compositions of the disclosure.
- dosage forms can be used to provide slow or controlled-release of one or more active ingredients using, for example, hydroxypropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems (such as OROS ® (Alza
- the methods described herein can further comprise administering a second agent and/or treatment to the subject, e.g. as part of a combinatorial therapy.
- an effective dose of a composition as described herein can be administered to a patient once. In certain embodiments, an effective dose of a composition can be administered to a patient repeatedly.
- subjects can be administered a therapeutic amount of a composition as described herein, such as, e.g. 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, or more.
- the dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to increase or decrease dosage, increase or decrease administration frequency, discontinue treatment, resume treatment, or make other alterations to the treatment regimen.
- the dosing schedule can vary from once a week to daily depending on a number of clinical factors, such as the subject's sensitivity to the adjuvant and/or the antigen.
- the desired dose or amount of activation can be administered at one time or divided into subdoses, e.g., 2-4 subdoses and administered over a period of time, e.g., at appropriate intervals through the day or other appropriate schedule.
- administration can be chronic, e.g., one or more doses over a period of weeks or months.
- the dosage ranges for the administration of a composition according to the methods described herein depend upon, for example, the form of the adjuvant, its potency, and the extent to which symptoms, markers, or indicators of a response described herein are desired to be induced, for example the percentage inducation desired for an immune response.
- the dosage should not be so large as to cause adverse side effects, such as inflammatory responses.
- the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art.
- the dosage can also be adjusted by the individual physician in the event of any complication.
- the efficacy of a composition as described herein in, e.g. inducing a response as described herein can be determined by the skilled clinician.
- a treatment is considered "effective treatment," as the term is used herein, if one or more of the signs or symptoms of a condition described herein are altered in a beneficial manner, other clinically accepted signs or symptoms are improved, or a desired response is induced e.g., by at least 10% following treatment according to the methods described herein.
- Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate.
- Immune responses can be detected by a variety of methods known to those skilled in the art, including but not limited to, antibody production, cytotoxicity assay, proliferation assay and cytokine release assays.
- samples of blood can be drawn from the immunized mammal and analyzed for the presence of antibodies against the antigen administered in the respective vaccine and the titer of these antibodies can be determined by methods known in the art.
- Efficacy of an agent can be determined by assessing physical indicators of a desired response, (e.g. immune response, cytokine production, antibody titers, etc). It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy can be assessed in animal models of a condition described herein, for example immunization of monkeys. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.
- a desired response e.g. immune response, cytokine production, antibody titers, etc. It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy can be assessed in animal models of a condition described herein, for example immunization of monkeys. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in
- In vitro and animal model assays are provided herein which allow the assessment of a given dose of an adjuvant and/or antigen.
- the effects of a dose of adjuvant can be assessed by measuring the antibody titers or cytokine production.
- the efficacy of a given dosage combination can also be assessed in an animal model, e.g. immunization of mice as described in the Examples herein.
- kits comprising a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc.
- a kit is any manufacture (e.g., a package or container) comprising at least one reagent, e.g., a composition as described herein, the manufacture being promoted, distributed, or sold as a unit for performing the methods described herein.
- the kits described herein can optionally comprise additional components useful for performing the methods described herein.
- the kit can comprise fluids and compositions (e.g., buffers, needles, syringes etc.) suitable for performing one or more of the administrations according to the methods described herein, an instructional material which describes performance of a method as described herein, and the like. Additionally, the kit may comprise an instruction leaflet.
- fluids and compositions e.g., buffers, needles, syringes etc.
- an instructional material which describes performance of a method as described herein, and the like.
- the kit may comprise an instruction leaflet.
- treatment means any one or more of the following: (i) the prevention of infection or re-infection, as in a traditional vaccine, (ii) the reduction in the severity of, or, in the elimination of symptoms, and (iii) the substantial or complete elimination of the pathogen or disorder in question.
- treatment may be effected prophylactically (prior to infection) or therapeutically (following infection).
- prophylactic treatment is the preferred mode.
- compositions and methods that treat, including prophylactically and/or therapeutically immunize, a host animal against a microbial infection (e.g., a bacterium or virus).
- a microbial infection e.g., a bacterium or virus.
- the methods of the present invention are useful for conferring prophylactic and/or therapeutic immunity to a subject.
- the methods of the present invention can also be practiced on subjects for biomedical research applications.
- an immunogenic amount or immunologically effective amount of a composition described herein is administered.
- the method further comprises isolating from the subject: a) an antibody that specifically binds to the antigen polypeptide; b) a nucleic acid encoding an antibody that specifically binds to the antigen polypeptide; or c) a cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide.
- Such compositions can be utilized to provide antibodies (polyclonal or monoclonal) which can be used for research, diagnostic, and/or therapeutic purposes according to methods known in the art.
- composition refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the
- a pharmaceutically acceptable carrier can be a carrier other than water.
- a pharmaceutically acceptable carrier can be a cream, emulsion, gel, liposome, nanoparticle, and/or ointment.
- a pharmaceutically acceptable carrier can be an artificial or engineered carrier, e.g., a carrier that the active ingredient would not be found to occur in in nature.
- administering refers to the placement of a compound as disclosed herein into a subject by a method or route which results in at least partial delivery of the agent at a desired site.
- Pharmaceutical compositions comprising the compounds disclosed herein can be administered by any appropriate route which results in an effective treatment in the subject.
- liposome refers to a vesicular structure having lipid-containing membranes enclosing an aqueous interior.
- a vesicular structure is a hollow, lamellar, spherical structure, and provides a small and enclosed compartment, separated from the cytosol by at least one lipid bilayer.
- Liposomes can have one or more lipid membranes. Liposome compositions can be prepared by a variety of methods that are known in the art.
- a "subject” means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomologous monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters.
- Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon.
- the subject is a mammal, e.g., a primate, e.g., a human.
- the terms, "individual,” “patient” and “subject” are used interchangeably herein.
- the subject is a mammal.
- the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of immunization and immune response.
- a subject can be male or female.
- a subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment (e.g. susceptibility to infection) or one or more complications related to such a condition, and optionally, have already undergone treatment for the condition or the one or more complications related to the condition.
- a subject can also be one who has not been previously diagnosed as having the condition or one or more complications related to the condition.
- a subject can be one who exhibits one or more risk factors for the condition or one or more complications related to the condition or a subject who does not exhibit risk factors.
- a "subject in need" of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.
- protein and “polypeptide” are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha- amino and carboxy groups of adjacent residues.
- protein and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function.
- modified amino acids e.g., phosphorylated, glycated, glycosylated, etc.
- amino acid analogs regardless of its size or function.
- Protein and “polypeptide” are often used in reference to relatively large polypeptides, whereas the term “peptide” is often used in reference to small polypeptides, but usage of these terms in the art overlaps.
- polypeptide proteins and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof.
- exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
- nucleic acid or “nucleic acid sequence” refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof.
- the nucleic acid can be either single -stranded or double-stranded.
- a single -stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA.
- the nucleic acid can be DNA.
- nucleic acid can be RNA.
- Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
- a nucleic acid encoding a polypeptide as described herein is comprised by a vector.
- a nucleic acid sequence encoding a given polypeptide as described herein, or any module thereof is operably linked to a vector.
- vector refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells.
- a vector can be viral or non-viral.
- vector encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells.
- a vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc.
- expression vector refers to a vector that directs expression of an R A or polypeptide from sequences linked to transcriptional regulatory sequences on the vector.
- the sequences expressed will often, but not necessarily, be heterologous to the cell.
- An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.
- expression refers to the cellular processes involved in producing RNA and proteins and as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing.
- “Expression products” include RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene.
- the term “gene” means the nucleic acid sequence, which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences.
- the gene may or may not include regions preceding and following the coding region, e.g. 5 ' untranslated (5'UTR) or "leader” sequences and 3 ' UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
- viral vector refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle.
- the viral vector can contain the nucleic acid encoding encoding a polypeptide as described herein in place of non-essential viral genes.
- the vector and/or particle may be utilized for the purpose of transferring any nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art.
- recombinant vector is meant a vector that includes a heterologous nucleic acid sequence, or "transgene” that is capable of expression in vivo. It should be understood that the vectors described herein can, In some embodiments of any of the aspects, be combined with other suitable compositions and therapies. In some embodiments of any of the aspects, the vector is episomal. The use of a suitable episomal vector provides a means of maintaining the nucleotide of interest in the subject in high copy number extra chromosomal DNA thereby eliminating potential effects of chromosomal integration.
- composition refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the
- pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- statically significant or “significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
- compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
- the term "consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment.
- the term "corresponding to” refers to refers to an amino acid or nucleotide at the enumerated position in a first polypeptide or nucleic acid, or an amino acid or nucleotide that is equivalent to an enumerated amino acid or nucleotide in a second polypeptide or nucleic acid.
- Equivalent enumerated amino acids or nucleotides can be determined by alignment of candidate sequences using degree of homology programs known in the art, e.g., BLAST.
- a loopable membrane scaffold protein comprising, from N-terminus to C-terminus:
- one circularization domain comprises: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue;
- the other circularization domain comprises:
- N-terminal circularization domain comprises:
- non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue
- the C-terminal circularization domain comprises:
- non-polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine.
- non-polar amino acid sequence consists of 1-5 glycine residues.
- non-polar amino acid sequence consists of 1-5 alanine residues.
- one circularization domain comprises an intein separated from the domain of (ii) by a Cys;
- the other circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- N-terminal circularization domain comprises an intein separated from the domain of (ii) by a Cys
- the C-terminal circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
- each circularization domain comprises a Cys. protein of any of paragraphs 1- 12, wherein the amphipathic alpha helix domain comprises:
- alpha helical polypeptide has a sequence selected from the group consisting of:
- ELAWDLAFEALDAELKLD (SEQ ID NO: 31);
- DWFKAFYDKVAEKFKEAF (SEQ ID NO: 41). protein of any of paragraphs 1-14, further comprising a cap sequence N-terminal of the N- terminal circularization domain that can be cleaved to expose the N-terminal circularization domain as the N-terminus of the protein.
- cap sequence comprises as sequence selected from the group consisting of:
- cap sequence further comprises an affinity purification tag N-terminal of the cleavage site.
- LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
- a covalently circularized nanodisc comprising:
- looped membrane scaffold protein comprises:
- an N-terminal circularization domain covalently linked to a C-terminal circularization domain comprises the sequence LPXT followed by a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue;
- amino acids 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine.
- LPST SEQ ID NO: 49
- LPET SEQ ID NO: 50
- nanodisc of any paragraph 25 wherein the N-terminal circularization domain covalently linked to a C-terminal circularization domain is a cysteine residue.
- nanodisc of any of paragraphs 25-31, wherein amphipathic alpha helix domain comprises:
- alpha helical polypeptide has a sequence selected from the group consisting of:
- ELAWDLAFEALDAELKLD (SEQ ID NO: 31);
- DWFKAFYDKVAEKFKEAF (SEQ ID NO: 41). nanodisc of any of paragraphs 25-33, wherein the plurality of amphipathic alpha helix domains are separated by flexible linker sequences;
- LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
- nanodisc of any of paragraphs 25-35 wherein the protein has the sequence of any of SEQ ID NOs: 1-4 and 6-23.
- nanodisc of any of paragraphs 25-37 wherein the diameter is greater than about 15 nm.
- nanodisc of any of paragraphs 25-38 wherein the diameter is greater than about 50 nm.
- nanodisc of any of paragraphs 25-39 wherein the diameter is about 80 nm. ethod of making a nanodisc of any of paragraphs 25-30 or 32-40, the method comprising:
- Staphylococcus aureus wild type sortase A (Srt A); evolved sortase; eSrtA; eSrtA(2A-9); eSrtA(4S-9); and Streptococcus pyogenes sortase A.
- step (a) contacting the looped protein produced in step (a) with solubilized phospholipids.
- step (a) a. contacting the loopable membrane scaffold protein of any of paragraphs 12-24 with a thiol reagent, resulting in circularization of the protein; and b. contacting the looped protein produced in step (a) with solubilized
- phospholipids The method of any of paragraphs 41-49, wherein the phospholipids are solubilized in detergent. The method of any of paragraphs 41-50, wherein step (b) occurs at a temperature of from about 0
- step (b) occurs at a temperature of from about 0
- step (a) is performed in the presence of phospholipids.
- step (a) The method of any of paragraphs 41-63, further comprising, after step (a), a step of eluting the looped protein produced in step (a) from the substrate.
- step (a) is passed through a column, substrate, and/or solution comprising Cu2+, Co2+ or Ni2+.
- a vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof.
- phospholamban phospholamban; influenza M2 channel protein; stannin; Vpu; HIV Vpu; parainfluenza 5 fusion protein; parainfluenza fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH.
- polypeptide of paragraph 5 wherein the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide.
- MPER membrane proximal external region
- polypeptide of any of paragraphs 5-12 comprising multiple different antigen polypeptides.
- polypeptide of any of paragraphs 12-13 wherein the antigen polypeptides or repeats thereof are separated by a linker.
- polypeptide of paragraph 14 wherein the linker is hydrophilic.
- polypeptide of any of paragraphs 19-21 wherein the linker is from 1 to 5 amino acids in length.
- cleic acid encoding the vaccine scaffold polypeptide of any of paragraphs 1-5 or the immunogenic conjugate polypeptide of any of paragraphs 5-22.
- lypeptide complex comprising a polymeric complex of the polypeptides of any of paragraphs
- mposition comprising a polypeptide complex of paragraph 24 and/or an immunogenic conjugate polypeptide of any of claims 5-22 embedded in the phospholipid bilayer of a liposome or nanodisc.
- composition of paragraph 25, wherein the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid.
- composition of paragraph 25, wherein the phospholipid bilayer comprises cholesterol comprises cholesterol
- armaceutical composition comprising the composition of any of paragraphs 25-29 and a pharmaceutically acceptable carrier.
- composition of paragraph 30 further comprising an adjuvant. ethod of inducing an immune response in a subject, the method comprising administering to the subject a composition of any of paragraphs 25-31.
- compositions of any of paragraphs 24-30 is admixed with the adjuvant prior to administration.
- nucleic acid encoding an antibody that specifically binds to the antigen polypeptide
- cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide.
- cNDs covalently circularized nanodiscs
- polygonal nanodiscs e.g., facilitating solution NMR and Cryo-EM studies, permitting structural and functional studies of large membrane proteins, and the use of the nanodiscs as vaccine platforms.
- Nanodiscs have been designed to conduct in vitro biophysical studies of membrane proteins.
- a nanodisc is an assembly of a phospholipid bilayer surrounded or “belted” by two copies of an amphipathic helical membrane scaffold protein (MSP).
- MSP amphipathic helical membrane scaffold protein
- the size of the MSP (e.g., circumference) defines the size of the nanodiscs and various lipids that can be incorporated to form the discoidal bilayer construct.
- Nanodiscs have been shown to provide a stable and more biologically relevant, "native-like" lipid bilayer environment compared to agents such as detergents or liposomes. Numerous proteins have been assembled into nanodiscs and these constructs have proven to be useful in studying membrane protein structure and function by solution NMR and Cryo-electron microscopy (Cryo-EM).
- the term "conventional nanodiscs” refers to discoidal, nanoscale phospholipid bilayers encompassed by a membrane scaffold protein (MSP) e.g., two molecules of amphipathic alpha- helical protein wrapped around the perimeter of the disc in an anti-parallel fashion.
- MSP membrane scaffold protein
- the hydrophobic face of the scaffold protein serves to sequester the hydrocarbon tails of the phospholipids away from the solvent and limits the size of the disc.
- the membrane scaffold protein can be apolipoprotein.
- These conventional nanodiscs are lipid-protein nanoparticles roughly 10 nm in diameter.
- cNDs covalently circularized nanodiscs
- polygonal nanodiscs Described herein are three "non-conventional" nanodiscs: covalently circularized nanodiscs (cNDs) and polygonal nanodiscs.
- Covalently circularized nanodiscs Described herein is the covalently linkage of the N and C termini of ApoA-I protein variants and circularization of the proteins on a Cu2+ chip to produce uniformly sized nanodiscs. To accommodate the analysis of larger membrane proteins, it is also demonstrated herein that high molecular weight circularized variants can be used to prepare circularized nanodiscs of up to 80 nm in diameter.
- Polygonal nanodiscs The present technology also relates to the production of polygonal nanodiscs.
- the inventors determined that at suboptimal lipid concentrations, the circularized high molecular weight variants could form nanodiscs having non-circular shapes and that these can increase the chance for crystallization.
- nanodisc structures Described herein are several applications for the nanodisc structures including their use in solution NMR and Cryo-EM studies, permitting structural and functional studies of larger membrane proteins, permitting the study of membrane protein interactions with other proteins, permitting the study of viral entry into cells, and their use as vaccine platforms.
- cNDs covalently circularized phospholipid bilayer nanodiscs
- Producing nanodiscs of increased size is highly desirable for incorporating larger integral membrane proteins (IMP), molecular complexes, oligomers of IMP, and pore-forming proteins into the discoidal bilayer for detailed biophysical investigation.
- IMP integral membrane proteins
- oligomers of IMP oligomers of IMP
- pore-forming proteins into the discoidal bilayer for detailed biophysical investigation.
- IMP integral membrane proteins
- cNDs described herein of interest to chemists engaged in pharmacological, membrane/lipid, and general biophysics research.
- the cNDs described herein can permit new opportunities in crystallization, drug and nucleic acid delivery, vaccine platform, cell free expression of larger membrane proteins (IMP) and molecular complexes.
- Nanodiscs provide a detergent-free lipid bilayer model that is compatible with solution NMR, are not prone to aggregation, and do not suffer from the geometric distortion often inherent in other membrane substitutes.
- a conventional nanodisc is composed of a nanometer-sized phospholipid bilayer encircled by two copies of a helical, amphipathic membrane scaffold proteins (MSPs) [2, 3] .
- MSPs are truncated forms of apolipoprotein Al, which is the major protein component of high-density lipoprotein.
- MSPs truncated forms of apolipoprotein Al, which is the major protein component of high-density lipoprotein.
- MSPs truncated forms of apolipoprotein Al, which is the major protein component of high-density lipoprotein.
- MSPs truncated forms of apolipoprotein Al, which is the major protein component of high-density lipoprotein.
- MSPs trunc
- nanodiscs for multidimensional NMR experiments, as required for complete three- dimensional structural assignment, remains challenging and is still in its early stages. Furthermore, to the best of our knowledge, there has been no membrane proteins successfully crystallized in nanodiscs. A challenging hurdle is that the diameter of the nanodisc particle can vary broadly independent of the MSP chain length in a single preparation [5, 6] . This size heterogeneity can result in a variable number of membrane proteins being incorporated into each disc [6] .
- cNDs Covalently circularized nanodiscs
- sortase A [7] was used to covalently link the N and C termini of several apoAl variants.
- the protein constructs contain the consensus sequence recognized by sortase A, which are a LPXTG sequence (SEQ ID NO: 51) near the C terminus and a single glycine residue at the N terminus. These two sites are sufficient to ensure covalent linkage between the N and C termini of a protein [8] while still conserving the function to form nanodiscs.
- cNDs particles permit the functional reconstitution of envelope/membrane proteins
- the gp41 transmembrane segment plus the highly conserved membrane proximal region (MPER-TM) of HIV which is an important target for vaccine development, can be incorporated into cNDs and their potential to elicit an immune response and confer immunity to HIV virus challenge investigated.
- MPER-TM membrane proximal region
- the improved stability, homogeneity and bigger sizes of cNDs relative to conventional nanodiscs make them an ideal platform for vaccine development.
- Described herein is the design of polygonal nanodiscs and testing for crystallization.
- a series of constructs can are designed with variable numbers of helices (2-6 helices) between each flexible linker. 2 or 3 helices can be fused together to increase the rigidity ( Figure 5).
- a series of constructs can be based on the amphipathic peptide 18A [9].
- the assembled nanodiscs can be examined by negative stain. After scaling up the production of polygonal nanodiscs, 2D or 3D crystallization can be performed with or without incorporated membrane protein. Stable and well-characterized membrane protein can be used for crystallization trials.
- Bowie JU Stabilizing membrane proteins. Current opinion in structural biology. 2001;11 :397-402.
- Described herein is a process for producing covalently circularized nanodiscs covering a wide range of defined sizes up to 80 nm in diameter and in a variety of geometric shapes. Further described herein is the use of large nanodiscs to address the poorly understood question of how simple non- enveloped viruses translocate their genomes across membranes to initiate infection, and demonstrate the feasibility of using 50 nm nanodiscs to determine the structure of the RNA translocation pore of poliovirus by cryo-electron microscopy.
- Phospholipid bilayer nanodiscs provide a detergent-free lipid bilayer model, enabling biochemical and biophysical characterization of membrane proteins in a physiologically relevant environment 1 .
- a conventional nanodisc is composed of a nanometer-sized phospholipid bilayer patch encircled by two a-helical, amphipathic membrane scaffold proteins (MSPs) 2 ' 3 .
- MSPs are truncated forms of apolipoprotein Al (apoAl), which is the major protein component of high-density lipoprotein.
- apoAl apolipoprotein Al
- the protein constructs described herien contain the consensus sequence recognized by sortase A (LPGTG (SEQ ID NO: 53)) near the C terminus and a single glycine residue at the N terminus (Fig. 2A). These two sites are sufficient to ensure covalent linkage between the N and C termini of a protein 8 while still conserving the function to form nanodiscs.
- sortase A LPGTG (SEQ ID NO: 53)
- the NW11 construct which assembles an 11 nm nanodisc, was used to optimize the circularization over a Cu +2 chip (Fig. 2B).
- the Cu 2+ is saturated with un-circularized NW11 protein prior to evolved sortase 9 addition.
- the circularized NW 11 (cNWl 1) is liberated to the solution and can be further purified via nickel affinity chromatography. Immobilizing NW11 on the Cu 2+ chip for circularization reduces the chances for head-to-tail linkage of two neighboring NW11 molecules and also offers a quick reaction time. Reaction completion was confirmed by SDS-PAGE gel shift (Fig. 2C), and reaction fidelity was confirmed via tandem mass spectrometry (MS/MS) (Fig.
- Circular dichroism (CD) spectroscopy was used to assess the effect of circularization on the thermal stability of lipid-free and lipid-bound cNWl 1.
- cNWl 1 has increased thermostability with an apparent midpoint melting temperature (T m ) of 65.4°C compared to 53.8°C for MSP ID 1.
- T m midpoint melting temperature
- Lipid-bound cNWl 1 demonstrated better stability compared to lipid-bound MSP ID 1 (T m of 90°C vs 84.5°C) (Fig. 12A, 12B).
- VDAC 1 Voltage-Dependent Anion Channel 1
- LDAO micelles The stability of Voltage-Dependent Anion Channel 1 (VDAC 1) in LDAO micelles is increased from 63.8 to 73°C by insertion into MSP 1D 1 nanodiscs, and to 82.2°C when inserted into cNWl 1 nanodiscs (Fig. 12C). Insertion of VDAC 1 into the smaller cNW9 nanodiscs maintains the high T m of 82°C (Fig. 12D) and limits the number of embedded channels to a single one (Fig. 12E) avoiding the previously observed problem of undefined numbers of embedded channels 5 . Furthermore, covalent circularization enhances the proteolytic stability of nanodiscs (Figs. 13A-13D).
- the cNW50 nanodiscs were used as a model to study the question of how simple non-enveloped viruses transfer their genomes across membranes to initiate infection. Unlike enveloped viruses, non-enveloped viruses lack an external membrane, and the delivery of their genome into cells requires translocation across a membrane to gain access to the inside of the host cell u ' 12 . Although there are now several model systems being used to study this process, the mechanism of genome translocation remains poorly understood 13 , and a more detailed structural analysis of the membrane-associated forms of the cell -entry intermediates is required.
- Poliovirus (30 nm diameter) is the prototype member of the enterovirus genus of the picornavirus family, which are positive-sense, single-stranded RNA viruses with ⁇ 7500b genomes enclosed by an icosahedral capsid, and lacking an envelope 14 .
- Viral infection is mediated by a specific receptor, CD155 (also known as the poliovirus receptor, PVR) 15 .
- CD155 also known as the poliovirus receptor, PVR
- PVR poliovirus receptor
- the expanded virus is then endocytosed by a non-canonical, actin-independent pathway 16 , and the RNA is released across the endosomal membrane, leaving an intact empty particle that is then transported to the perinuclear region.
- a 50-nm nanodisc is sufficiently large to accommodate multiple CD155 copies and has enough surface area to act as a surrogate membrane for the RNA-translocation complex during viral uncoating (Fig. 6A). Similar to studies that used liposomes 17"19 , here 50-nm nanodiscs containing lipids derivatized with a NTA nickel-chelating head group were generated and functionalized with the His- tagged CD 155 ectodomain.
- the receptor-decorated nanodiscs were incubated with poliovirus for 5 minutes at 4°C. The complex was then heated to 37°C for 15 minutes to initiate receptor-mediated viral uncoating (Fig. 6B). Negative-stain EM confirmed virus binding to the CD 155-decorated nanodiscs and subsequent insertion of viral components into and across the membrane (Fig. 6C). Additionally, the negative-stain EM images indicated that the virus started to form a pore in the nanodisc. To obtain a view of the molecular interactions involved in the RNA-translocation complex as well as to elucidate in more detail the formation of a pore, cryo-EM studies were conducted using an FEI Polara electron microscope.
- Figure 6D and 13 show the dark RNA-filled virus next to the slightly larger 50 nm nanodisc.
- the nanodisc is tilted in Figure 8E and tethered to the virus in Figure 6F.
- the formation of a putative pore inside the nanodiscs (Fig. 6G, 6H), through which the virus ejects its RNA was visualized.
- the images indicate that the pore is formed by several viral proteins whose number and identities are currently being determined.
- the availability of the circularized 50-nm nanodiscs greatly facilitates imaging as compared to using liposomes because the nanodiscs are more homogenous in size and shape, and allow for the use of a thinner ice layer. Also, RNA can be visualized more easily in the absence of large liposomal membranes.
- cNW30 nanodiscs (15 nm) decorated with CD 155 were used.
- the virus also tethers to this smaller nanodisc (Fig. 61), forms a pore and ejects RNA, leaving an empty viral capsid behind (Fig. 6J).
- the quality of the data collected on the virus- nanodisc complexes represents a vast improvement over data previously used to obtain low-resolution structural models of the translocation complex using the receptor-decorated liposome model 20 , and indicates that the nanodisc model permits determination of structures with greatly improved resolution and quality.
- NW9, NW1 1, NW30 and NW50 (all in pET- 28a) containing a TEV-cleavable N-terminal His6 tag (SEQ ID NO: 54) and a C-terminal sortase- cleavable His6 tag (SEQ ID NO: 54) were transformed into BL21-Gold (DE3) competent E. coli cells (Agilent).
- 3L cell cultures were grown at 37°C, 200 rpm in Luria broth (LB) medium supplemented with 50 ⁇ g/ml Kanamycin, and expression was induced with 1 mM IPTG at an OD600 of 0.8 for 3 hours at 37°C (NW9 and NW11) or 16 hours at 18°C (NW30 and NW50). Cells were harvested by centrifugation (7000xg, 15 minutes, 4°C) and cell pellets were stored at -80°C.
- LB Luria broth
- Kanamycin Luria broth
- the pellets recovered from lysate centrifugation were dissolved in denaturing buffer (50 mM Tris, pH 8.0, 500 mM NaCl, 6M guanidine hydrochloride), centrifuged (35,000xg, 50 minutes, 4°C), and the supernatant was applied to the same Ni2+-NTA column containing bound protein from the soluble fraction.
- the column was washed with denaturing buffer, and NW9 and NW11 were refolded on-column with 10 column volumes (CV) buffer A.
- Resin was then washed with 10 CV of the following: buffer A + 1% Triton X-100, buffer A + 50 mM sodium cholate, buffer A, and buffer A + 20 mM imidazole. Proteins were eluted with buffer A + 500 mM imidazole, TEV (His6-tagged (SEQ ID NO: 54); produced in-house) was added to cleave the N- terminal His6 tag (SEQ ID NO: 54), and the samples were dialyzed against 50 mM Tris-HCl, pH 8.0, 20 mM NaCl, 1 mM EDTA, 2 mM DTT at 4°C for 16 hours.
- TEV His6-tagged (SEQ ID NO: 54); produced in-house) was added to cleave the N- terminal His6 tag (SEQ ID NO: 54)
- NW9 and NW11 (still containing a C-terminal His6 tag (SEQ ID NO: 54)) were exchanged into nanodisc-assembly buffer (50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 0.02% NaN3) using centricon concentrators (10 kDa MW cutoff, Millipore).
- NW30 and NW50 were purified under denaturing conditions and refolded as follows. Pellets of cells expressing NW30 or NW50 were resuspended in denaturing lysis buffer (50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 6M guanidine hydrochloride) and lysed by sonication on ice. Lysate was centrifuged (35000xg, 50 minutes, 4°C) and the supernatant was filtered and loaded onto Ni2+-NTA column.
- denaturing lysis buffer 50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 6M guanidine hydrochloride
- Resin was washed with 10 column volumes (CV) of denaturing lysis buffer to remove unbound proteins, and NW30 and NW50 were refolded on-column with 10 CV buffer A (50 mM Tris HC1, pH 8.0, 500 mM NaCl). Resin was washed with 10 CV of the following: buffer A + 1% Triton X-100, buffer A + 50 mM sodium cholate, buffer A, and buffer A + 20 mM imidazole.
- CV buffer A 50 mM Tris HC1, pH 8.0, 500 mM NaCl
- Proteins were eluted with buffer A + 500 mM imidazole, TEV was added to cleave the N-terminal His6 tag (SEQ ID NO: 54), and samples were dialyzed against 50 mM Tris, pH 8.0, 20 mM NaCl, 1 mM EDTA, 2 mM DTT at 4°C for 16 hours. NW30 and NW50 (still containing a Cterminal His6 tag (SEQ ID NO: 54)) were further purified by size exclusion chromatography (SEC; Superdex 200 16/60 [GE Healthcare] equilibrated in 20 mM Tris-HCl, pH 7.5, 500 mM NaCl, 50 mM sodium cholate, 0.5 mM EDTA).
- SEC fractions containing NW30 and NW50 were further purified over Ni2+-NTA resin to remove truncation products (which lack a C-terminal His6 tag (SEQ ID NO: 54)).
- Purified proteins were exchanged into nanodisc assembly buffer (50 mM Tris HC1, pH 8.0, 500 mM NaCl, 0.02% NaN3) using centricon concentrators (30 kDa MW cutoff, Millipore).
- a 50 mL reaction was prepared with 10 ⁇ NWs and 5 ⁇ (final concentrations) freshly made evolved sortase in 300 mM Tris-HCl, pH 7.5, 150 mM NaCl, and 10 mM CaC12. The reaction was incubated at 4°C for 16 hours or at 25°C for 4 hours with gentle shaking on a rotating platform.
- a covalent sortase inhibitor AAEK2 was added to a concentration of 500 ⁇ , and the solution was incubated further for 30 minutes at room temperature with gentle shaking. Proteins that did not undergo circularization were removed by binding to Ni2+-NTA column.
- Circularized NWs were further purified by size-exclusion chromatography (Superdex 75 16/60) equilibrated in 20 mM Tris HC1, pH 7.5, 500 mM NaCl, 50 mM sodium cholate, 0.5 mM EDTA.
- cNWs lipid ratios of 1 :60, 1 :75, 1 : 1000 and 1 :4000 were used to assemble cNW9, cNWl 1, cNW30, cNW50 nanodiscs respectively.
- Lipids (POPC:POPG 3:2, solubilized in sodium cholate) and cNWs were incubated on ice for 1 hour. After incubation, sodium cholate was removed by the addition of Bio-beads SM-2 (Bio-Rad) and incubation on ice for 1 hour followed by overnight incubation at 4°C.
- the nanodisc preparations were filtered through 0.45- ⁇ nitrocellulose-filter tubes to remove the Bio-beads.
- the nanodisc preparations were further purified by size-exclusion chromatography while monitoring the absorbance at 280 nm on a Superdex 200 10x300 column (for cNW9 and cNWl 1 nanodiscs) or Superose 6 10/300 column (for cNW30 and cNW50 nanodiscs) equilibrated in 20 mM Tris HC1, pH 7.5, 100 mM NaCl, 0.5 mM EDTA. Fractions corresponding to the size of each nanodisc were collected and concentrated. The purity of nanodisc preparations was checked using SDS-PAGE.
- VDAC-1 In vitro reconstitution ofVDAC-1 into POPC/POPG nanodiscs.
- VDAC- 1 In order to assemble VDAC- 1 into POPC/POPG nanodiscs, 15 ⁇ of VDAC-1 (solubilized in LDAO), 150 ⁇ of cNWl 1 and 8.5 mM lipids (POPC:POPG 3 :2, solubilized in sodium cholate) were incubated over ice for 1 hour. After incubation, LDAO and sodium cholate were removed by the addition of Bio-beads SM-2TM (Bio-Rad) and incubation on ice for 1 hour followed by overnight incubation at 4°C.
- Bio-beads SM-2TM Bio-Rad
- the disc preparation was filtered through 0.45- ⁇ nitrocellulosefilter tubes to remove the Bio-beadsTM.
- the sample was mixed with Ni2+-NTA resin for 1 hour at 4°C.
- the resin bed volume was equal to the assembly mixture.
- the resin was washed with buffer E (20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 15 mM imidazole). Nanodiscs containing VDAC were eluted with buffer E containing 0.3 M imidazole.
- the nanodisc preparation was further purified by size-exclusion chromatography while monitoring the absorbance at 280 nm on a Superdex 200 10x300 column (GE Healthcare) with 20 mM Tris-HCl, pH 7.5, 0.1 mM NaCl at 0.5 mL/minute. Fractions corresponding to the size of the VDAC- nanodisc complex were collected and concentrated. The purity of VDAC containing nanodiscs was checked using SDS-PAGE.
- Negative-stain electron microscopy Samples were prepared by conventional negative staining as described previously 21 . Briefly, 3.5 ⁇ of nanodisc samples were adsorbed to carbon-coated copper grids and stained with 0.75% (w/v) uranyl formate. EM images were collected with a Philips CM 10TM electron microscope (FEI) equipped with a tungsten filament and operated at an acceleration voltage of 100 kV. Images were recorded with a Gatan 1 K ⁇ 1 KTM CCD camera (Gatan, Inc.,
- EXAMPLE 4 Covalently Circularized Nanodiscs for Structural and Functional Studies of Membrane Proteins
- the physicochemical environment enveloping a membrane protein in vitro is critical to fully understand the molecular behavior in a biologically relevant context.
- micelles and bicelles have produced significant results, detergents can alter dynamic protein behavior and hinder interactions between a membrane protein and its cytosolic partner(s).
- Conventional nanodiscs are composed of a nanometer-sized phospholipid bilayer encircled by two a helical, amphipathic membrane scaffold proteins (MSPs). These particles provide a unique detergent free lipid bilayer model enabling biochemical and biophysical characterization of membrane proteins in a physiologically relevant medium.
- MSPs amphipathic membrane scaffold proteins
- the MSPs used in a particular nanodisc preparation are the same length, the distribution in diameter of an assembled disc can be broad. This can result in a variable number of membrane proteins incorporating into each disc, and obtaining a sample with a mixed population of membrane proteins per nanodisc that lead to confounding results.
- cMSP circularized MSPs
- Described herein are different methods to covalently link the N and C terminus of an MSP polypeptide using evolved sortase. Sortase reaction fidelity has been confirmed by mass spectrometry of the cMSP polypeptide. The homogeneity in particle diameter was a narrow distribution using negative -stain EM.
- nanodiscs of different sizes up to 100 nm in diameter can be constructed.
- Figs. 2E demonstrates, via negative stain EM, that the circularized nanodiscs described herein are more homogenous than conventional nanodiscs.
- SEQ ID NO: 11 NW30 (assemble ⁇ 30 nm nanodisc) MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
- SEQ ID NO: 22 NW90 (assemble -90 nm nanodisc)
- a loopable membrane scaffold protein was designed based on SEQ ID NO: 2, with the inclusion of substitution mutations at residues 36, 110, and 175 (SEQ ID NO: 62, NW11_3C). SDS- PAGE analysis of the circularized form of this protein is depicted in Fig. 19.
- EXAMPLE 6 A NEW GENERAL-PURPOSE PHOSPHOLAMBAN-BASED SCAFFOLD FOR PEPTIDE IMMUNOGEN CONSTRUCTION
- the methods and compositions described herein relate to antiviral immunology.
- the invention involves the reconstruction of immunogens using the phospholamban (PLN) TM helix as a general stable, low-cost scaffold.
- Potential applications include subunit vaccine construction as well as the production of diagnostic antibodies.
- HIV-1 human immunodeficiency virus
- Env conserved regions of the viral Envelope
- NAbs neutralizing Abs
- MPER membrane proximal external region
- the phospholamban (PLN, Figs. 20A- 20B) transmembrane helix was used as a scaffold for attaching MPER, displaying up to 5 copies per complex on the membrane surface (Figs. 21A-21B).
- the phospholamban (PLN) TM helix provides a stable pentameric TM scaffold that coincidentally share the first three amino acid residues at the beginning of the PLN-TM region "LFI" with the natural TM sequence of HXB2-gp41 immediately following the MPER segment.
- Preliminary negative-stain EM images show that pre-formed 10E8 binds to MPER-PLN chimara incorporated in nanodisc (Figs. 22A-22B).
- immunogenicity data indicate that mice immunized with MPER-PLN chimera elicited antibodies specific to MPER.
- PLN-TM offers the following advantages as a vaccine scaffold:
- Stable pentameric scaffold TM that share the first three amino acid residues with the natural TM sequence of HXB2-gp41 immediately following the MPER segment.
- MPER-PLN chimera (-50 AA) can be synthesized by conventional peptide synthesis techniques as well as expressed in E. coli or other expression systems.
- c. Permits mixing and control of how many MPER arms are present per nanodisc thus control distances between each MPER copy.
- Pore formation can be clearly shown by negative-stain EM that permits verification of incorporation and whether there are aggregations or not.
- the hybrid MPER-PLN can be readily incorporated into nanodisc or liposomes to permit preparation of immunogens.
- SEQ ID NO: 114 Phospholamban transmembrane domain
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Nanotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Mycology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Analytical Chemistry (AREA)
- Medical Informatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Condensed Matter Physics & Semiconductors (AREA)
- General Physics & Mathematics (AREA)
- Manufacturing & Machinery (AREA)
Abstract
Described herein are methods and compositions relating to vaccine components, vaccines, and methods of using the same, e.g. by displaying antigens on a polypeptide scaffold embedded in, e.g., a nanodiscs.
Description
IMMUNOGENIC COMPOSITIONS AND METHODS RELATING THERETO
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application No. 62/363,395 filed July 18, 2016, the contents of which are incorporated herein by reference in their entirety.
GOVERNMENT SUPPORT
[0002] This invention was made with government support under Grant Nos. F32GM113406;
GM047467; GM075879; and AI037581 awarded by the National Institutes of Health. The U.S.
government has certain rights in the invention.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on July 13, 2017, is named 002806-086592-PCT_SL.txt and is 205, 107 bytes in size.
TECHNICAL FIELD
[0004] The technology described herein relates to nanodiscs, proteins used to assemble the nanodiscs, and methods of making nanodiscs.
BACKGROUND
[0005] Small models of the cell membrane can be used to study the structure and behavior of cell membrane proteins, e.g., as part of the development of drugs and/or vaccines. Traditionally, such models were produced by creating micelles or liposomes. Micelles are small spheres which require the use of significant levels of detergents for their creation. These detergents can destabilize and/or inhibit any associated cell membrane proteins, limiting the utility of the micelles. Liposomes do not require detergent use, but tend to aggregate and are irregular in size, making them unsuitable for analysis by crystallization and NMR.
[0006] A more recent development is nanodiscs. Nanodiscs do not contain detergents and are not prone to aggregation. A conventional nanodisc is composed of a nanometer-sized phospholipid bilayer encircled by two copies of a helical, amphipathic membrane scaffold proteins (MSPs) (Denisov et al. J Am Chem Soc. 2004; 126:3477-87 and Bayburt et al. Nano Lett. 2002;2:853-6). These conventional nanodiscs are limited in size from 7-17 nm. In addition to this limited range of possible sizes, the size of each conventional nanodisc in a given preparation tends to vary significantly. This lack of uniformity is undesirable for, e.g., crystillazation and causes variation in the number of membrane proteins found in each individual nanodisc.
SUMMARY
[0007] As described herein, the inventors have found that by circularizing the membrane scaffold protein, it is possible to obtain nanodiscs of up to 100 nm in diameter with extremely high consistency in the size of each individual nanodisc. Additionally, the nanodiscs made with such circularized membrane scaffold proteins can be designed to be either circular or polygonal in shape. The polygonal nanodiscs are of particular interest as they can increase the likelihood of crystallization.
[0008] In one aspect of any of the embodiments, described herein is a loopable membrane scaffold protein comprising, from N-terminus to C-terminus: i) an N-terminal circularization domain; ii) a plurality of amphipathic alpha helix domains; and iii) a C-terminal circularization domain.
[0009] In some embodiments of any of the aspects, one circularization domain comprises: a non- polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and the other circularization domain comprises: a sequence LPXTG/A; wherein X represents any amino acid. In some embodiments of any of the aspects, the N-terminal circularization domain comprises: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and the C-terminal circularization domain comprises: a sequence LPXTG/A; wherein X represents any amino acid. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 glycine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 alanine residues. In some embodiments of any of the aspects, the sequence LPXTG/A is covalently bound to the at least one glycine or alanine residue of (i). In some embodiments of any of the aspects, the sequence LPXTG/A is LPGTG/A (SEQ ID NO: 24); LPSTG/A (SEQ ID NO: 25); LPETG/A (SEQ ID NO: 26).
[0010] In some embodiments of any of the aspects, one circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the other circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein. In some embodiments of any of the aspects, the N-terminal circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the C-terminal circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein. In some embodiments of any of the aspects, at least one intein is flanked by a chitin binding domain (CBD).
[0011] In some embodiments of any of the aspects, each circularization domain comprises a Cys.
[0012] In some embodiments of any of the aspects, the amphipathic alpha helix domain comprises: a) an ApoA-I polypeptide; or b) at least one alpha helical polypeptide with secondary amphipathicity or a
repeat thereof; c) at least one amphipathic proline-rich polypeptide or a repeat thereof; or d) at least one repeat of the sequence XZXPPP; wherein X is any hydrophobic residue and Z is any hydrophilic residue. In some embodiments of any of the aspects, the alpha helical polypeptide has a sequence selected from the group consisting of: DWFKAFYDKLAEKFKEAF (SEQ ID NO: 27);
DFLKAFYDKVAEKFKEAAPDWFKAFYDKVAEKFKEAF (SEQ ID NO: 28):
KLALRLALKAFKAALKLA (SEQ ID NO: 29); RLALDLALRAFKAAWKLA (SEQ ID NO: 30); ELAWDLAFEALDAELKLD (SEQ ID NO: 31); FLKLLKKFLKLFKKLLKLF (SEQ ID NO: 32); WLKLLKKWLKLWKKLLKL (SEQ ID NO: 33); LLKFLKRLLKLLKDLWKLL (SEQ ID NO: 34); WEAAFAEALAEAWAEHLAEALAEAVEALAA (SEQ ID NO: 35);
WEAKLAKALAKALAKHLAKALAKALKACEA (SEQ ID NO: 36);
RAFARALARALKALARALKALAR (SEQ ID NO: 37); GLFEALLELLESLWELLLEA (SEQ ID NO: 38); KLLKLLLKLWKKLLKLLK (SEQ ID NO: 39); DWLKAFYDKVAEKLKEAF (SEQ ID NO: 40); and DWFKAFYDKVAEKFKEAF (SEQ ID NO: 41).
[0013] In some embodiments of any of the aspects, the protein further comprises a cap sequence N- terminal of the N-terminal circularization domain that can be cleaved to expose the N-terminal circularization domain as the N-terminus of the protein. In some embodiments of any of the aspects,the cap sequence comprises as sequence selected from the group consisting of: a) Leu-Val-Pro-Arg-Gly-Ser (SEQ ID NO: 42); and b) Glu-X-Leu-Tyr-< -Gln-(p where X is any residue, Φ is any large or medium hydrophobic residue and φ is glycine or alanine (SEQ ID NO: 43). In some embodiments of any of the aspects, the cap sequence further comprises an affinity purification tag N-terminal of the cleavage site. In some embodiments of any of the aspects, the protein further comprises a His tag flanking one of the circularization domains. In some embodiments of any of the aspects, the His tag is located C-terminal of the C-terminal circularization domain. In some embodiments of any of the aspects, the protein further comprises a linker flanking one of the circularization domains. In some embodiments of any of the aspects, the linker is located C-terminal of the C-terminal circularization domain.
[0014] In some embodiments of any of the aspects,the plurality of amphipathic alpha helix domains are separated by flexible linker sequences. In some embodiments of any of the aspects, the flexible linker sequence is selected from the group consisting of: LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
[0015] In some embodiments of any of the aspects, the protein has the sequence of any of SEQ ID NOs: 1-4 and 6-23.
[0016] In one aspect of any of the embodiments, described herein is a covalently circularized nanodisc comprising: a) a phospholipid bilayer; and b) a looped membrane scaffold protein forming a belt
around the bilayer, wherein the looped membrane scaffold protein comprises: i) an N-terminal circularization domain covalently linked to a C-terminal circularization domain; and ii) a plurality of amphipathic alpha helix domains.
[0017] In some embodiments of any of the aspects, an N-terminal circularization domain covalently linked to a C-terminal circularization domain comprises the sequence LPXT followed by a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; wherein X represents any amino acid. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 glycine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 alanine residues. In some embodiments of any of the aspects, the sequence LPXT is LPGT (SEQ ID NO: 48); LPST (SEQ ID NO: 49); or LPET (SEQ ID NO: 50).
[0018] In some embodiments of any of the aspects, the N-terminal circularization domain covalently linked to a C-terminal circularization domain is a cysteine residue.
[0019] In some embodiments of any of the aspects, the diameter is greater than about 6 nm. In some embodiments of any of the aspects, the diameter is greater than about 15 nm. In some embodiments of any of the aspects, the diameter is greater than about 50 nm. In some embodiments of any of the aspects, the diameter is about 80 nm.
[0020] In one aspect of any of the embodiments, described herein is a method of making a nanodisc as described herein, the method comprising: contacting the loopable membrane scaffold protein described herein with a sortase enzyme; and contacting the looped protein produced in step (a) with solubilized phospholipids. In some embodiments of any of the aspects, the sortase is selected from the group consisting of: Staphylococcus aureus wild type sortase A (Srt A); evolved sortase; eSrtA; eSrtA(2A-9); eSrtA(4S-9); and Streptococcus pyogenes sortase A. In some embodiments of any of the aspects, the contacting step is stopped by quenching the reaction with a sortase inhibitor. In some embodiments of any of the aspects, the sortase inhibitor is AAEK2 or high concentrations of EDTA. In some
embodiments of any of the aspects, the sortase is bound to a substrate. In some embodiments of any of the aspects, the sortase further comprises a His tag.
[0021] In one aspect of any of the embodiments, described herein is a method of making a nanodisc as described herein, the method comprising: a) contacting the loopable membrane scaffold protein described herein with a solution having a pH low enough to induce cleavage of the dipeptide sequence of Asn-Cys; and a thiol reagent to induce cleavage at the Cys residue, resulting in circularization of the
protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids. In some embodiments of any of the aspects, the thiol reagent is DTT.
[0022] In one aspect of any of the embodiments, described herein is a method of making a nanodisc as described herein, the method comprising a) contacting the loopable membrane scaffold protein described herein with a thiol reagent, resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids.
[0023] In some embodiments of any of the aspects, the phospholipids are solubilized in detergent. In some embodiments of any of the aspects, step (b) occurs at a temperature of from about 0 C to about 42 C. In some embodiments of any of the aspects, step (b) occurs at a temperature of from about 0 C to about 37 C. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2000 to about 1 :5000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3500 to about 1 :4500; and circular nanodiscs are formed. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :4000; and circular nanodiscs are formed. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to
phospholipids is from about 1 :2500 to about 1 :3700; and non-circular nanodiscs are formed. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3100 to about 1 :3400; and non-circular nanodiscs are formed.
[0024] In some embodiments of any of the aspects, the protein further comprises a cap sequence N- terminal of the N-terminal circularization domain and the method comprises a first step of contacting the protein with an enzyme to cleave the cap sequence. In some embodiments of any of the aspects, the protein further comprises a C-terminal His tag and the method comprises a first step of binding the protein to a substrate. In some embodiments of any of the aspects, the substrate comprises Cu2+, Ni2+ or Co2+. In some embodiments of any of the aspects, the substrate is a chip or bead. In some embodiments of any of the aspects, the substrate is a bead and step (a) is performed in the presence of phospholipids. In some embodiments of any of the aspects, the substrate is a bead and the steps (a) and (b) are performed concurrently. In some embodiments of any of the aspects, the method further comprises, after step (a), a step of eluting the looped protein produced in step (a) from the substrate.
[0025] In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of less than 100 uM prior to the contacting step. In some embodiments of any of the aspects, the looped protein formed in step (a) is passed through a column, substrate, and/or solution comprising Cu2+, Co2+ or Ni2+.
[0026] In one aspect of any of the embodiments, described herein is a vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof. In some embodiments of any of the aspects, the single a-helix transmembrane protein is selected from the group consisting of phospholamban; influenza M2 channel protein; stannin; Vpu; HIV Vpu; parainfluenza 5 fusion protein; parainfluenza fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH. In some embodiments of any of the aspects, the transmembrane domain is the sequence of one of SEQ ID NOs: 95-101, 113, or 114. In some embodiments of any of the aspects, the variant of the transmembrane domain is a sequence with at least 90% homology to one of SEQ ID NO: 95-101, 113 or 114.
[0027] In one aspect of any of the embodiments, described herein is an immunogenic conjugate polypeptide comprising: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein. In some embodiments of any of the aspects, the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide. In some embodiments of any of the aspects, the antigen polypeptide is conjugated to the C-terminus of the vaccine scaffold polypeptide.
[0028] In some embodiments of any of the aspects, the antigen polypeptide is a viral envelope protein, a cell surface protein, or portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is an HIV protein or portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is the membrane proximal external region (MPER) of Env. In some embodiments of any of the aspects, the antigen polypeptide is the 10E8 epitope or the 4E10 epitope.
[0029] In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple repeats of the same antigen polypeptide. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple different antigen polypeptides. In some embodiments of any of the aspects, the antigen polypeptides or repeats thereof are separated by a linker.
[0030] In some embodiments of any of the aspects, the immunogenic polypeptide comprises from 1 to 5 copies of the antigen polypeptide. In some embodiments of any of the aspects, the antigen polypeptide and the vaccine scaffold polypeptide are joined by a linker.
[0031] In some embodiments of any of the aspects, the linker is hydrophobic. In some embodiments of any of the aspects,the linker is hydrophilic. In some embodiments of any of the aspects, the linker is from 1 to 5 amino acids in length.
[0032] In one aspect of any of the embodiments, described herein is a nucleic acid encoding a vaccine scaffold polypeptide or an immunogenic conjugate polypeptide as described herein. In one aspect of any of the embodiments, described herein is a polypeptide complex comprising a polymeric complex of a vaccine scaffold polypeptide and/or an immunogenic conjugate polypeptide as described herein.
[0033] In one aspect of any of the embodiments, described herein is a composition comprising a polypeptide complex and/or immunogenic conjugate polypeptide as described herein embedded in the phospholipid bilayer of a liposome or nanodisc. In some embodiments of any of the aspects, the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid. In some embodiments of any of the aspects, the phospholipid bilayer comprises cholesterol. In some embodiments of any of the aspects, each liposome or nanodisc comprises 10 or fewer copies of the antigen polypeptide. In some embodiments of any of the aspects, each liposome or nanodisc comprises 5 or fewer copies of the antigen polypeptide.
[0034] In one aspect of any of the embodiments, described herein is a pharmaceutical composition comprising a polypeptide complex and/or immunogenic conjugate polypeptide as described herein embedded in the phospholipid bilayer of a liposome or nanodisc and a pharmaceutically acceptable carrier. In some embodiments of any of the aspects, the pharmaceutical composition further comprises an adjuvant.
[0035] In one aspect of any of the embodiments, described herein is a method of inducing an immune response in a subject, the method comprising administering to the subject a composition comprising a polypeptide complex and/or immunogenic conjugate polypeptide as described herein embedded in the phospholipid bilayer of a liposome or nanodisc. In some embodiments of any of the aspects, the immune response comprises immunization. In some embodiments of any of the aspects, the subject is further administered an adjuvant. In some embodiments of any of the aspects, the compositions is admixed with the adjuvant prior to administration. In some embodiments of any of the aspects, the administration is a prime administration and/or a boost administration. In some embodiments of any of the aspects, the subject is further administered a second vaccine. In some embodiments of any of the aspects, the method further comprises a step of isolating from the subject:
a. an antibody that specifically binds to the antigen polypeptide;
b. a nucleic acid encoding an antibody that specifically binds to the antigen polypeptide; or c. a cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide.
BRIEF DESCRIPTION OF THE DRAWINGS
[0036] Fig. 1 depicts a schematic representation of a nanodisc.
[0037] Figs. 2A-2E depict schematics of the production of covalently circularized MSP and nanodiscs. Fig. 2A depicts a general outline of the constructs that are used for making covalently circularized nanodiscs. Constructs containing a sortase A recognition sequence (LPXTG (SEQ ID NO:
51)) and N-terminal glycine can undergo circularization (intramolecular transpeptidation) after exposing the N-terminal glycine and incubating with evolved sortase. Fig. 2A discloses "HHHHHH" as SEQ ID NO: 54. Fig. 2B depicts an outline of the procedure for creating circularized proteins over a Cu+2 chip. Fig. 2B discloses "GSTFSKL" as SEQ ID NO: 80, "KLNTQLPGTAAALEHHHHHH" as SEQ ID NO: 81, "KLNTQLPGTGSTFSKLR" as SEQ ID NO: 82 and "AALEHHHHHH" as SEQ ID NO: 83. Fig. 2C shows SDS-PAGE analysis of NW11 before (lane 1) and after (lane 2) circularization. Fig. 2C discloses "LPXTG" as SEQ ID NO: 51 and "HHHHHH" as SEQ ID NO: 54. Fig. 2D depicts MS/MS spectrum of a tryptic peptide of cNWl 1 confirming the ligation of the N-terminal residues (GSTFSK (SEQ ID NO: 52)) to the C-terminal LPGTG motif (SEQ ID NO: 53). The b and y ions that were identified in the MS/MS spectrum are highlighted in blue and red. Fig. 2D discloses "KLNTQLPGTGSTFSK" as SEQ ID NO: 84. Fig. 2E depicts the diameter distribution for nanodiscs made using linear MSP (top) and circularized MSP (bottom) and their representative negative stain images. Fig. 2E discloses "NTQLPGTAA" as SEQ ID NO: 85 and "NTQLPGTGST" as SEQ ID NO: 86.
[0038] Figs 3A-3C demonstrate the production of large covalently circularized nanodiscs. Fig. 3 A demonstrate SDS-PAGE analysis of NW30 before and after circularization. The circularized NW30 migrates slower than the linear form. Right: negative-stain EM analysis of the nanodiscs made using circularized NW30 (cNW30) shows the formation of -15 nm nanodiscs. Fig. 3B demonstrate SDS- PAGE analysis of NW50 before and after circularization. Right: negative -stain EM analysis of the nanodiscs made using circularized NW50 (cNW50) shows the formation of -50 nm nanodiscs. Bottom: cryo-EM images for individual nanodiscs showing top and side views. Fig. 3C depicts negative stain images showing single nanodisc particles with increasing sizes as indicated.
[0039] Fig. 4A depicts cryo-EM images of individual nanodiscs with different shapes. Fig. 4B depicts potential molecular arrangements of scaffold protein molecules in the different shaped nanodiscs. Fig. 4C depicts possible crystal packing of nanodiscs with the corresponding shapes. The triangular, square and hexagonal shapes should, in principle, provide better crystal packing than pentagonal or circular ones. Fig. 4D shows that each triangular disc is made of 3 copies of amphipathic protein that are connected together with a long flexible loop.
[0040] Fig. 5 depicts a schematic of the strategy for making polygonal nanodiscs and and the associated scaffold proteins. Fig. 5 discloses "LPXTG" as SEQ ID NO: 51 and "HHHHHH" as SEQ ID NO: 54.
[0041] Figs. 6A-6J depict poliovirus caught in the act. Fig. 6A depicts negative -stain EM of 50-nm circularized nanodiscs plus poliovirus. A control (nanodiscs without CD155) is shown to illustrate the relative dimensions of the 30-nm poliovirus and the 50-nm nanodisc. Fig. 6B depicts an outline of the
procedure used to initiate poliovirus bridging and fusion with nanodiscs decorated with CD 155. Fig. 6C depicts negative-stain EM images showing individual viruses tethered to nanodiscs. Fig. 6D depicts cryo- EM image of 50-nm nanodiscs plus poliovirus. Fig. 6E depicts cryo-EM image showing a tilted view of 50-nm nanodisc. Fig. 6F depicts cryo-EM images showing individual viruses tethered to nanodiscs. Fig. 6G-6H depict cryo-EM images showing the creation of a putative pore in the nanodisc by the poliovirus. Fig. 61 depicts cryo-EM image showing three viral particles around a 15-nm nanodisc. Fig. 6 J depicts cryo-EM image showing individual viruses ejecting RNA after incubation with CD155-decorated 15-nm nanodiscs.
[0042] Figs 7A-7D demonstrate the analysis of VDAC-1 in different size nanodiscs. Fig. 7A depicts 2D-[1H, 15N]-TROSY spectrum of 2H,15N-labeled VDAC-1 in cNW9 nanodiscs. Fig. 7B depicts representative image of negatively stained cNW9 nanodiscs containing single VDAC-1 channel. The stain-filled channels appear as dark spot inside the nanodisc. Right: SDS-PAGE analysis of cNW9 nanodiscs containing VDAC-1. Fig. 7C depicts 2D-[¾ 15N]-TROSY spectrum of 2H,15N-labeled VDAC- 1 in cNWl 1 nanodiscs. Fig. 7D depicts representative image of negatively stained cNWl 1 nanodiscs containing VDAC-1 channels. Each nanodisc appear to contain 2 channels. Right: SDS-PAGE analysis of cNWl 1 nanodiscs containing VDAC-1.
[0043] Fig. 8 depicts a schematic outline of the procedure for creating circularized NW proteins over Cu+2 chip. His6- tagged NWs ("His6" disclosed as SEQ ID NO: 54) is attached to Cu+2 chip. Addition of His6-tagged evolved sortase ("His6" disclosed as SEQ ID NO: 54) creates circularized non- His tagged NW (cNW), which can be eluted while cleaved His6- tagged products ("His6" disclosed as SEQ ID NO: 54) and evolved sortase remain bound to the Cu+2 chip. The eluted cMSP is passed through Ni column to get rid of any traces of His6- tagged products ("His6" disclosed as SEQ ID NO: 54) and evolved sortase. Fig. 8 discloses "GSTFSKL" as SEQ ID NO: 80, "KLNTQLPGTAAALEHHHHHH" as SEQ ID NO: 81, "AALEHHHHHH" as SEQ ID NO: 83 and "LEEYTKKLNTQLPGTGSTFSKLREQL" as SEQ ID NO: 87.
[0044] Fig. 9A depicts a schematic of circularization of NW proteins over Ni2+ beads. His6- tagged linear NW ("His6" disclosed as SEQ ID NO: 54) is attached to Ni-beads followed by adding lipids to NW. Addition of lipids to NW helps to bring the C and N terminal ends close so the circularization pathway will dominate. Adding His6-tagged sortase ("His6" disclosed as SEQ ID NO: 54) creates circularized non- tagged NW (cNW), which can be eluted while cleaved His6- tagegd cleavage product ("His6" disclosed as SEQ ID NO: 54) and sortase remain bound to the beads. Fig. 9A discloses
"KLNTQLPGTGSTFSK" as SEQ ID NO: 84. Fig. 9B SDS-PAGE gel showing the final products after circularization over Ni beads with or without lipids.
[0045] Fig. 10 depicts a schematic outline of the procedure for creating circularized NW in solution. His6- tagged linear NW ("His6" disclosed as SEQ ID NO: 54) is diluted before adding sortase to favor the circularization. Adding the sortase covalent inhibitor AAEK2 quenches the reaction.
[0046] Fig. 11 depicts a schematic of adding evolved sortase to concentrated NW11 solution in order to multimerize NW11, followed by circularization. The oligomeric, circularized species containing variable numbers of NW11 assemble into nanodiscs of various sizes. Bottom: Negative-stain EM image showing large nanodiscs made using oligomeric, circularized NW11. Scale bar represents 100 nm. Fig. 11 discloses
"LEEKLNTQLPXTGSTFSKLRELEEKLNTQLPXTGSTFSKLRELEEKLNTQLPXTGSTFSKLRE" as SEQ ID NO: 88 and "LEEYTKKLNTQLPGTGSTFSKLRELEEKLNTQLPGTGSTFSKLRE" as SEQ ID NO: 89.
[0047] Figs. 12A-12E demonstrate that covalent circularization stabilizes MSPs against thermal unfolding without and with lipids, stabilizes embedded VDAC1 and allows control of the number of channels embedded. Thermal unfolding of MSP1D1 and cNWl l without (Fig. 12A) and with lipids (Fig. 12B) followed by circular dichroism (CD) spectroscopy at 222 nm, the wavelength most characteristic of helical secondary structure. POPC/POPG lipids at a molar ratio of 3:2 were used to generate nanodiscs. Fig. 12C demonstrates that placement in MSP ID 1 nanodiscs increases the melting temperature of VDAC1 by 9.2 degrees over that of VDAC1 in an LDAO micelle environment, and covalent
circularization of the scaffold protein (cNWl 1) raises Tm by additional 9.2 degrees. Thermal unfolding of human VDAC-1 was followed by CD spectroscopy at 218 nm, the wavelength most characteristic of β- sheet secondary structure. Orange: VDAC1 in 0.1% LDAO. Depicted are VDAC1 reconstituted into conventional nanodiscs (assembled using MSP ID 1), and VDAC1 reconstituted into circularized nanodiscs (assembled using cNWl 1). Nanodiscs were made with POPC/POPG 3:2 lipids. Fig. 12D depicts thermal unfolding of VDAC 1 reconstituted into circularized nanodiscs (assembled using cNW9) followed by CD spectroscopy at 218 nm. Nanodiscs were made with POPC/POPG lipids at a molar ratio of 3:2. All samples were in 20 mM Tris-HCl, pH 7.5, 100 mM NaCl. Fig. 12E depicts analysis of the VDAC1 nanodisc assembly reaction. Top: size-exclusion chromatography and negative-stain EM of VDAC1 in cNW9 nanodiscs. Negative-stain image shows nanodiscs containing a single channel. The stain-filled channels appear as dark spots inside nanodiscs. Bottom: SDS-PAGE analysis of the nanodisc assembly. Fractions 1-6 were collected and analyzed.
[0048] Figs. 13A-13D demonstrate that covalent circularization stabilizes MSPs against digestion by V8 protease without and with lipids. Figs. 13A-13B depict SDS-PAGE analysis of the proteolysis of lipid-free MSPAH5 and cNW9. Samples were treated with V8 protease for 0 min (before addition of V8),
and for 1, 3 and 18 hours. Lanes are labeled with times of protease treatment. Proteolysis was performed in 20 mM Tris-HCl, pH 7.5, 100 mM NaCl at 37°C and using a proteimprotease ratio (w/w) of 1000: 1. Treatment of MSPAH5 with V8 resulted in the appearance of a large peptide, which is close in size to MSPAH5 and is not discernible until about 18 hours after addition of V8; this peptide may be generated earlier but is not visible due to the low amount or overlap with uncleaved MSPAH5. The intensity of the MSPAH5 band decreased by 75% after 3 hours and by 93% after 18 hours. On the other hand, the intensity of the cNW9 band decreased by only 20% after 18 hours. A band that corresponds to linearized NW9 was observed after 3 hours and increased in intensity after 18 hours. Figs. 13C-13D depict SDS- PAGE analysis of the proteolysis of nanodiscs assembled with MSPAH5 and cNW9. Samples were treated with V8 protease for 0 min (before addition of V8), and for 20 min, 1, 3 and 18 hours. Proteolysis was performed at 37°C at pH 7.5 in 20 mM Tris-HCl, 100 mM NaCl using a 100: 1 proteimprotease (w/w). The band intensity of MSPAH5 decreased by 81% after 3 hours. There were no decreases in cNW9 band intensity up to 3 hours. ImageJ™ software was for analyzing band intensities.
[0049] Fig. 14 depicts characterization of cNW9 by MS/MS confirms the ligation of the C terminus to the N terminus. MS/MS spectrum of a tryptic fragment of cNW9 (SEQ ID NO: 91) showing the ligation of the C-terminal motif (LNTQLPGTG-His6 (SEQ ID NO: 55)) to the N-terminal residues (GSTFSK (SEQ ID NO: 52)). Expected masses for b and y ions along with the peptide sequence are listed in the table (SEQ ID NO: 91). The b and y ions that were identified in the MS/MS spectrum are highlighted. The full amino acid sequence of linear NW9 is shown at the top (SEQ ID NO: 90).
[0050] Fig. 15 depicts characterization of cNW30 by MS/MS confirms the ligation of the C terminus to the N terminus. MS/MS spectrum of a tryptic fragment of cNW30 (SEQ ID NO: 91) showing the ligation of the C-terminal motif (LNTQLPGTG-His6 (SEQ ID NO: 55)) to the Nterminal residues (GSTFSK (SEQ ID NO: 52)). Expected masses for b and y ions along with the peptide sequence are listed in the table (SEQ ID NO: 91). The b and y ions that were identified in the MS/MS spectrum are highlighted in. The full amino acid sequence of linear NW30 is shown at the top (SEQ ID NO: 92).
[0051] Fig. 16 depicts characterization of cNW50 by MS/MS. Spectrum of a tryptic fragment of cNW50 (SEQ ID NO: 91) showing the ligation of the C-terminal motif (LNTQLPGTG-His6 (SEQ ID NO: 55)) to the N-terminal residues (GSTFSK (SEQ ID NO: 52)). Expected masses for b and y ions along with the peptide sequence are listed in the table (SEQ ID NO: 91). The b and y ions that were positively identified in the MS/MS spectrum are highlighted. The amino acid sequence of linear NW50 (after TEV cleavage) is shown at the top (SEQ ID NO: 93).
[0052] Fig. 17 depict a diagram illustrating the production of circularized proteins or poly peptides using the two-intein system. The intein has a chitin binding domain (CBD) which allows it to bind to
chitin beads. The protein splicing of the inteins is then induced by adding DTT and changing the pH. The target protein then released from the chitin bound intein. The exposed N and C termini of the released protein interact together and result in the circularization of the protein.
[0053] Fig. 18 depicts chemically mediated ligation of scaffold proteins.
[0054] Fig. 19 depicts SDS-PAGE analysis of NW9 3C before (lane 1) and after covalent circularization (lane 2).
[0055] Figs 20A-20B depict phospholamban. Fig. 20A depicts the structure of phospholamban (PDB # 1ZLL). Fig. 20B depicts the primary amino acid sequence of phospholamban from different species.
[0056] Figs. 21A-21B depict models of PLN nanodisc structures. Fig. 21A depicts a cartoon of MPEPv-Phospholamban (PLN)-TM hybrid in bilayer. Fig. 2 IB depicts MPER-Phospholamban hybrids displaying different number of MPER copies per complex.
[0057] Figs. 22A-22B depict an EM study of MPER-Phospholamban (PLN)-TM hybrid in complex with 10E8 Fab. Fig. 22A demonstrates that negative stain EM reveals multiple arms of 10E8 per complex. Fig. 22B depicts a cartoon for MPER-Phospholamban (PLN)-TM hybrid in complex with 10E8 Fab.
[0058] Figs. 23A-23C demonstrate MPER-Phospholamban (PLN)-TM intereactions with antibodies. Fig. 23A depicts 2d class averages of MPER-Phospholamban (PLN)-TM hybrid in complex with 10E8 Fab. Fig. 23B depicts low resolution 3D reconstruction of the complex based on the negative-stain data. Fig. 23C depicts a cartoon of the interaction.
[0059] Fig. 24 depicts a schematic illustration of an example of strategy to produce immunogens incorporated in a nanodisc.
[0060] Figs. 25A-25B depict a schematic illustration of an example of strategy to produce trimer immunogen in nanodisc according to one embodiment of the present invention. gp l40 could be covalently linked to MPER-PLB after (Fig. 25A) or before (Fig. 25B) incorporation into nanodisc.
[0061] Figs. 26A-26C depict a schematic illustration of an example of strategy to produce DNA immunogen comprises a DNA Duplex scaffold covalently linked to N terminus of MPER-phospholamban transmembrane fusion protein or 10E8 -phospholamban transmembrane fusion protein. DNA scaffold can be covalently linked to MPER-PLB after (Fig. 26A) or before (Fig. 26B) incorporation into nanodisc. (Fig. 26C) some duplex DNA designs that can be used for modifying 2, 3 or 5 MPER-PLB arms.
[0062] Fig. 27 demonstrates that a strong MPER-specific antibody response is generated to nanodisc delivered MPER-immunogen. MPER-peptide quantification by ELISA. Immulon IB plates were pre- coated with streptavidin followed by washing, blocking and binding of biotinylated MPER-peptide.
Serially diluted sera collected 19 days following a third and final immunization were tested against naive mouse sera. Immunized mice received membrane presented MPER-phospholamban fusion protein displayed on nanodiscs (lOOug of MPER-phospholamban:nanodisc per mouse). Mice were immunized three times at 3 -week intervals via subcutaneous tail-base injection in conjunction with 5ug/mouse CDN adjuvant-loaded liposomes. Non-circularized (open circles) and circularized (filled circles) MSP nanodiscs result in identical IgG antibody titers. No MPER-specific IgG antibodies are detected in any naive (filled circle; dashed line) mice. Symbols represent mean with SEM shown. N=4 female BALB/c mice; 8 weeks old at time of primary immunization.
[0063] Fig. 28 demonstrates the immunogenicity of MPER-phospholamban
transmembrane/nanodiscs. MPER- and human MSP-specific antibodies titer were measured by ELISA (left panel). 96 well plates were coated with MPER-phospholamban transmembrane in nanodisc
(PLMPER/nanodiscs), empty nanodiscs made with human MSP (hMSP) or biotin-MPER, respectively. Right panel shows the frequency of MPER-specific bone marrow (BM) plasma cells at day 10 after the second immunization. Numbers of MPER-binding antibody-forming cells (AFCs) were determined by ELISPOT using liposomes containing MPER-TM, MPER-N (E662-T676) or MPER-C (A667-K683) as the capture antigen. When nanodiscs containing MPER-Phospholamban were administered to mice, high titer immune responses specific to both MPER and human MSP, the membrane scaffold protein that wrap around nanodisc, were generated after two immunizations (left panel)
DETAILED DESCRIPTION
[0064] The inventors have discovered methods of making nanodisc which permit previously unachievable sizes, uniformity, and geometry. This new approach to nanodisc construction involves the use of circularized membrane scaffold proteins, as opposed to the linear membrane scaffold proteins previously described. Provided herein are loopable membrane scaffold proteins, nanodiscs comprising such proteins, and methods of producing these nanodiscs. Further described herein are methods and compositions relating to the presentation of antigens on nanodics and/or liposome.
[0065] In one aspect, described herein is a vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof. In some embodiments of any of the aspects, the vaccine scaffold polypeptide consists of the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof. In some embodiments of any of the aspects, the vaccine scaffold polypeptide consists essentially of the transmembrane domain of a single a-helix transmembrane protein or a variant thereof.
[0066] In some embodiments of any of the aspects, a polypeptide described herein is engineered.
[0067] As used herein "single a-helix transmembrane protein" refers to a naturally-ocurring protein which comprises one a-helix transmembrane domain. A single a-helix transmembrane protein can exist in situ as a monomer or a multimer. Single a-helix transmembrane proteins are well known in the art and can be readily identified, e.g., by structure and/or annotation searches of protein and sequence databases. Non-limiting examples of suitable single a-helix transmembrane protein can include phospholamban; influenza M2 channel; stannin; Vpu; HIV Vpu; parainfluenza fusion protein; parainfluenza 5 fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH.
[0068] As used herein "phospholamban" refers to a single a-helix transmembrane protein that forms a homopentameric integral membrane protein complex to regulate the Ca2+ pump. Sequences for phospholamban are known for a number of species, including, e.g., human (NCBI Gene ID: 5350) (mRNA, NCBI Seq Ref: NM_002667.4) (polypeptide, NCBI Ref Seq: NP_002658.1). In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of phospholamban. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of phospholamban. In some embodiments of any of the aspects, the transmembrane domain of phospholamban can be the portion of the sequence of a phospholamban corresponding to SEQ ID NO: 1 13 or 1 14. In some embodiments of any of the aspects, the transmembrane domain of phospholamban can be the sequence of SEQ ID NO: 1 13 or 1 14.
[0069] As used herein, the influenza "M2 channel protein" or "matrix-2 (M2) protein" refers to a single a-helix transmembrane protein that forms a homotetramer ion channel in the viral envelop of influenza A. Tetramers comprising the transmembrane domain of M2 channel protein display a structure which widens right before the cytoplasmic side of the plasma membrane, permitting antigenic polypeptides to be spread more widely on the membrane surface. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of M2 channel protein. Sequences for M2 channel protein are known, e.g., (NCBI Gene ID: 956528 and 3655107) (polypeptide, NCBI Ref Seq: NP_040979.2 or YP_308853.1). In some embodiments of any of the aspects, the transmembrane domain of M2 channel protein can be the portion of the sequence of a M2 channel protein corresponding to SEQ ID NO: 95 or 96. In some embodiments of any of the aspects, the transmembrane domain of M2 channel protein can be the sequence of SEQ ID NO: 95 or 96.
SEQ ID NO: 95
LAIAA NIIGILHLIL WILDRL
SEQ ID NO: 96
LVVAA SIIGILHFIL WILDRL
[0070] As used herein, "stannin" refers to a single a-helix transmembrane protein that forms monomers which cross the plasma membrane at approximately a 20° angle. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of stannin. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N- terminus of the transmembrane domain of stannin. Sequences for stannin are known, e.g., human stannin (NCBI Gene ID: 51061) (polypeptide, NCBI Ref Seq: NP 001290376.1, NP 001310951.1,
NP_001310953.1, NP_001310954.1, and NP_056998.4) (mRNA, NCBI Ref Seq: NM 001303447.1, NM_001324022.1 , NM_001324024.1 , NM_001324025.1 , and NM_015914.6). In some embodiments of any of the aspects, the transmembrane domain of stannin can be the portion of the sequence of a stannin corresponding to SEQ ID NO: 97. In some embodiments of any of the aspects, the transmembrane domain of stannin can be the sequence of SEQ ID NO: 97.
SEQ ID NO: 97
TGVVTVIVILIAIAALGALILGCW
[0071] As used herein, "Vpu" or "viral protein U" refers to a single a-helix transmembrane protein that forms pentameric ion channels which are wider at the C-terminus than the N-terminus. In some embodiments of any of the aspects, a Vpu can be an HIV Vpu. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of Vpu, e.g., HIV Vpu. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of Vpu, e.g, HIV Vpu. Sequences for Vpu are known, e.g., HIV Vpu (NCBI Gene ID: 155945) (polypeptide, NCBI Ref Seq: NP 057855.1). In some embodiments of any of the aspects, the transmembrane domain of Vpu can be the portion of the sequence of a Vpu corresponding to SEQ ID NO: 98. In some embodiments of any of the aspects, the transmembrane domain of Vpu can be the sequence of SEQ ID NO: 98.
SEQ ID NO: 98
IVAIV ALVVAIIIAI VVWSIVIIEY
[0072] As used herein, a "parainfluenza fusion protein" refers to a single a-helix transmembrane protein that forms trimeric complexes. In some embodiments of any of the aspects, the parainfluenza fusion protein can be a parainfluenza 5 fusion protein. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus
of the transmembrane domain of a fusion protein, e.g., parainfluenza 5 fusion protein. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of a fusion protein, e.g., parainfluenza 5 fusion protein. Sequences for fusion proteins are known, e.g., parainfluenza 5 fusion protein (NCBI Gene ID: 3160801) (polypeptide, NCBI Ref Seq: YP 138515.1). In some embodiments of any of the aspects, the transmembrane domain of a parainfluenza fusion protein can be the portion of the sequence of a parainfluenza fusion protein corresponding to SEQ ID NO: 99. In some embodiments of any of the aspects, the transmembrane domain of a parainfluenza fusion protein can be the sequence of SEQ ID NO: 99.
SEQ ID NO: 99
VLSIIA ICLGSLGLIL IILLSVVVWK LLTIVVA
[0073] As used herein, a "SH" or "Small Hydrophobic" protein refers to a single a-helix
transmembrane protein that forms pentameric complexes. In some embodiments of any of the aspects, the SH protein can be a Respiratory syncytial virus (RSV) SH protein. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of a SH protein, e.g., RSV SH. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N-terminus of the transmembrane domain of a SH protein, e.g., RSV SH. Sequences for SH proteins are known, e.g., RSV SH (NCBI Gene ID: 1494473) (polypeptide, NCBI Ref Seq: NP_044594.1). In some embodiments of any of the aspects, the transmembrane domain of a SH protein can be the portion of the sequence of a SH protein corresponding to SEQ ID NO: 100. In some embodiments of any of the aspects, the transmembrane domain of a SH protein can be the sequence of SEQ ID NO: 100.
SEQ ID NO: 100
HMITTIISL LIIISIMIAI L
[0074] As used herein, a "E" or "Envelope small membrane" protein refers to a single a-helix transmembrane protein that forms pentameric complexes. In some embodiments of any of the aspects, the E protein can be a SARS-Cov E protein. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the C-terminus of the transmembrane domain of an E protein, e.g., SARS-Cov E. In some embodiments of any of the aspects, an immunogenic conjugate polypeptide can comprise an antigenic polypeptide conjugated to the N- terminus of the transmembrane domain of an E protein, e.g., SARS-Cov E. Sequences for E proteins are known, e.g., SARS-Cov E (NCBI Gene ID: 1489671) (polypeptide, NCBI Ref Seq: NP_828854.1). In some embodiments of any of the aspects, the transmembrane domain of an E protein can be the portion of
the sequence of an E protein corresponding to SEQ ID NO: 101. In some embodiments of any of the aspects, the transmembrane domain of an E protein can be the sequence of SEQ ID NO: 101.
SEQ ID NO: 101
NSVLLF LAFVVFLLVT LAILTALRL
[0075] In some embodiments of any of the aspects, the vaccine scaffold polypeptide is less than 60 amino acids in length. In some embodiments of any of the aspects, the vaccine scaffold polypeptide is less than 50 amino acids in length. In some embodiments of any of the aspects, the vaccine scaffold polypeptide is less than 40 amino acids in length.
[0076] As used herein, the term "transmembrane domain" refers to a a portion, part, or polypeptide sequence of a protein which forms an a-helix with a least one hydrophobic face. The transmembrane domain can target and/or anchor a translated polypeptide comprising the transmembrane domain to the plasma membrane of a host cell. The transmembrane domains of a given polypeptide sequence can be predicted and/or identified with any of various computer programs designed to analyze polypeptide sequences, or by consulting the annotation found in various publically -available databases, e.g., NCBI or PDB.
[0077] In some embodiments of any of the aspects, the transmembrane domain of phospholamban is the sequence of SEQ ID NO: 113 or 114. In some embodiments of any of the aspects, a variant of the transmembrane domain of phospholamban is a sequence with at least 90% homology to SEQ ID NO: 113 or 114. A variant of a given transmembrane domain can include sequences in which cysteine residues are substituted with another residue, e.g, serine. Such substitutions can improve the ease with which the vaccine scaffold polypeptide can be manipulated.
[0078] In one aspect of any of the embodiments, described herein is an immunogenic conjugate polypeptide comprising: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein. In one aspect of any of the embodiments, described herein is an immunogenic conjugate polypeptide comprising: a) at least one antigen polypeptide conjugated to; b) a transmembrane domain of a single a-helix transmembrane protein. In one aspect of any of the embodiments, described herein is an immunogenic conjugate polypeptide consisting essentially of: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein. In one aspect of any of the embodiments, described herein is an immunogenic conjugate polypeptide consisting essentially of: a) at least one antigen polypeptide conjugated to; b) a transmembrane domain of a single a- helix transmembrane protein. In one aspect of any of the embodiments, described herein is an immunogenic conjugate polypeptide consisting of: a) at least one antigen polypeptide conjugated to; b) a vaccine scaffold polypeptide as described herein. In one aspect of any of the embodiments, described
herein is an immunogenic conjugate polypeptide consisting of: a) at least one antigen polypeptide conjugated to; b) a transmembrane domain of a single a-helix transmembrane protein.
[0079] As used herein, an "antigen" is a molecule that is specifically bound by a B cell receptor (BCR), T cell receptor (TCR), and/or antibody, thereby activating an immune response. An antigen can be pathogen-derived, or originate from a pathogen. An antigen can be a polypeptide, protein, nucleic acid or other molecule or portion thereof. The term "antigenic determinant" refers to an epitope on the antigen recognized by an antigen-binding molecule, and more particularly, by the antigen-binding site of said molecule. An antigen polypeptide can be any antigenic polypeptide sequence.
[0080] In some embodiments of any of the aspects, the immunogenic conjugate polypeptide is less than 60 amino acids in length. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide is less than 50 amino acids in length. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide is less than 40 amino acids in length.
[0081] In some embodiments of any of the aspects, the antigen polypeptide is a viral protein or a bacterial protein or antigenic portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is a protein or antigenic portion thereof, obtained from a pathogenic organism. In some embodiments of any of the aspects, the antigen polypeptide is a protein or antigenic portion thereof, specific to a pathogenic organism, e.g., as compared to related nonpathogenic and/or commensal organisms.
[0082] In some embodiments of any of the aspects, the antigen polypeptide is a viral envelope protein, a cell surface protein, or antigenic portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is encoded by a viral env gene, e.g., the HIV env gene (NCBI Gene ID: 155971). Env genes and corresponding polypeptides for various virii are known in the art, e.g., in the NCBI database.
[0083] In some embodiments of any of the aspects, the antigen polypeptide is an HIV protein, or antigenic portion thereof. In some embodiments of any of the aspects, the antigen polypeptide is the membrane proximal external region (MPER) of Env, e.g., HIV Env. Exemplary MPER sequences for several HIV isolates are provided in Table 2.
[0084] Table 2: Sequence of MPER from different HIV isolates
REJO.4541.67 ELDKWASLWNWFDITNWLWYIK 110
ACIO.0.29 ALDKWANLWNWFNITEWLWYIK 111
[0085] In some embodiments of any of the aspects, the antigen polypeptide is the 10E8 epitope (SLWNWFNITNWLWYIK; SEQ ID NO: 112) or the 4E10 epitope (NWFNITNWLW; SEQ ID NO: 94) of HIV Env.
[0086] In som embodiments, the antigen polypeptide can be the ectodomain of HIV gpl60 (e.g., NCBI Gene ID: 155971), influenza HA (e.g., NCBI Gene ID: 956529, 3654620, 3655151, 23308115, 23308115, 1460996, 23104227, or 3655103), hepatitis C El, or hepatitis C E2 protein (see, e.g, NCBI Gene ID: 951475) or an antigenic portion thereof.
[0087] The term "conjugated" refers to the attachment of at least two entities to form one entity. The joining of the two entities can be direct (e.g., via covalent or non-covalent bonds) or indirect (e.g., via linkers etc.). Conjugation can be by means of linkers, chemical modification, peptide linkers, chemical linkers, covalent or non-covalent bonds, or protein fusion or by any means known to one skilled in the art. The joining can be permanent or reversible. In some embodiments of any of the aspects, the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide. In some embodiments of any of the aspects, the antigen polypeptide is conjugated to the C-terminus of the vaccine scaffold polypeptide.
[0088] An immunogenic conjugate polypeptide can comprise more than one occurrena of an antigen polypeptide, e.g, multiple repeats of the same antigen polypeptide and/or multiple different antigen polypeptides. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple repeats of the same antigen polypeptide. In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises multiple different antigen polypeptides.
[0089] In some embodiments of any of the aspects, multiple antigen polypeptides or repeats thereof are separated by a linker. In some embodiments of any of the aspects, the antigen polypeptide and the vaccine scaffold polypeptide are joined by a linker. The term "linker" refers to any means, entity or moiety used to join two or more entities. Linker moieties include, but are not limited to, chemical linker moieties, or for example a peptide linker moiety. In some embodiments of any of the aspects, the linker is hydrophobic. In some embodiments of any of the aspects, the linker is hydrophilic. In some embodiments of any of the aspects, the linker is from 1 to 5 amino acids in length, e.g., is 1, 2, 3, 4, or 5 amino acids in length.
[0090] In some embodiments of any of the aspects, the immunogenic conjugate polypeptide comprises from 1 to 5 antigen polypeptides, e.g., 1 to 5 repeats of the same antigen polypeptide and/or 1 to 5 different antigen polypeptides.
[0091] In one aspect of any of the embodiments, described herein is a nucleic acid encoding the vaccine scaffold polypeptide as described herein or the immunogenic conjugate polypeptide as described herein. In some embodiments of any of the aspects, described herein is a vector comprising a nucleic acid encoding the vaccine scaffold polypeptide as described herein or the immunogenic conjugate polypeptide as described herein.
[0092] The vaccine scaffold polypeptides and/or immunogenic conjugate polypeptides described herein can exist as multimers, e.g., as polypeptide complexes. The potential for multimerization can be controlled by the vaccine scaffold polypeptide selection, e.g., phospholamban-derived vaccine scaffold polypeptides will provide vaccine scaffold polypeptides and/or immunogenic conjugate polypeptides which form pentamers. In a multimer of immunogenic conjugate polypeptides, the antigen polypeptide(s) of each immunogenic conjugate polypeptide can be the same or differ. In some embodiments of any of the aspects, the individual vaccine scaffold polypeptides and/or immunogenic conjugate polypeptides of a polypeptide complex are not covalently bound to each other.
[0093] In one aspect of any of the embodiments, described herein is a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. In some embodiments of any of the aspects, the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid. In some embodiments of any of the aspects, the phospholipid bilayer comprises cholesterol. Suitable lipids discussed in further detail below herein.
[0094] In some embodiments of any of the aspects, each liposome or nanodisc comprises 10 or fewer copies of the antigen polypeptide. In some embodiments of any of the aspects, each liposome or nanodisc comprises 5 or fewer copies of the antigen polypeptide.
[0095] In one aspect of any of the embodiments, described herein is a pharmaceutical composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc and a pharmaceutically acceptable carrier. In some embodiments of any of the aspects, the pharmaceutical composition can further comprise an adjuvant.
[0096] As used herein in the context of immunization, immune response and vaccination, the term "adjuvant" refers to any substance than when used in combination with a specific antigen that produces a more robust immune response than the antigen alone. When incorporated into a vaccine formulation, an
adjuvant acts generally to accelerate, prolong, or enhance the quality of specific immune responses to the vaccine antigen(s). Non-limiting examples of adjuvants include alum, paraffin oil, killed bacteria, squallene, detergents, plant saponins, cytokines, Freund's complete adjuvant, Freund's incomplete adjuvant, adjuvant 65, aluminum hydroxide, aluminum phosphate, and/or calcium phosphate hydroxide.
[0097] Described herein are covalently circularized nanodiscs and the loopable membrane scaffold proteins used to construct these nanodiscs. As used herein, "nanodisc" refers to a discoidal, nanoscale phospholipid bilayer which is "belted" or "ringed" by a membrane scaffold protein. The membrane scaffold protein comprises amphipathic alpha helices which provide an hydrophobic surface next to the hydrocarbon tails of the phospholipid bilayer and an external hydrophilic surface. As used herein, "covalently circularized nanodisc" refers to a nanodisc in which the membrane scaffold protein has been covalently boneded to itself to form continuous polypeptide loop (i.e. it has been circularized).
[0098] In one aspect of any of the embodiments, described herein is a loopable membrane scaffold protein comprising, from N-terminus to C-terminus: i) an N-terminal circularization domain; ii) at least one amphipathic alpha helix domain; and iii) a C-terminal circularization domain. In one aspect of any of the embodiments, described herein is a loopable membrane scaffold protein comprising, from N-terminus to C-terminus: i) an N-terminal circularization domain; ii) a plurality of amphipathic alpha helix domains; and iii) a C-terminal circularization domain. As used herein, "loopable membrane scaffold protein" refers to a protein which is capable of being circularized by a covalent bond in such as way that the interior circumference of the protein provides a hydrophobic environment and the exterior circumference forms a hydrophilic environment. Once circularized, the protein is referred to herein as a "looped membrane scaffold protein." This circularized protein can accommodate a phospholipid bilayer within the interior circumference.
[0099] As used herein, "circularized" or "looped" when used in reference to a polypeptide refers to the fact that the peptide sequence is not linear in nature, e.g., it does not have an N-terminus or C- terminus. A polypeptide which is circularized or looped can form any shape, e.g., a circle, an oval, or a polygon. In contrast, a polypeptide or nanodisc referred to herein which is "circular in shape," has a shape or cross-section which forms the shape of a circle.
[00100] As used herein, "a circularization domain" refers to a section of a linear polypeptide which upon interaction with a corresponding second circularization domain in the same polypeptide, can cause circularization of the polypeptide. The circularization domain can comprise one or more amino acid residues. A number of circularization technologies are known in the art and any such technology can be applied to the proteins described herein. Exemplary circularization domains are described below.
[00101] Proteins can be circularized by the action of a sortase enzyme. Sortase recognizes a
LPXTG/A (e.g., LPXTG (SEQ ID NO: 51) or LPXTA (SEQ ID NO: 56)) sequence, cleaving the sequence after the threonine. The threonine residue can then form a new peptide bond with a glycine or alanine residue found at a second, more N-terminal location in the polypeptide, causing it to be circularized. The use of sortase enzymes to circularize polypeptide is described in more detail in, e.g., Cowper et al. ChemBioChem 2013 14: 809-812; Antes et al., Journal of Biological Chemistry 2009 284: 16028-36; and Tsukiji et al. ChemBioChem 2009 10:787-798; each of which is incorporated by reference herein in its entirety. In some embodiments of any of the aspects described herein, one circularization domain comprises: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and the other circularization domain comprises: a sequence LPXTG/A;
wherein X represents any amino acid. In some embodiments of any of the aspects described herein, the N-terminal circularization domain comprises: a non-polar amino acid sequence comprising at least one N- terminal glycine or alanine residue; and the C-terminal circularization domain comprises: a sequence LPXTG/A; wherein X represents any amino acid.
[00102] As used herein, "non-polar amino acid sequence" refers to a sequence comprising non-polar amino acids, the sequence being at least one amino acid in length. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 20 amino acids in length. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to about 10 amino acids in length. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 10 amino acids in length. In some embodiments of any of the aspects, the non-polar amino acid sequence comprises glycine and alanine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of glycine and alanine residues. In some embodiments of any of the aspects, the non- polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence is from 1 to 10 amino acids in length and consists of amino acids selected from the group consisting of: glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 residues selected from glycine and alanine. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 glycine residues. In some embodiments of any of the aspects, the non-polar amino acid sequence consists of 1-5 alanine residues.
[00103] In some embodiments of any of the aspects, the sequence LPXTG/A can be covalently bound to the at least one glycine or alanine residue of (i).
[00104] In some embodiments of any of the aspects, the LPXTG/A is LPGTG/A (SEQ ID NO: 24); LPSTG/A (SEQ ID NO: 25); or LPETG/A (SEQ ID NO: 26). In some embodiments of any of the aspects,
the LPXTG/A is LPGTG (SEQ ID NO: 53); LPGTA (SEQ ID NO: 57); LPSTG (SEQ ID NO: 58);
LPSTA (SEQ ID NO: 59); LPETG (SEQ ID NO: 60); or LPETA (SEQ ID NO: 61).
[00105] Proteins can also be circularized by use of two intein domains (e.g., using the pTWIN vectors commercially available from New England Biolabs; Ipswich, MA (e.g., Cat. No. N695 I S)). Inteins can excise themselves from a polypeptide, causing splicing of the remaining sequence (e.g., exteins). When inteins are used to flank a central sequence, the central sequence can be circularized when the inteins excise themselves. Various inteins and their use are described in more detail in, e.g.. Elleuche et al. Applied Microbiology and Biotechnology. 2010 87:479-489; Cowper et al. ChemBioChem 2013 14:809- 812; Ahlmann-Eltze et al. 2015 hdl.handle.net/1721.1/96071 ; Evans et al. Journal of Biological
Chemistry 1999 274: 18359-18363; and Evans et al. Biopoly 1999 51 : 333-342; each of which is incorporated by reference herein in its entirety.
[00106] In some embodiments of any of the aspects, one circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the other circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein. In some embodiments of any of the aspects, the N-terminal circularization domain comprises an intein separated from the domain of (ii) by a Cys; and the C-terminal circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein. In some embodiments of any of the aspects, at least one intein is flanked by a chitin binding domain (CBD). Intein-mediated cyclization is described further in, e.g., Xu et al. Methods. 2001 Jul;24(3):257-77; which is incorporated by reference herein in its entirety.
[00107] Proteins can also be circularized by utilizing 2 cysteine residues, one at each end of the sequence to be circularized. The C-terminal cysteine is capable of initiating an intramolecular N→S acyl shift. This results in an S-acyl intermediate that can be intercepted by an added thiol, yielding a C- terminal thioester and liberating cysteine. The cysteine at the N terminus interacts with the C-terminal thioester and leads to spontaneous backbone circularization, through intramolecular
transthioesterification. Next, an S→N acyl shift rearrangement occurs that lead to formation of a peptide bond. The final circularized product will have a cysteine next to the newly formed peptide bond. Such methods of circularization are described in more detail at, e.g., Cowper, B et. al. ChemBioChem 2013, 14, 809 - 812; which is incorporated by reference herein in its entirety. In some embodiments of any of the aspects, each circularization domain comprises a Cys. In some embodiments of any of the aspects, one of the Cys residues is preceded by a Gly residue. In some embodiments of any of the aspects, one of the Cys residues is the C-terminal residue of the linear polypeptide.
[00108] As used herein, "amphipathic alpha helix domain" refers to a domain comprising a continuous amphipathic alpha helix, e.g., an alpha helix with a face which is hydrophobic/non-polar and a second face which is hydrophilic/polar. In some embodiments of any of the aspects, a loopable membrane scaffold protein can comprise a plurality of amphipathic alpha helix domains, e.g., multiple domains separated by non-helical sequences. Several exemplary amphipathic alpha helix domains are provided herein. By way of non-limiting example, an amphipathic alpha helix can comprise an ApoA-I polypeptide or repeats thereof; at least one alpha helical polypeptide with secondary amphipathicity or a repeat thereof; at least one amphipathic proline-rich polypeptide or a repeat thereof; or at least one repeat of the sequence XZXPPP; wherein X is any hydrophobic residue (e.g., any of A, I, L, F, V, P,W, M, Y and G) and Z is any hydrophilic residue (e.g., any of R, K, D, E, Q, N, H, S,T, or C). A given
amphipathic alpha helix domain and/or loopable membrane scaffold protein can comprise a combination of any of the specific sequences and domains described herein.
[00109] ApoA-I (e.g., NCBI Gene ID: 335), also referred to as ApoAl, refers to the major protein component of high density lipoprotein (HDL) in plasma, which also serves a cofactor for lecithin cholesterolacyltransferase (LCAT). The sequences for ApoA-I are known for a number of species, e.g., human ApoA-I mRNA (e.g., NCBI Ref Seq: NM_000039.2) and protein (e.g., NCBI Ref Seq:
NP_000030.1 ; SEQ ID NO: 5) sequences. The native ApoA-1 protein comprises a 43 residue N-terminal globular domain and a 200 residue C-terminal lipid binding domain (e.g., residues 68-267 of SEQ ID NO: 5) which forms an ampipathic alpha helix. As used herein, "ApoA-I polypeptide" refers to a polypeptide comprising at least one repeat of the ApoA-I C-terminal lipid binding domain (e.g., residues 68-267 of SEQ ID NO: 5). In some embodiments of any of the aspects, an ApoA-I polypeptide comprises from 1 to 10 repeats of the ApoA-I C-terminal lipid binding domain (e.g., residues 68-267 of SEQ ID NO: 5).
[00110] As used herein, "secondary amphipathicity" refers to amphipathicity existing in the secondary structure of a polypeptide, e.g., the polar residues are found on one face of the secondary structure and the nonpolar residues are found on the opposite face of the secondary structure.
[00111] In some embodiments of any of the aspects described herein, an alpha helical polypeptide with secondary amphipathicity can have a sequence selected from the group consisting of:
DWFKAFYDKLAEKFKEAF (SEQ ID NO: 27);
DFLKAFYDKVAEKFKEAAPDWFKAFYDKVAEKFKEAF (SEQ ID NO: 28);
KLALRLALKAFKAALKLA (SEQ ID NO: 29); RLALDLALRAFKAAWKLA (SEQ ID NO: 30); ELAWDLAFEALDAELKLD (SEQ ID NO: 31); FLKLLKKFLKLFKKLLKLF (SEQ ID NO: 32);
WLKLLKKWLKLWKKLLKL (SEQ ID NO: 33); LLKFLKRLLKLLKDLWKLL (SEQ ID NO: 34); WEAAFAEALAEAWAEHLAEALAEAVEALAA (SEQ ID NO: 35);
WEAKLAKALAKALAKHLAKALAKALKACEA (SEQ ID NO: 36);
RAFARALARALKALARALKALAR (SEQ ID NO: 37); GLFEALLELLESLWELLLEA (JTS 1 peptide) (SEQ ID NO: 38); KLLKLLLKLWKKLLKLLK (SEQ ID NO: 39);
DWLKAFYDKVAEKLKEAF (18A peptide) (SEQ ID NO: 40); DWFKAFYDKVAEKFKEAF (4F peptide) (SEQ ID NO: 41); or variants thereof. Alpha helical polypeptide with secondary amphipathicity are readily identified by one of skill in the art, e.g., the Helical Wheel Prediction algorithm available at rzlab.ucr.edu/scripts/wheel/ can be used to characterize the secondary amphipathicity of a query polypeptide sequence. Secondary amphipathic peptides are described further in the art at, e.g., S.
Gottschalk et al., Gene Ther. 1996; 3 : 448-457; T. Niidome et al. Bioconjugate Chem. 1999; 10(5): 773- 780); B. Chung et al, J. Bio. Chem. 1985; 260: 10256-10262; and H. Kariyazono et al. J. Pept. Sci. 2016; 22: 1 16-122; each of which is incorporated by reference herein in its entirety.
[00112] The loopable membrane scaffold proteins described herein can further comprise sequences useful for preparation of the covalently circularized nanodiscs, but which will not be present in the covalently circularized nanodisc itself. For example, sequences flanking the N- or C-terminal circularization domains can be used to purify the loopable membrane scaffold proteins and/or to tether them to a substrate or surface for the circularization process. Circularization itself will necessarily remove such flanking sequences from the membrane scaffold protein as it is looped at the circulariation domains.
[00113] In some embodiments of any of the aspects, the loopable membrane scaffold protein can comprise a cap sequence N-terminal of the N-terminal circularization domain that can be cleaved to expose the N-terminal circularization domain as the N-terminus of the protein. In some embodiments of any of the aspects, the loopable membrane scaffold protein can comprise a a cap sequence N-terminal of the N-terminal circularization domain comprising a non-polar amino acid sequence that can be cleaved to expose the N-terminal circularization domain a non-polar amino acid sequence as the N-terminus of the protein. Such cap sequences can comprise and be cleaved by means of any sequence recognized by a protease. By way of non-limiting example, the cap sequence can comprise the recognition sequence Leu- Val-Pro-Arg-Gly-Ser (SEQ ID NO: 42). This recognition sequence can be cleaved by thrombin between Arg and Gly. By way of further non-limting example, the cap sequence can comprise the recognition sequence Glu-X-Leu-Tyr-< -Gln-(p where X is any residue, Φ is any large or medium hydrophobic residue (e.g., W, F, M,Y, L, I, or V) and φ is glycine or alanine (SEQ ID NO: 43). Glu-X-Leu-Tyr-<D-Gln-(p (SEQ ID NO: 43) is recognized by TEV protease and cleaved after the Gin residue.
[00114] In some embodiments of any of the aspects, the cap sequence, or any sequence flanking the circularization domains can further comprise an affinity purification tag. In some embodiments of any of
the aspects, the cap sequence can further comprise an affinity purification tag N-terminal of the cleavage site. In some embodiments of any of the aspects, the loopable membrane scaffold protein can comprise an affinity tag flanking one of the circularization domains. In some embodiments of any of the aspects, the loopable membrane scaffold protein can comprise an affinity tag C-terminal of the C-terminal circularization domain. In some embodiments of any of the aspects, the loopable membrane scaffold protein can comprise an affinity tag N-terminal of the N-terminal circularization domain.
[00115] Affinity tags can be used for, e.g., affinity purification or to bind a protein to a desired substrate or surface. Affinity tags can be used to bind the loopable membrane scaffold tag to a surface or substrate prior to circularization, or to remove flanking sequences (e.g. cleaved N-terminal cap sequences) after they have been cleaved. A number of affinity tags and their binding partner ligands are well known in the art and are described, e.g., in Lichty et al. Protein Expr Purif 2005 41:98-105; Zhao et al. J
Analytical Methods in Chemistry 2013; Kimple et al. Current Protocols in Protein Science 2004
36:939:9.1-9.9.19; and Giannone et al. Methods and Protocols "Protein Affinity Tags" Humana Press 2014; each of which is incorporated by reference herein in its entirety. Non-limiting examples of affinity tags can include His tags, Flag tags, or Strep tags.
[00116] Affinity tags can be separated from a circularization domain by a linker. Accordingly, a linker can be located C-terminal of the C-terminal circularization domain and N-terminal of an affinity tag, or N-terminal of the N-terminal circularization domain and C-terminal of an affinity tag.
[00117] Illustrative examples of linkers include glycine polymers (G)n; glycine-serine polymers (Gi_ 5Si_5)n (SEQ ID NO: 63), where n is an integer of at least one, two, three, four, or five; glycine -alanine polymers; alanine-serine polymers; and other flexible linkers known in the art. Glycine and glycine- serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between domains of the proteins described herein. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 1 1173-142 (1992)). The ordinarily skilled artisan will recognize that design of a protein in particular embodiments can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired nanodisc structure.
[00118] Other exemplary linkers include, but are not limited to the following amino acid sequences: GGG; DGGGS (SEQ ID NO: 64); TGEKP (SEQ ID NO: 65) (see, e.g., Liu et al , PNAS 5525-5530 (1997)); GGRR (SEQ ID NO: 66) (Pomerantz et al. 1995, supra); (GGGGS)n wherein = 1, 2, 3, 4 or 5 (SEQ ID NO: 67) (Kim et al, PNAS 93, 1156-1160 (1996.); EGKSSGSGSESKVD (SEQ ID NO: 68) (Chaudhary et al , 1990, Proc. Natl. Acad. Sci. U.S.A. 87: 1066-1070); KESGSVSSEQLAQFRSLD
(SEQ ID NO: 69) (Bird et al , 1988, Science 242:423-426), GGRRGGGS (SEQ ID NO: 70); LRQRDGERP (SEQ ID NO: 71); LRQKDGGGSERP (SEQ ID NO: 72); LRQKD(GGGS)2 ERP (SEQ ID NO: 73). Alternatively, flexible linkers can be rationally designed using a computer program capable of modeling both DNA -binding sites and the peptides themselves (Desjarlais & Berg, PNAS 90:2256-2260 (1993), PNAS 91 : 1 1099-1 1 103 (1994) or by phage display methods. In one embodiment, the linker comprises the following amino acid sequence: GSTSGSGKPGSGEGSTKG (SEQ ID NO: 74) (Cooper et al, Blood, 101(4): 1637- 1644 (2003)).
[00119] In some embodiments of any of the aspects, a covalently circularized nanodisc can, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, be circular in shape. In some embodiments of any of the aspects, a covalently circularized nanodisc can, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, be polygonal (e.g., triangular, rectangular, pentagonal, etc) in shape.
[00120] In some embodiments of any of the aspects, the shape of the nanodisc can be directed by the ratio of phospholipids to looped scaffold membrane protein. In some embodiments of any of the aspects, the shape of the nanodisc can be directed by the structure of the looped scaffold membrane protein. A looped scaffold membrane protein comprising a single amphipathic alpha helix domain or multiple amphipathic alpha helix domains which are joined by sequences with constrained geometry will tend to form nanodiscs which, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, are circular in shape.
[00121] In some embodiments of any of the aspects, the loopable scaffold membrane protein can comprise a plurality of amphipathic alpha helix domains separated by flexible linker sequences. Each linker sequence will tend to allow a sharper bend to be assumed by a looped scaffold membrane protein at that location. Accordingly, such variants of the looped scaffold membrane protein can, when viewed from an angle which is perpendicular to a hydrophilic surface of the phospholipid layer, be polygonal in shape. The particular polygon assumed by the assembled nanodisc can be directed by the number of separate flexible linker sequences present in the looped scaffold membrane protein, with each forming a corner of a polygon. Linker sequences are known to those of skill in the art and can be any sequence of less than about 30 amino acids in length which do not assume a secondary structure. In some
embodiments of any of the aspects, the linker sequence can be less than 30 amino acids in length.In some embodiments of any of the aspects, the linker sequence can be less than about 25 amino acids in length. In some embodiments of any of the aspects, the linker sequence can be less than 25 amino acids in length. In some embodiments of any of the aspects, the linker sequence can be less than about 20 amino acids in
length. In some embodiments of any of the aspects, the linker sequence can be less than 20 amino acids in length.
[00122] In some embodiments of any of the aspects, the flexible linker sequence is selected from the group consisting of: LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
[00123] In some embodiments of any of the aspects, the loopable scaffold membrane protein has the sequence of any of SEQ ID NOs: 1-4 and 6-23.
[00124] Mutation of certain residues to cysteine can, e.g., permit immobilizing nanodiscs to surfaces and/or solid substrates, e.g., by surface plasmon resonance or with use of resins or beads configured to bind to cysteine residues. Provision of cysteine residues can further permit attachment of tags, e.g., small molecule or protein tags for NMR or crystallization applications). Accordingly, In some embodiments of any of the aspects, the loopable scaffold membrane protein can comprise substitution with cysteine at one or more residues.
[00125] In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at one or more residues corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6, or positions 31, 36, 93, 1 10, 159, and 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at one residue corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at two residues corresponding to positions 31, 36, 137, and/or 153 of SEQ ID NO: 1 or 6. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at three residues corresponding to positions 31, 36, 137, and/or 153 of SEQ ID NO: 1 or 6. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the four residues corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6.
[00126] In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the residue corresponding to positions 31, 36, 93, 1 10, 159, or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the two residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the three residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a
substitution with cysteine at the four residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the five residues corresponding to positions 31, 36, 93, 1 10, 159, and/or 175 of SEQ ID NO: 2 or 7. In some embodiments of any of the aspects, the loopable scaffold membrane protein can further comprise a substitution with cysteine at the six residues corresponding to positions 31, 36, 93, 1 10, 159, and 175 of SEQ ID NO: 2 or 7.
[00127] In some embodiments of any of the aspects, the loopable scaffold membrane protein can comprise a sequence of SEQ ID NO: 1 or 6 with a substitution with cysteine at one or more residues corresponding to positions 31, 36, 137, and 153 of SEQ ID NO: 1 or 6. In some embodiments of any of the aspects, the loopable scaffold membrane protein can comprise a sequence of SEQ ID NO: 2 or 7 with a substitution with cysteine at one or more residues corresponding to positions 31, 36, 93, 1 10, 159, and 175 of SEQ ID NO: 2 or 7.
[00128] In some embodiments of any of the aspects, the loopable scaffold membrane protein can have or comprise the sequence of SEQ ID NO: 62.
SEQ ID NO: 62 NW1 1 3C
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWCNLEKETEGLRQEMSKDLEEVKAKVQPY LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGECMRDRARAHVDALRTH LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALCDLRQGLLPVLESFK VSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00129] In one aspect of any of the embodiments, described herein is a nucleic acid encoding a loopable membrane scaffold protein as described herein. In one aspect of any of the embodiments, described herein is a vector comprising a nucleic acid encoding a loopable membrane scaffold protein as described herein.
[00130] The loopable scaffold membrane proteins described herein can be circularized and combined with phospholipids to form a covalently circularized nanodisc. In one aspect of any of the embodiments, described herein is a covalently circularized nanodisc comprising: a) a phospholipid bilayer; and b) a looped membrane scaffold protein forming a belt around the bilayer, wherein the looped membrane scaffold protein comprises: i) an N-terminal circularization domain covalently linked to a C-terminal circularization domain; and ii) at least one amphipathic alpha helix domains. In one aspect of any of the embodiments, described herein is a covalently circularized nanodisc comprising: a) a phospholipid bilayer; and b) a looped membrane scaffold protein forming a belt around the bilayer, wherein the looped membrane scaffold protein comprises: i) an N-terminal circularization domain covalently linked to a C- terminal circularization domain; and ii) a plurality of amphipathic alpha helix domains.
[00131] Suitable exemplary circularization domains and methods of circularizing proteins comprising them are described elsewhere herein. The looped proteins that result from use of these exemplary circularization domains are described herein.
[00132] In some embodiments of any of the aspects, a loopable membrane scaffold protein can comprise one circularization domain comprising: a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and a second circularization domain comprising: a sequence LPXTG/A; wherein X represents any amino acid. In the resulting looped membrane scaffold protein a first circularization domain covalently linked to a second circularization domain comprises the sequence LPXT followed by a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; wherein X represents any amino acid. In some embodiments of any of the aspects, the sequence LPXT is LPGT (SEQ ID NO: 48); LPST (SEQ ID NO: 49); or LPET (SEQ ID NO: 50).
[00133] In some embodiments of any of the aspects, a loopable membrane scaffold protein can comprise one circularization domain comprising an intein separated from the domain of (ii) by a Cys; and a second circularization domain comprising an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein. In the resulting looped membrane scaffold protein a first circularization domain covalently linked to a second circularization domain comprises a cysteine residue.
[00134] In some embodiments of any of the aspects, each circularization domain of a loopable membrane scaffold protein can comprise a Cys residue. In some embodiments of any of the aspects, one of the Cys residues is preceded by a Gly residue. In some embodiments of any of the aspects, one of the Cys residues is the C-terminal residue of the linear polypeptide. In the resulting looped membrane scaffold protein a first circularization domain covalently linked to a second circularization domain comprises a cysteine residue.
[00135] In some embodiments of any of the aspects, the diameter of the nanodisc is greater than about 6 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than 6 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than about 15 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than 15 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than about 50 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is greater than 50 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 80 nm.
[00136] In some embodiments of any of the aspects, the diameter of the nanodisc is about 6 nm to about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 6 nm to 80 nm.
In some embodiments of any of the aspects, the diameter of the nanodisc is about 15 nm to about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 15 nm to 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is about 50 nm to about 80 nm. In some embodiments of any of the aspects, the diameter of the nanodisc is 50 nm to 80 nm.
[00137] The nanodiscs described herein comprise phospholipids. As used herein, the term
"phospholipid" refers to phosphatidic acids, phosphoglycerides, and phosphosphingolipids. Phosphatidic acids include a phosphate group coupled to a glycerol group, which may be mono- or diacylated.
Phosphoglycerides (or glycerophospholipids) include a phosphate group intermediate an organic group (e.g., choline, ethanolamine, serine, inositol) and a glycerol group, which may be mono- or diacylated. Phosphosphingolipids (or sphingomyelins) include a phosphate group intermediate an organic group (e.g., choline, ethanolamine) and a sphingosine (non-acylated) or ceramide (acylated) group. It will be appreciated that in certain embodiments, the phospholipids useful in the compositions and methods of the invention include their salts (e.g., sodium, ammonium). For phospholipids that include carbon-carbon double bonds, individual geometrical isomers (cis, trans) and mixtures of isomers are included.
[00138] Representative phospholipids include phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidylserines, phosphatidylinositols, and phosphatidic acids, and their lysophosphatidyl (e.g., lysophosphatidylcholines and lysophosphatidylethanolamine) and diacyl phospholipid (e.g., diacylphosphatidylcholines, diacylphosphatidylethanolamines,
diacylphosphatidylglycerols, diacylphosphatidylserines, diacylphosphatidylinositols, and
diacylphosphatidic acids) counterparts.
[00139] The acyl groups of the phospholipids may be the same or different. In certain embodiments, the acyl groups are derived from fatty acids having C10-C24 carbon chains (e.g., acyl groups such as lauroyl, myristoyl, palmitoyl, stearoyl or oleoyl groups). Representative diacylphosphatidylcholines (i.e., l,2-diacyl-sn-glycero-3-phosphocholines) include distearoylphosphatidylcholine (DSPC),
dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC),
dilinoleoylphosphatidylcholine DLPC), palmitoyloleoylphosphatidylcholine (POPC),
palmitoyllinoleoylphosphatidylcholine, stearoyllinoleoylphosphatidylcholine
stearoyloleoylphosphatidylcholine, stearoylarachidoylphosphatidylcholine,
didecanoylphosphatidylcholine (DDPC), dierucoylphosphatidylcholine (DEPC),
dilinoleoylphosphatidylcholine (DLOPC), dimyristoylphosphatidylcholine (DMPC),
myristoylpalmitoylphosphatidylcholine (MPPC), myristoylstearoylphosphatidylcholine (MSPC), stearoylmyristoylphosphatidylcholine (SMPC), palmitoylmyristoylphosphatidylcholine (PMPC),
palmitoylstearoylphosphatidylcholine (PSPC), stearoylpalmitoylphosphatidylcholine (SPPC), and stearoyloleoylphosphatidylcholine (SOPC).
[00140] Representative diacylphosphatidylethanolamines (i.e., l,2-diacyl-sn-glycero-3- phosphoethanolamines) include dioleoylphosphatidylethanolamine (DOPE),
dipalmitoylphosphatidylethanolamine (DPPE), distearoylphosphatidylethanolamine (DSPE), dilauroylphosphatidylethanolamine (DLPE), dimyristoylphosphatidylethanolamine (DMPE), dierucoylphosphatidylethanolamine (DEPE), and palmitoyloleoylphosphatidylethanolamine (POPE).
[00141] Representative diacylphosphatidylglycerols (i.e., l,2-diacyl-sn-glycero-3- phosphoglycerols) include dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG),
dierucoylphosphatidylglycerol (DEPG), dilauroylphosphatidylglycerol (DLPG),
dimyristoylphosphatidylglycerol (DMPG), distearoylphosphatidylglycerol (DSPG), and
palmitoyloleoylphosphatidylglycerol (POPG) .
[00142] Representative diacylphosphatidylserines (i.e., l,2-diacyl-sn-glycero-3- phosphoserines) include dilauroylphosphatidylserine (DLPS), dioleoylphosphatidylserine (DOPS),
dipalmitoylphosphatidylserine (DPPS), and distearoylphosphatidylserine (DSPS).
[00143] Representative diacylphosphatidic acids (i.e., l,2-diacyl-sn-glycero-3-phosphates) include dierucoylphosphatidic acid (DEPA), dilauroylphosphatidic acid (DLPA), dimyristoylphosphatidic acid (DMPA), dioleoylphosphatidic acid (DOPA), dipalmitoylphosphatidic acid (DPPA), and
distearoylphosphatidic acid (DSPA).
[00144] Representative phospholipids include phosphosphingolipids such as ceramide
phosphoryllipid, ceramide phosphorylcholine, and ceramide phosphorylethanolamine.
[00145] In some embodiments of any of the aspects, the nanodics of the invention can comprise one type of phospholipid. In some embodiments of any of the aspects, the nanodics of the invention can comprise two or more different phospholipids. In some embodiments of any of the aspects, the nanodics of the invention can comprise two different phospholipids. In some embodiments of any of the aspects, the nanodics of the invention can comprise three different phospholipids. In some embodiments of any of the aspects, the nanodics of the invention can comprise four different phospholipids.
[00146] In some embodiments of any of the aspects, the phospholipid can be a native lipid extract. In some embodiments of any of the aspects, the phospholipid can be a headgroup modified lipid, e.g., alkyl phosphates (e.g. 16:0 Monomethyl PE; 18: 1 Monomethyl PE; 16:0 Dimethyl PE; 18: 1 Dimethyl PE; 16:0 Phosphatidylmethanol; 18: 1 Phosphatidylmethanol; 16:0 Phosphatidylethanol; 18: 1 Phosphatidylethanol; 16:0-18: 1 Phosphatidylethanol; 16:0 Phosphatidylpropanol; 18: 1 Phosphatidylpropanol; 16:0
Phosphatidylbutanol; and 18: 1 Phosphatidylbutanol); MRI imaging reagents (e.g.14:0 PE-DTPA (Gd);
DTPA-BSA (Gd); 16:0 PE-DTPA (Gd); 18:0 PE-DTPA (Gd); bis(14:0 PE)-DTPA (Gd); bis(16:0 PE)- DTPA (Gd); and bis(18:0 PE)-DTPA (Gd)); chelators (e.g., 14:0 PE-DTPA (Gd); DTPA-BSA (Gd); 16:0 PE-DTPA (Gd); 18:0 PE-DTPA (Gd); bis(14:0 PE)-DTPA (Gd); bis( 16:0 PE)-DTPA (Gd); and bis(18:0 PE)-DTPA (Gd)); glycosylated lipids (e.g., 18: 1 Lactosyl PE); pH sensitive lipids (e.g., N-palmitoyl homocysteine; 18: 1 DGS; 16:0 DGS; and DOBAQ); antigenic lipids (e.g., DNP PE and DNP Cap PE); adhesive lipids (e.g., 16:0 DG Galloyl); and functionalized lipids (e.g., 16:0 PA-PEG3-mannose; 16:0 Caproylamine PE; 18: 1 Caproylamine PE; 16:0 MPB PE; 18: 1 MPB PE; 16:0 Ptd Ethylene Glycol; 18: 1 Ptd Ethylene Glycol; 16:0 Folate Cap PE; 16:0 Cyanur PE; 16:0 Biotinyl PE; 18: 1 Biotinyl PE; 16:0 Biotinyl Cap PE; 16:0 Cyanur Cap PE; 18: 1 Biotinyl Cap PE; 16:0 Dodecanoyl PE; 18: 1 Dodecanyl PE; 16:0 Glutaryl PE; 18: 1 Glutaryl PE; 16:0 Succinyl PE; 18: 1 Succinyl PE; 16:0 PDP PE; 18: 1 PDP PE; 16:0 Ptd Thioethanol; 18: 1 Dodecanylamine PE; 16:0 Dodecanylamine PE; 16:0 PE MCC; 18: 1 PE MCC; 16:0 hexynoyl PE; and 16:0 azidocaproyl PE).
[00147] In some embodiments of any of the aspects described herein, the phospholipids can further comprise a molecule of interest, e.g., a membrane protein, a receptor, a transmembrane protein or channel, hydrophobic small molecules, hydrophobic drugs, RNA, peptides, and the like. In some embodiments of any of the aspects described herein, the covalently circularized nanodiscs described herein can be or be utilized as a drug delivery vehicle.
[00148] Provided herein are methods of making the covalently circularized nanodiscs described herein. In one aspect of any of the embodiments, described herein is a method comprising: a) circularizing the loopable membrane scaffold protein described herein; b) contacting the looped protein produced in step (a) with solubilized phospholipids.
[00149] In one aspect of any of the embodiments, described herein is a method comprising: a) contacting the loopable membrane scaffold protein described herein with a sortase enzyme; b) contacting the looped protein produced in step (a) with solubilized phospholipids. A number of sortase enzymes are known in the art, e.g., ones that recognize the various exemplary circularization domain sequences provided herein. By way of non-limiting example, the sortase can be Staphylococcus aureus wild type sortase A (Srt A); evolved sortase; eSrtA; eSrtA(2A-9); eSrtA(4S-9); or Streptococcus pyogenes sortase A. Wild type SrtA and eSrtA recognize LPXTG (SEQ ID NO: 5 1) while eSrtA(2A-9) recognizes LAXTG (SEQ ID NO: 75), LSETG (SEQ ID NO: 76) and accepts glycine nucleophiles and eSrt A(4S-9) recognizes LPXSG (SEQ ID NO: 77), LPXCG (SEQ ID NO: 78), LPXAG (SEQ ID NO: 79) and accepts glycine nucleophiles. Evolved sortases are described further in, e.g., Dorr et al. PNAS 2014 1 1 1(37): 13343-8 and Chen et al. PNAS 201 1 108(28): 1 1399-404; each of which is incorporated by reference herein in its entirety. Streptococcus sortase A recognizes the LPXTA motif (SEQ ID NO: 56)
and accepts alanine nucleophiles (see, e.g., P. Race, J. Biol. Chem. 284: 6924-6933; which is incorporated by reference herein in its entirety).
[00150] In some embodiments of any of the aspects, the contacting step can be stopped by quenching the reaction with a sortase inhibitor. Sortase inhibition is known in the art and can include the use of AAEK2 or a high concentration of EDTA. As used herein, a high concentration of EDTA can be from about 100 uM to about 400 mM, e.g., 100 uM to 400 mM, about ImM to about 300 mM, ImM to 300 mM, about ImM to about 200 mM, or ImM to 200 mM.
[00151] In one aspect of any of the embodiments, described herein is a method comprising a) contacting the loopable membrane scaffold protein comprising intein circularization domains with: i) a solution having a pH low enough to induce cleavage of the dipeptide sequence of Asn-Cys; ii) and a thiol reagent to induce cleavage at the Cys residue; resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids. In some embodiments of any of the aspects, the thiol reagent is DTT.
[00152] In some embodiments of any of the aspects, the loopable membrane scaffold protein comprises a chitin binding domain flanking each circularization domain and is first purified by chitin binding prior to circularization (e.g., the loopable membrane scaffold protein is expressed from a pTWIN vector in E. coli and purified by binding to chitin beads).
[00153] In one aspect of any of the embodiments, described herein is a method comprising a) contacting a loopable membrane scaffold protein comprising circularization domains comprising cysteine residues with a thiol reagent or thiol donor, resulting in circularization of the protein; and b) contacting the looped protein produced in step (a) with solubilized phospholipids. In some embodiments of any of the aspects, the thiol can be DTT, sodium 2-mercaptoethane sulfonate (MESNa) or guanidinium hydrocholoride. Circularization via two cysteine residues is described in the art, e.g., Cowper, B et. al. ChemBioChem 2013, 14, 809 - 812; which is incorporated by reference herein in its entirety. Briefly, the C-terminal cysteine initiates an intramolecular N→S acyl shift. This results in an S-acyl intermediate that can be intercepted by an added thiol, yielding a C-terminal thioester and liberating cysteine. The cysteine at the N terminus interacts with the C-terminal thioester and leads to spontaneous backbone
circularization, through intramolecular transthioesterification. Next, an S→N acyl shift rearrangement occurs that lead to formation of a peptide bond. The final circularized product has a cysteine next to the newly formed peptide bond.
[00154] In some embodiments of any of the aspects, a reagent and/or enzyme used to catalyze or permit circularization (e.g., a sortase enzyme) can be bound to a substrate or surface.
[00155] In some embodiments of any of the aspects, a reagent and/or enzyme used to catalyze or permit circularization (e.g., a sortase enzyme) can further comprise an affinity tag to, e.g., permit binding a substrate or to assist in removal of the reagent and/or enzyme when the reaction is to be stopped. In some embodiments of any of the aspects, the affinity tag is a His tag. In some embodiments of any of the aspects, a sortase can further comprise a His tag.
[00156] In some embodiments of any of the aspects, the loopable membrane scaffold protein can further comprise an affinity tag that permits the protein to be bound to a substrate or surface. In some embodiments of any of the aspects, the loopable membrane scaffold protein can further comprise a His tag that permits the protein to be bound to a substrate or surface. In some embodiments of any of the aspects, the loopable membrane scaffold protein can further comprise a C-terminal affinity tag that permits the protein to be bound to a substrate or surface. In some embodiments of any of the aspects, the method described herein can further comprise a first step of binding a loopable membrane scaffold protein comprising an affinity tag to a substrate or surface.
[00157] In some embodiments of any of the aspects, the substrate comprises Cu2+, Ni2+ or Co2+. In some embodiments of any of the aspects, the substrate is a column, chip, or bead.
[00158] In some embodiments of any of the aspects, the loopable membrane scaffold protein is bound to a substrate, e.g., a bead, and the first contacting step is performed in the presence of phospholipids. In some embodiments of any of the aspects, the loopable membrane scaffold protein is bound to a substrate, e.g., a bead, and the first and second contacting steps are performed concurrently.
[00159] In some embodiments of any of the aspects, the loopable membrane scaffold protein is bound to a substrate, e.g., a bead, and after the first contacting step, the looped membrane scaffold protein is eluted from the substrate.
[00160] In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of less than about 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of less than 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of from about 1 uM to about 1 mM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of from 1 uM to 1 mM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a concentration of from about 1 uM to about 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the loopable membrane scaffold protein is in solution at a
concentration of from 1 uM to 100 uM prior to the first contacting step. In some embodiments of any of the aspects, the looped membrane scaffold protein formed after the first contacting step is passed through a column, substrate, and/or solution which can be bound by an affinity tag found on the loopable membrane scaffold protein. In some embodiments of any of the aspects, the looped membrane scaffold protein formed after the first contacting step is passed through a column, substrate, and/or solution Cu2+, Co2+ or Ni2+, which can be bound by an affinity tag (e.g. a His tag) found on the loopable membrane scaffold protein.
[00161] In some embodiments of any of the aspects, the loopable membrane protein further comprises a cap sequence N-terminal of the N-terminal circularization domain and the method comprises a first step of contacting the protein with an enzyme to cleave the cap sequence.
[00162] In some embodiments of any of the aspects, the phospholipids of the second contacting step are solubilized in detergent. Exemplary detergents can include, but are not limited to Decyl β-D- maltopyranoside, Deoxycholic acid, Digitonin, n-Dodecyl β-D-glucopyranoside, n-Dodecyl β-D- maltoside, N-Lauroylsarcosine sodium salt, Sodium cholate, Sodium deoxycholate , Undecyl β-D- maltoside, Triton X-100, CHAPS, 5-Cyclohexylpentyl β-D-maltoside, n-dodecyl phosphatidylcholine, n- octyl^-d-glucoside, and Brij 97.
[00163] In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from about 0 C to about 42 C. In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from 0 C to 42 C. In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from about 0 C to about 37 C. In some embodiments of any of the aspects, the second contacting step occurs at a temperature of from 0 C to 37 C.
[00164] In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 : 1000 to about 1 : 10,000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from 1 : 1000 to 1 : 10,000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2000 to about 1 :5000. In some embodiments of any of the aspects, the ratio of loopable membrane scaffold protein to phospholipids is from 1:2000 to 1 :5000.
[00165] In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3500 to about 1 :4500; and nanodiscs which are circular in shape formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is about 1 :4000; and nanodiscs which are circular in shape are formed. In some embodiments of any of the aspects, the loopable membrane
scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from 1 :3500 to 1 :4500; and nanodiscs which are circular in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is 1 :4000; and nanodiscs which are circular in shape are formed. In some embodiments of any of the aspects, the phospholipids are POPC/POPG lipids.
[00166] In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2500 to about 1 :3700; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :3100 to about 1 :3400; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from 1 :2500 to 1 :3700; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the loopable membrane scaffold protein has the sequence of SEQ ID NO: 4; the ratio of loopable membrane scaffold protein to phospholipids is from 1 :3100 to 1 :3400; and nanodiscs which are polygonal in shape are formed. In some embodiments of any of the aspects, the phospholipids are POPC/POPG lipids.
[00167] The nanodiscs described herein can be used, e.g., in structural and/or functional studies of membrane proteins or as vaccine platforms. It is specifically contemplated that the nanodiscs described herein can be used for solution NMR, cryo-EM studies, crystallization, and 2D lattice of, e.g., membrane proteins in or on the bilayer. Membrane proteins can be studied to examine, e.g., protein-protein interactions with other membrane proteins, or cytosolic or extracellular proteins; behavior and structure of membrane pores; virus entry and inhibition thereof; and cell-free expression of membrane proteins. The nanodiscs described herein can also permit study of, e.g., lipid rafts themselves, vesicle fusion, and Residual Dipolar Coupling (RDC) measurements (detergent free, homogenous effect, charge tunable).
[00168] In one aspect of any of the embodiments, described herein is a method of inducing an immune response in a subject, the method comprising administering to the subject a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. As used herein, an "immune response" refers to a response by a cell of the immune system, such as a B cell, T cell (CD4 or CD8), regulatory T cell, antigen-presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil, to a stimulus (e.g., to an adjuvant). In some embodiments of the
aspects described herein, the response is specific for a particular antigen (an "antigen-specific response"), and refers to a response by a CD4 T cell, CD8 T cell, or B cell via their antigen-specific receptor. In some embodiments of the aspects described herein, an immune response is a T cell response, such as a CD4+ response or a CD8+ response. Such responses by these cells can include, for example, cytotoxicity, proliferation, cytokine or chemokine production, trafficking, or phagocytosis, and can be dependent on the nature of the immune cell undergoing the response. Stimulation of an immune response refers to an induction or increase of the immune response.
[00169] An immune response to an antigen can be the development in a subject of a humoral and/or a cell-mediated immune response to molecules present in the antigen or vaccine composition of interest. For purposes of the present invention, a "humoral immune response" is an antibody-mediated immune response and involves the induction and generation of antibodies that recognize and bind with some affinity for the antigen in the immunogenic composition of the invention, while a "cell-mediated immune response" is one mediated by T-cells and/or other white blood cells. A "cell-mediated immune response" is elicited by the presentation of antigenic epitopes in association with Class I or Class II molecules of the major histocompatibility complex (MHC), CD1 or other non-classical MHC-like molecules. This activates antigen-specific CD4+ T helper cells or CD8+ cytotoxic lymphocyte cells ("CTLs"). CTLs have specificity for peptide antigens that are presented in association with proteins encoded by classical or non- classical MHCs and expressed on the surfaces of cells. CTLs help induce and promote the intracellular destruction of intracellular microbes, or the lysis of cells infected with such microbes. Another aspect of cellular immunity involves an antigen-specific response by helper T-cells. Helper T-cells act to help stimulate the function, and focus the activity of, nonspecific effector cells against cells displaying peptide or other antigens in association with classical or non-classical MHC molecules on their surface. A "cell- mediated immune response" also refers to the production of cytokines, chemokines and other such molecules produced by activated T-cells and/or other white blood cells, including those derived from CD4+ and CD8+ T-cells. The ability of a particular antigen or composition to stimulate a cell-mediated immunological response may be determined by a number of assays, such as by lymphoproliferation (lymphocyte activation) assays, CTL cytotoxic cell assays, by assaying for T-lymphocytes specific for the antigen in a sensitized subject, or by measurement of cytokine production by T cells in response to re- stimulation with antigen. Such assays are well known in the art. See, e.g., Erickson et al. (1993) J.
Immunol. 151:4189-4199; and Doe et al. (1994) Eur. J. Immunol. 24:2369-2376.
[00170] In some embodiments of any of the aspects, an immune response can comprise immunization. Immunization refers to the process of inducing a high level of antibody and/or cellular immune response in a subject, that is directed against a pathogen or antigen to which the organism has been exposed.
Immunization can provide protection against the relevant pathogen, e.g., prevent disease arising from a pathogen comprising the antigen if the subject is exposed to said pathogen after immunization.
Immunization may be life-long or require booster administrations.
[00171] In some embodiments of any of the aspects, a subject administered a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc is further administered an adjuvant, e.g, in the same composition or in a different composition, at the same time, or at a separate time. In some embodiments of any of the aspects, the composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc is admixed with the adjuvant prior to administration.
[00172] In some embodiments of any of the aspects, the administration is a prime administration and/or a boost administration. In some embodiments of any of the aspects, the subject is further administered a second vaccine, e.g., against the same or a different pathogen(s).
[00173] The compositions and methods described herein can be administered to a subject in need of vaccination, immunization, and/or stimulation of an immune response. In some embodiments of any of the aspects, the methods described herein comprise administering an effective amount of compositions described herein, e.g. to a subject in order to stimulate an immune response or provide protection against the relevant pathogen the antigen was derived from. Providing protection against the relevant pathogen is stimulating the immune system such that later exposure to the antigen (e.g., on or in a live pathogen) triggers a more effective immune response than if the subject was naive to the antigen. Protection can include faster clearance of the pathogen, reduced severity and/or time of symptoms, and/or lack of development of disease or symptoms. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. Such methods can include, but are not limited to oral, parenteral, intravenous, intramuscular, subcutaneous, transdermal, airway (aerosol), pulmonary, cutaneous, injection, or topical, administration. Administration can be local or systemic. In some embodiments of any of the aspects, the administration can be intramuscular or subcutaneous.
[00174] The term "effective amount" as used herein refers to the amount of adjuvant needed to stimulate the immune system, or in combination with an antigen, to provide a protective effect against subsequent infections, and relates to a sufficient amount of pharmacological composition to provide the desired effect. The term "therapeutically effective amount" therefore refers to an amount of the adjuvant (and optionally, the antigen) that is sufficient to provide a particular immune stimulatory effect when
administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom of the disease (for example but not limited to, slowing the progression of a symptom of the disease), or prevent a symptom of the disease. Thus, it is not generally practicable to specify an exact "effective amount" . However, for any given case, an appropriate "effective amount" can be determined by one of ordinary skill in the art using only routine experimentation.
[00175] Effective amounts, toxicity, and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g. , for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dosage can vary depending upon the dosage form employed and the route of administration utilized. The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50. Compositions and methods that exhibit large therapeutic indices are preferred. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e. , the concentration of a composition which achieves a half-maximal inhibition of symptoms or induction of desired responses) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for antibody titers, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
[00176] In some embodiments of any of the aspects, the technology described herein relates to a pharmaceutical composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc as described herein, and optionally a pharmaceutically acceptable carrier. In some embodiments of any of the aspects, the active ingredients of the pharmaceutical composition comprises a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. In some embodiments of any of the aspects, the active ingredients of the pharmaceutical composition consist essentially of a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. In some embodiments of any of the aspects, the active ingredients of the pharmaceutical composition consist of a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. Pharmaceutically acceptable carriers and diluents include saline, aqueous buffer solutions, solvents and/or
dispersion media. The use of such carriers and diluents is well known in the art. Some non-limiting examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and/or polyanhydrides; (22) bulking agents, such as polypeptides and amino acids (23) serum component, such as serum albumin, HDL and LDL; (22) C2-Ci2 alcohols, such as ethanol; and (23) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation. The terms such as "excipient", "carrier", "pharmaceutically acceptable carrier" or the like are used interchangeably herein. In some embodiments of any of the aspects, the carrier inhibits the degradation of the active agent.
[00177] In some embodiments of any of the aspects, the pharmaceutical composition as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, parenteral dosage forms are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. In addition, controlled-release parenteral dosage forms can be prepared for administration of a patient, including, but not limited to, DUROS®-type dosage forms and dose-dumping.
[00178] Suitable vehicles that can be used to provide parenteral dosage forms of an adjuvant as disclosed within are well known to those skilled in the art. Examples include, without limitation: sterile water; water for injection USP; saline solution; glucose solution; aqueous vehicles such as but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate. Compounds
that alter or modify the solubility of a pharmaceutically acceptable salt of a composition as disclosed herein can also be incorporated into the parenteral dosage forms of the disclosure, including conventional and controlled-release parenteral dosage forms.
[00179] Conventional dosage forms generally provide rapid or immediate drug release from the formulation. Depending on the pharmacology and pharmacokinetics of the drug, use of conventional dosage forms can lead to wide fluctuations in the concentrations of the drug in a patient's blood and other tissues. These fluctuations can impact a number of parameters, such as dose frequency, onset of action, duration of efficacy, maintenance of therapeutic blood levels, toxicity, side effects, and the like.
Advantageously, controlled-release formulations can be used to control a drug's onset of action, duration of action, plasma levels within the therapeutic window, and peak blood levels. In particular, controlled- or extended-release dosage forms or formulations can be used to ensure that the maximum effectiveness of a drug is achieved while minimizing potential adverse effects and safety concerns, which can occur both from under-dosing a drug (i.e., going below the minimum therapeutic levels) as well as exceeding the toxicity level for the drug. In some embodiments of any of the aspects, the adjuvant can be administered in a sustained release formulation.
[00180] Controlled-release pharmaceutical products have a common goal of improving drug therapy over that achieved by their non-controlled release counterparts. Ideally, the use of an optimally designed controlled-release preparation in medical treatment is characterized by a minimum of drug substance being employed to cure or control the condition in a minimum amount of time. Advantages of controlled- release formulations include: 1) extended activity of the drug; 2) reduced dosage frequency; 3) increased patient compliance; 4) usage of less total drug; 5) reduction in local or systemic side effects; 6) minimization of drug accumulation; 7) reduction in blood level fluctuations; 8) improvement in efficacy of treatment; 9) reduction of potentiation or loss of drug activity; and 10) improvement in speed of control of diseases or conditions. Kim, Cherng-ju, Controlled Release Dosage Form Design, 2 (Technomic Publishing, Lancaster, Pa.: 2000).
[00181] Most controlled-release formulations are designed to initially release an amount of drug (active ingredient) that promptly produces the desired therapeutic effect, and gradually and continually release other amounts of drug to maintain this level of therapeutic or prophylactic effect over an extended period of time. In order to maintain this constant level of drug in the body, the drug must be released from the dosage form at a rate that will replace the amount of drug being metabolized and excreted from the body. Controlled-release of an active ingredient can be stimulated by various conditions including, but not limited to, pH, ionic strength, osmotic pressure, temperature, enzymes, water, and other physiological conditions or compounds.
[00182] A variety of known controlled- or extended-release dosage forms, formulations, and devices can be adapted for use with the salts and compositions of the disclosure. Examples include, but are not limited to, those described in U.S. Pat. Nos. : 3,845,770; 3,916,899; 3,536,809; 3,598, 123; 4,008,719; 5674,533; 5,059,595; 5,591 ,767; 5, 120,548; 5,073,543; 5,639,476; 5,354,556; 5,733,566; and 6,365, 185 B l ; each of which is incorporated herein by reference. These dosage forms can be used to provide slow or controlled-release of one or more active ingredients using, for example, hydroxypropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems (such as OROS® (Alza
Corporation, Mountain View, Calif. USA)), or a combination thereof to provide the desired release profile in varying proportions.
[00183] In some emboidments of any of the aspects, the methods described herein can further comprise administering a second agent and/or treatment to the subject, e.g. as part of a combinatorial therapy.
[00184] In certain embodiments, an effective dose of a composition as described herein can be administered to a patient once. In certain embodiments, an effective dose of a composition can be administered to a patient repeatedly. For systemic administration, subjects can be administered a therapeutic amount of a composition as described herein, such as, e.g. 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, or more.
[00185] The dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to increase or decrease dosage, increase or decrease administration frequency, discontinue treatment, resume treatment, or make other alterations to the treatment regimen. The dosing schedule can vary from once a week to daily depending on a number of clinical factors, such as the subject's sensitivity to the adjuvant and/or the antigen. The desired dose or amount of activation can be administered at one time or divided into subdoses, e.g., 2-4 subdoses and administered over a period of time, e.g., at appropriate intervals through the day or other appropriate schedule. In some embodiments of any of the aspects, administration can be chronic, e.g., one or more doses over a period of weeks or months.
[00186] The dosage ranges for the administration of a composition according to the methods described herein depend upon, for example, the form of the adjuvant, its potency, and the extent to which symptoms, markers, or indicators of a response described herein are desired to be induced, for example the percentage inducation desired for an immune response. The dosage should not be so large as to cause
adverse side effects, such as inflammatory responses. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.
[00187] The efficacy of a composition as described herein in, e.g. inducing a response as described herein (e.g. an immune response or immunization) can be determined by the skilled clinician. However, a treatment is considered "effective treatment," as the term is used herein, if one or more of the signs or symptoms of a condition described herein are altered in a beneficial manner, other clinically accepted signs or symptoms are improved, or a desired response is induced e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate. Immune responses can be detected by a variety of methods known to those skilled in the art, including but not limited to, antibody production, cytotoxicity assay, proliferation assay and cytokine release assays. For example, samples of blood can be drawn from the immunized mammal and analyzed for the presence of antibodies against the antigen administered in the respective vaccine and the titer of these antibodies can be determined by methods known in the art.
[00188] Efficacy of an agent can be determined by assessing physical indicators of a desired response, (e.g. immune response, cytokine production, antibody titers, etc). It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy can be assessed in animal models of a condition described herein, for example immunization of monkeys. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.
[00189] In vitro and animal model assays are provided herein which allow the assessment of a given dose of an adjuvant and/or antigen. By way of non-limiting example, the effects of a dose of adjuvant can be assessed by measuring the antibody titers or cytokine production.
[00190] The efficacy of a given dosage combination can also be assessed in an animal model, e.g. immunization of mice as described in the Examples herein.
[00191] In one aspect of any of the embodiments, described herein is a kit comprising a composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc. A kit is any manufacture (e.g., a package or container) comprising at least one reagent, e.g., a composition as described herein, the manufacture being promoted, distributed, or sold as a unit for performing the methods described herein. The kits described herein can optionally comprise additional components useful for performing the
methods described herein. By way of example, the kit can comprise fluids and compositions (e.g., buffers, needles, syringes etc.) suitable for performing one or more of the administrations according to the methods described herein, an instructional material which describes performance of a method as described herein, and the like. Additionally, the kit may comprise an instruction leaflet.
[00192] The term "treatment" (including variations thereof, e.g., "treat" or "treated") as used herein means any one or more of the following: (i) the prevention of infection or re-infection, as in a traditional vaccine, (ii) the reduction in the severity of, or, in the elimination of symptoms, and (iii) the substantial or complete elimination of the pathogen or disorder in question. Hence, treatment may be effected prophylactically (prior to infection) or therapeutically (following infection). In the present invention, prophylactic treatment is the preferred mode. According to a particular embodiment of the present invention, compositions and methods are provided that treat, including prophylactically and/or therapeutically immunize, a host animal against a microbial infection (e.g., a bacterium or virus). The methods of the present invention are useful for conferring prophylactic and/or therapeutic immunity to a subject. The methods of the present invention can also be practiced on subjects for biomedical research applications.
[00193] In some embodiments of any of the aspects, an immunogenic amount or immunologically effective amount of a composition described herein is administered. The term an "immunogenic amount," and "immunologically effective amount," both of which are used interchangeably herein, refers to the amount of the antigen or immunogenic composition sufficient to elicit an immune response, either a cellular (T-cell) or humoral (B-cell or antibody) response, or both, as measured by standard assays known to one skilled in the art.
[00194] In one aspect of any of the embodiments, after the subject is administered the composition comprising a vaccine scaffold polypeptide, immunogenic conjugate polypeptide, and/or a multimer thereof embedded in the phospholipid bilayer of a liposome or nanodisc, the method further comprises isolating from the subject: a) an antibody that specifically binds to the antigen polypeptide; b) a nucleic acid encoding an antibody that specifically binds to the antigen polypeptide; or c) a cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide. Such compositions can be utilized to provide antibodies (polyclonal or monoclonal) which can be used for research, diagnostic, and/or therapeutic purposes according to methods known in the art.
[00195] As used herein, the term "pharmaceutical composition" refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the
pharmaceutical industry. The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical
judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. In some embodiments of any of the aspects, a pharmaceutically acceptable carrier can be a carrier other than water. In some embodiments of any of the aspects, a pharmaceutically acceptable carrier can be a cream, emulsion, gel, liposome, nanoparticle, and/or ointment. In some embodiments of any of the aspects, a pharmaceutically acceptable carrier can be an artificial or engineered carrier, e.g., a carrier that the active ingredient would not be found to occur in in nature.
[00196] As used herein, the term "administering," refers to the placement of a compound as disclosed herein into a subject by a method or route which results in at least partial delivery of the agent at a desired site. Pharmaceutical compositions comprising the compounds disclosed herein can be administered by any appropriate route which results in an effective treatment in the subject.
[00197] For convenience, the meaning of some terms and phrases used in the specification, examples, and appended claims, are provided below. Unless stated otherwise, or implicit from context, the following terms and phrases include the meanings provided below. The definitions are provided to aid in describing particular embodiments, and are not intended to limit the claimed invention, because the scope of the invention is limited only by the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. If there is an apparent discrepancy between the usage of a term in the art and its definition provided herein, the definition provided within the specification shall prevail.
[00198] For convenience, certain terms employed herein, in the specification, examples and appended claims are collected here.
[00199] As used herein, "liposome" refers to a vesicular structure having lipid-containing membranes enclosing an aqueous interior. In cell biology, a vesicular structure is a hollow, lamellar, spherical structure, and provides a small and enclosed compartment, separated from the cytosol by at least one lipid bilayer. Liposomes can have one or more lipid membranes. Liposome compositions can be prepared by a variety of methods that are known in the art.
[00200] As used herein, a "subject" means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomologous monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters. Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon. In some embodiments of any of the aspects, the subject is a
mammal, e.g., a primate, e.g., a human. The terms, "individual," "patient" and "subject" are used interchangeably herein.
[00201] Preferably, the subject is a mammal. The mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of immunization and immune response. A subject can be male or female.
[00202] A subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment (e.g. susceptibility to infection) or one or more complications related to such a condition, and optionally, have already undergone treatment for the condition or the one or more complications related to the condition. Alternatively, a subject can also be one who has not been previously diagnosed as having the condition or one or more complications related to the condition. For example, a subject can be one who exhibits one or more risk factors for the condition or one or more complications related to the condition or a subject who does not exhibit risk factors.
[00203] A "subject in need" of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.
[00204] As used herein, the terms "protein" and "polypeptide" are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha- amino and carboxy groups of adjacent residues. The terms "protein", and "polypeptide" refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function. "Protein" and "polypeptide" are often used in reference to relatively large polypeptides, whereas the term "peptide" is often used in reference to small polypeptides, but usage of these terms in the art overlaps. The terms "protein" and "polypeptide" are used interchangeably herein when referring to a gene product and fragments thereof. Thus, exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
[00205] As used herein, the term "nucleic acid" or "nucleic acid sequence" refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof. The nucleic acid can be either single -stranded or double-stranded. A single -stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA. In one aspect, the nucleic acid can be DNA. In another aspect, the nucleic acid can be RNA. Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
[00206] In some embodiments of any of the aspects, a nucleic acid encoding a polypeptide as described herein (e.g. a loopable membrane scaffold protein) is comprised by a vector. In some of the aspects described herein, a nucleic acid sequence encoding a given polypeptide as described herein, or any module thereof, is operably linked to a vector. The term "vector", as used herein, refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells. As used herein, a vector can be viral or non-viral. The term "vector" encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells. A vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc.
[00207] As used herein, the term "expression vector" refers to a vector that directs expression of an R A or polypeptide from sequences linked to transcriptional regulatory sequences on the vector. The sequences expressed will often, but not necessarily, be heterologous to the cell. An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification. The term "expression" refers to the cellular processes involved in producing RNA and proteins and as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing. "Expression products" include RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene. The term "gene" means the nucleic acid sequence, which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences. The gene may or may not include regions preceding and following the coding region, e.g. 5 ' untranslated (5'UTR) or "leader" sequences and 3 ' UTR or "trailer" sequences, as well as intervening sequences (introns) between individual coding segments (exons).
[00208] As used herein, the term "viral vector" refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle. The viral vector can contain the nucleic acid encoding encoding a polypeptide as described herein in place of non-essential viral genes. The vector and/or particle may be utilized for the purpose of transferring any nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art.
[00209] By "recombinant vector" is meant a vector that includes a heterologous nucleic acid sequence, or "transgene" that is capable of expression in vivo. It should be understood that the vectors described herein can, In some embodiments of any of the aspects, be combined with other suitable compositions and therapies. In some embodiments of any of the aspects, the vector is episomal. The use of a suitable episomal vector provides a means of maintaining the nucleotide of interest in the subject in
high copy number extra chromosomal DNA thereby eliminating potential effects of chromosomal integration.
[00210] As used herein, the term "pharmaceutical composition" refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the
pharmaceutical industry. The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
[00211] The term "statistically significant" or "significantly" refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
[00212] Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term "about." The term "about" when used in connection with percentages can mean ±1%.
[00213] As used herein the term "comprising" or "comprises" is used in reference to compositions, methods, and respective component(s) thereof, that are essential to the method or composition, yet open to the inclusion of unspecified elements, whether essential or not.
[00214] The term "consisting of refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
[00215] As used herein the term "consisting essentially of refers to those elements required for a given embodiment. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment.
[00216] As used herein, the term "corresponding to" refers to refers to an amino acid or nucleotide at the enumerated position in a first polypeptide or nucleic acid, or an amino acid or nucleotide that is equivalent to an enumerated amino acid or nucleotide in a second polypeptide or nucleic acid. Equivalent enumerated amino acids or nucleotides can be determined by alignment of candidate sequences using degree of homology programs known in the art, e.g., BLAST.
[00217] The singular terms "a," "an," and "the" include plural referents unless context clearly indicates otherwise. Similarly, the word "or" is intended to include "and" unless the context clearly indicates otherwise. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of this disclosure, suitable methods and materials are described below. The
abbreviation, "e.g." is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation "e.g." is synonymous with the term "for example."
[00218] Unless otherwise defined herein, scientific and technical terms used in connection with the present application shall have the meanings that are commonly understood by those of ordinary skill in the art to which this disclosure belongs. It should be understood that this invention is not limited to the particular methodology, protocols, and reagents, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims. Definitions of common terms in immunology and molecular biology can be found in The Merck Manual of Diagnosis and Therapy, 19th Edition, published by Merck Sharp & Dohme Corp., 201 1 (ISBN 978-0-91 1910-19-3); Robert S. Porter et al. (eds.), The Encyclopedia of Molecular Cell Biology and Molecular Medicine, published by Blackwell Science Ltd., 1999-2012 (ISBN 9783527600908); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8); Immunology by Werner Luttmann, published by Elsevier, 2006; Janeway's Immunobiology, Kenneth Murphy, Allan Mowat, Casey Weaver (eds.), Taylor & Francis Limited, 2014 (ISBN 0815345305, 9780815345305); Lewin's Genes XI, published by Jones & Bartlett Publishers, 2014 (ISBN-1449659055); Michael Richard Green and Joseph Sambrook, Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2012) (ISBN 19361 13414); Davis et al , Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (2012) (ISBN 044460149X); Laboratory Methods in Enzymology: DNA, Jon Lorsch (ed.) Elsevier, 2013 (ISBN 0124199542); Current Protocols in Molecular Biology (CPMB), Frederick M. Ausubel (ed.), John Wiley and Sons, 2014 (ISBN 047150338X, 9780471503385), Current Protocols in Protein Science (CPPS), John E. Coligan (ed.), John Wiley and Sons, Inc., 2005; and Current Protocols in Immunology (CPI) (John E. Coligan, ADA M Kruisbeek, David H Margulies, Ethan M Shevach, Warren Strobe, (eds.) John Wiley and Sons, Inc., 2003 (ISBN 0471 142735,
9780471 142737), the contents of which are all incorporated by reference herein in their entireties.
[00219] Other terms are defined herein within the description of the various aspects of the invention.
[00220] All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not
entitled to antedate such disclosure by virtue of prior invention or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.
[00221] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.
[00222] Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.
[00223] The technology described herein is further illustrated by the following examples which in no way should be construed as being further limiting.
[00224] Some embodiments of the technology described herein can be defined according to any of the following numbered paragraphs:
1. A loopable membrane scaffold protein comprising, from N-terminus to C-terminus:
i. an N-terminal circularization domain;
ii. a plurality of amphipathic alpha helix domains; and
iii. a C-terminal circularization domain.
2. The protein of paragraph 1, wherein one circularization domain comprises:
a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and
the other circularization domain comprises:
a sequence LPXTG/A; wherein X represents any amino acid.
protein of paragraph 1, wherein the N-terminal circularization domain comprises:
a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue; and
the C-terminal circularization domain comprises:
a sequence LPXTG/A; wherein X represents any amino acid.
protein of any of paragraphs 1-3, wherein the non-polar amino acid sequence is from 1 to 10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine.
protein of any of paragraphs 1-4, wherein the non-polar amino acid sequence consists of 1-5 glycine residues.
protein of any of paragraphs 1-4, wherein the non-polar amino acid sequence consists of 1-5 alanine residues.
protein of paragraph 1-6, wherein the sequence LPXTG/A is covalently bound to the at least one glycine or alanine residue of (i).
protein of any of paragraphs 1-7, wherein the sequence LPXTG/A is LPGTG/A (SEQ ID
NO: 24); LPSTG/A (SEQ ID NO: 25); or LPETG/A (SEQ ID NO: 26). protein of paragraph 1, wherein one circularization domain comprises an intein separated from the domain of (ii) by a Cys; and
the other circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
protein of paragraph 1, wherein the N-terminal circularization domain comprises an intein separated from the domain of (ii) by a Cys; and
the C-terminal circularization domain comprises an intein separated from the domain of (ii) by a dipeptide sequence of Asn-Cys, with the Asn being closest to the intein.
protein of any of paragraphs 9-10, wherein at least one intein is flanked by a chitin binding domain (CBD). otein of paragraph 1, wherein each circularization domain comprises a Cys.
protein of any of paragraphs 1- 12, wherein the amphipathic alpha helix domain comprises:
(a) an ApoA-I polypeptide; or
(b) at least one alpha helical polypeptide with secondary amphipathicity or a repeat thereof;
(c) at least one amphipathic proline-rich polypeptide or a repeat thereof; or
(d) at least one repeat of the sequence XZXPPP; wherein X is any hydrophobic residue and Z is any hydrophilic residue.
protein of paragraph 13, wherein the alpha helical polypeptide has a sequence selected from the group consisting of:
DWFKAFYDKLAEKFKEAF (SEQ ID NO: 27);
DFLKAFYDKVAEKFKEAAPDWFKAFYDKVAEKFKEAF (SEQ ID NO: 28): KLALRLALKAFKAALKLA (SEQ ID NO: 29);
RLALDLALRAFKAAWKLA (SEQ ID NO: 30);
ELAWDLAFEALDAELKLD (SEQ ID NO: 31);
FLKLLKKFLKLFKKLLKLF (SEQ ID NO: 32);
WLKLLKKWLKLWKKLLKL (SEQ ID NO: 33);
LLKFLKRLLKLLKDLWKLL (SEQ ID NO: 34);
WEAAFAEALAEAWAEHLAEALAEAVEALAA (SEQ ID NO: 35);
WEAKLAKALAKALAKHLAKALAKALKACEA (SEQ ID NO: 36);
RAFARALARALKALARALKALAR (SEQ ID NO: 37);
GLFEALLELLESLWELLLEA (SEQ ID NO: 38);
KLLKLLLKLWKKLLKLLK (SEQ ID NO: 39);
DWLKAFYDKVAEKLKEAF (SEQ ID NO: 40); and
DWFKAFYDKVAEKFKEAF (SEQ ID NO: 41). protein of any of paragraphs 1-14, further comprising a cap sequence N-terminal of the N- terminal circularization domain that can be cleaved to expose the N-terminal circularization domain as the N-terminus of the protein.
protein of paragraph 15, wherein the cap sequence comprises as sequence selected from the group consisting of:
a. Leu-Val-Pro-Arg-Gly-Ser (SEQ ID NO: 42); and
b. Glu-X-Leu-Tyr-< -Gln-(p where X is any residue, Φ is any large or medium hydrophobic residue and φ is glycine or alanine (SEQ ID NO: 43).
protein of any of paragraphs 1-16, wherein the cap sequence further comprises an affinity purification tag N-terminal of the cleavage site.
protein of any of paragraphs 1-17, further comprising a His tag flanking one of the circularization domains.
The protein of paragraph 18, wherein the His tag is located C-terminal of the C-terminal circularization domain.
The protein of any of paragraphs 1-19, further comprising a linker flanking one of the
circularization domains.
The protein of any of paragraphs 1-20, wherein the linker is located C-terminal of the C-terminal circularization domain. The protein of any of paragraphs 1-21, wherein the plurality of amphipathic alpha helix domains are separated by flexible linker sequences;
The protein of paragraph 22, wherein the flexible linker sequence is selected from the group consisting of:
LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47). The protein of any of paragraphs 1-23, having the sequence of any of SEQ ID NOs: 1-4 and 6-23.
A covalently circularized nanodisc comprising:
a. a phospholipid bilayer; and
b. a looped membrane scaffold protein forming a belt around the bilayer, wherein the
looped membrane scaffold protein comprises:
iv. an N-terminal circularization domain covalently linked to a C-terminal circularization domain; and
v. a plurality of amphipathic alpha helix domains. The nanodisc of paragraph 25, wherein an N-terminal circularization domain covalently linked to a C-terminal circularization domain comprises the sequence LPXT followed by a non-polar amino acid sequence comprising at least one N-terminal glycine or alanine residue;
wherein X represents any amino acid.
The nanodisc of any of paragraphs 25-26, wherein the non-polar amino acid sequence is from 1 to
10 amino acids in length and comprises amino acids selected from the group consisting of: glycine and alanine.
The nanodisc of any of paragraphs 25-27, wherein the non-polar amino acid sequence consists of
1-5 glycine residues.
nanodisc of any of paragraphs 25-27, wherein the non-polar amino acid sequence consists of
1-5 alanine residues.
nanodisc of any of paragraphs 25-29, wherein the sequence LPXT is LPGT (SEQ ID NO:
48); LPST (SEQ ID NO: 49); or LPET (SEQ ID NO: 50).
nanodisc of any paragraph 25, wherein the N-terminal circularization domain covalently linked to a C-terminal circularization domain is a cysteine residue. nanodisc of any of paragraphs 25-31, wherein amphipathic alpha helix domain comprises:
(a) an ApoA-I polypeptide; or
(b) at least one alpha helical polypeptide with secondary amphipathicity or a repeat thereof;
(c) at least one amphipathic proline-rich polypeptide or a repeat thereof; or
(d) at least one repeat of the sequence XZXPPP; wherein X is any hydrophobic residue and Z is any hydrophilic residue.
nanodisc of paragraph 32, wherein the alpha helical polypeptide has a sequence selected from the group consisting of:
DWFKAFYDKLAEKFKEAF (SEQ ID NO: 27);
DFLKAFYDKVAEKFKEAAPDWFKAFYDKVAEKFKEAF (SEQ ID NO: 28): KLALRLALKAFKAALKLA (SEQ ID NO: 29);
RLALDLALRAFKAAWKLA (SEQ ID NO: 30);
ELAWDLAFEALDAELKLD (SEQ ID NO: 31);
FLKLLKKFLKLFKKLLKLF (SEQ ID NO: 32);
WLKLLKKWLKLWKKLLKL (SEQ ID NO: 33);
LLKFLKRLLKLLKDLWKLL (SEQ ID NO: 34);
WEAAFAEALAEAWAEHLAEALAEAVEALAA (SEQ ID NO: 35);
WEAKLAKALAKALAKHLAKALAKALKACEA (SEQ ID NO: 36);
RAFARALARALKALARALKALAR (SEQ ID NO: 37);
GLFEALLELLESLWELLLEA (SEQ ID NO: 38);
KLLKLLLKLWKKLLKLLK (SEQ ID NO: 39);
DWLKAFYDKVAEKLKEAF (SEQ ID NO: 40); and
DWFKAFYDKVAEKFKEAF (SEQ ID NO: 41). nanodisc of any of paragraphs 25-33, wherein the plurality of amphipathic alpha helix domains are separated by flexible linker sequences;
nanodisc of paragraph 25-34, wherein the flexible linker sequence is selected from the group consisting of:
LPGTGS (SEQ ID NO: 44); LPGTSG (SEQ ID NO: 45); LPSTGS (SEQ ID NO: 46); and LPSTSG (SEQ ID NO: 47).
nanodisc of any of paragraphs 25-35, wherein the protein has the sequence of any of SEQ ID NOs: 1-4 and 6-23. nanodisc of any of paragraphs 25-36, wherein the diameter is greater than about 6 nm.
nanodisc of any of paragraphs 25-37, wherein the diameter is greater than about 15 nm. nanodisc of any of paragraphs 25-38, wherein the diameter is greater than about 50 nm. nanodisc of any of paragraphs 25-39, wherein the diameter is about 80 nm. ethod of making a nanodisc of any of paragraphs 25-30 or 32-40, the method comprising:
a. contacting the loopable membrane scaffold protein of any of paragraphs 1-8 or 13-24 with a sortase enzyme;
b. contacting the looped protein produced in step (a) with solubilized
phospholipids.
method of paragraph 41, wherein the sortase is selected from the group consisting of:
Staphylococcus aureus wild type sortase A (Srt A); evolved sortase; eSrtA; eSrtA(2A-9); eSrtA(4S-9); and Streptococcus pyogenes sortase A.
method of any of paragraphs 41-42, wherein the contacting step is stopped by quenching the reaction with a sortase inhibitor.
method of paragraph 43, wherein the sortase inhibitor is AAEK2 or high concentrations of
EDTA.
method of any of paragraphs 41-44, wherein the sortase is bound to a substrate.
method of any of paragraphs 41-45, wherein the sortase further comprises a His tag. ethod of making a nanodisc of any of paragraphs 31-40, the method comprising:
a. contacting the loopable membrane scaffold protein of any of paragraphs 9-11 or 13-24 with:
a. a solution having a pH low enough to induce cleavage of the dipeptide sequence of Asn-Cys;
b. and a thiol reagent to induce cleavage at the Cys residue;
resulting in circularization of the protein; and
b. contacting the looped protein produced in step (a) with solubilized phospholipids.
The method of paragraph 47, wherein the thiol reagent is DTT.
A method of making a nanodisc of any of paragraphs 31-40, the method comprising:
a. contacting the loopable membrane scaffold protein of any of paragraphs 12-24 with a thiol reagent, resulting in circularization of the protein; and b. contacting the looped protein produced in step (a) with solubilized
phospholipids. The method of any of paragraphs 41-49, wherein the phospholipids are solubilized in detergent. The method of any of paragraphs 41-50, wherein step (b) occurs at a temperature of from about 0
C to about 42 C.
The method of any of paragraphs 41-51, wherein step (b) occurs at a temperature of from about 0
C to about 37 C.
The method of any of paragraphs 41-52, wherein the ratio of loopable membrane scaffold protein to phospholipids is from about 1 :2000 to about 1 :5000.
The method of any of paragraphs 41-53, wherein the ratio of loopable membrane scaffold protein of any of paragraphs 1-21 and 24 to phospholipids is from about 1 :3500 to about 1 :4500; and circular nanodiscs are formed.
The method of any of paragraphs 41-54, wherein the ratio of loopable membrane scaffold protein of any of paragraphs 1-21 and 24 to phospholipids is from about 1 :4000; and circular nanodiscs are formed.
The method of any of paragraphs 41-55, wherein the ratio of loopable membrane scaffold protein of any of paragraphs 22-23, to phospholipids is from about 1 :2500 to about 1 :3700; and non- circular nanodiscs are formed.
The method of any of paragraphs 41-56, wherein the ratio of loopable membrane scaffold protein of any of paragraphs 22-23 to phospholipids is from about 1 :3100 to about 1 :3400; and non- circular nanodiscs are formed.
58. The method of any of paragraphs 41-57, wherein the protein further comprises a cap sequence N- terminal of the N-terminal circularization domain and the method comprises a first step of contacting the protein with an enzyme to cleave the cap sequence.
59. The method of any of paragraphs 41-58, wherein the protein further comprises a C-terminal His tag and the method comprises a first step of binding the protein to a substrate.
60. The method of any of paragraphs 41-59, wherein the substrate comprises Cu2+, Ni2+ or Co2+.
61. The method of any of paragraphs 41-60, wherein the substrate is a chip or bead.
62. The method of any of paragraphs 41-61, wherein the substrate is a bead and step (a) is performed in the presence of phospholipids.
63. The method of any of paragraphs 41-62, wherein the substrate is a bead and the steps (a) and (b) are performed concurrently.
64. The method of any of paragraphs 41-63, further comprising, after step (a), a step of eluting the looped protein produced in step (a) from the substrate.
65. The method of any of paragraphs 41-64, wherein the loopable membrane scaffold protein is in solution at a concentration of less than 100 uM prior to the contacting step.
66. The method of paragraph 65, wherein the looped protein formed in step (a) is passed through a column, substrate, and/or solution comprising Cu2+, Co2+ or Ni2+.
[00225] Some embodiments of the technology described herein can be defined according to any of the following numbered paragraphs:
1. A vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof.
2. The polypeptide of paragraph 1, wherein the single a-helix transmembrane protein is selected from the group consisting of:
phospholamban; influenza M2 channel protein; stannin; Vpu; HIV Vpu; parainfluenza 5 fusion protein; parainfluenza fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH.
3. The polypeptide of any of paragraphs 1-2, wherein the transmembrane domain of phospholamban is the sequence of one of SEQ ID NOs: 95-101, 113, or 114.
4. The polypeptide of any of paragraphs 1-2, wherein the variant of the transmembrane domain of phospholamban is a sequence with at least 90% homology to one of SEQ ID NO: 95-101, 113 or 114.
mmunogenic conjugate polypeptide comprising:
a. at least one antigen polypeptide conjugated to;
b. a vaccine scaffold polypeptide of paragraphs 1-4.
polypeptide of paragraph 5, wherein the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide.
polypeptide of paragraph 5 wherein the antigen polypeptide is conjugated to the C-terminus of the vaccine scaffold polypeptide.
polypeptide of any of paragraphs 5-7, wherein the antigen polypeptide is a viral envelope protein, a cell surface protein, or portion thereof.
polypeptide of any of paragraphs 5-8, wherein the antigen polypeptide is an HIV protein or portion thereof.
polypeptide of any of paragraphs 5-9, wherein the antigen polypeptide is the membrane proximal external region (MPER) of Env.
polypeptide of any of paragraphs 5-9, wherein the antigen polypeptide is the 10E8 epitope or the 4E10 epitope.
polypeptide of any of paragraphs 5-1 1, comprising multiple repeats of the same antigen polypeptide.
polypeptide of any of paragraphs 5-12, comprising multiple different antigen polypeptides. polypeptide of any of paragraphs 12-13, wherein the antigen polypeptides or repeats thereof are separated by a linker.
polypeptide of paragraph 14, wherein the linker is hydrophobic.
polypeptide of paragraph 14, wherein the linker is hydrophilic.
polypeptide of any of paragraphs 14- 16, wherein the linker is from 1 to 5 amino acids in length.
polypeptide of any of paragraphs 5-17, wherein the immunogenic polypeptide comprises from 1 to 5 copies of the antigen polypeptide.
polypeptide of any of paragraphs 5-18, wherein the antigen polypeptide and the vaccine scaffold polypeptide are joined by a linker.
polypeptide of paragraph 19, wherein the linker is hydrophobic.
polypeptide of paragraph 19, wherein the linker is hydrophilic.
polypeptide of any of paragraphs 19-21, wherein the linker is from 1 to 5 amino acids in length.
cleic acid encoding the vaccine scaffold polypeptide of any of paragraphs 1-5 or the immunogenic conjugate polypeptide of any of paragraphs 5-22. lypeptide complex comprising a polymeric complex of the polypeptides of any of paragraphs
1-23. mposition comprising a polypeptide complex of paragraph 24 and/or an immunogenic conjugate polypeptide of any of claims 5-22 embedded in the phospholipid bilayer of a liposome or nanodisc.
composition of paragraph 25, wherein the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid.
composition of paragraph 25, wherein the phospholipid bilayer comprises cholesterol.
composition of any of paragraphs 25-27, wherein each liposome or nanodisc comprises 10 or fewer copies of the antigen polypeptide.
composition of any of paragraphs 25-28, wherein each liposome or nanodisc comprises 5 or fewer copies of the antigen polypeptide. armaceutical composition comprising the composition of any of paragraphs 25-29 and a pharmaceutically acceptable carrier.
composition of paragraph 30, further comprising an adjuvant. ethod of inducing an immune response in a subject, the method comprising administering to the subject a composition of any of paragraphs 25-31.
method of paragraph 32, wherein the immune response comprises immunization.
method of paragraphs 32-33, wherein the subject is further administered an adjuvant.
method of paragraph 34, wherein the compositions of any of paragraphs 24-30 is admixed with the adjuvant prior to administration.
method of any of paragraphs 32-35, wherein the administration is a prime administration and/or a boost administration.
method of any of paragraphs 32-36, wherein the subject is further administered a second vaccine.
method of any of paragraphs 32-37, further comprising a step of isolating from the subject: a. an antibody that specifically binds to the antigen polypeptide;
b. a nucleic acid encoding an antibody that specifically binds to the antigen polypeptide; or
c. a cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide.
EXAMPLES
EXAMPLE 1
[00226] Described herein are three different nanodics embodiments and/or structures: (1) covalently circularized nanodiscs (cNDs); and (2) polygonal nanodiscs). Specifically contemplated herein are the use of these nanodics for, e.g., facilitating solution NMR and Cryo-EM studies, permitting structural and functional studies of large membrane proteins, and the use of the nanodiscs as vaccine platforms.
[00227] Nanodiscs have been designed to conduct in vitro biophysical studies of membrane proteins. A nanodisc is an assembly of a phospholipid bilayer surrounded or "belted" by two copies of an amphipathic helical membrane scaffold protein (MSP). A schematic representation of a nanodisc is depicted in Fig. 1.
[00228] The size of the MSP (e.g., circumference) defines the size of the nanodiscs and various lipids that can be incorporated to form the discoidal bilayer construct. Nanodiscs have been shown to provide a stable and more biologically relevant, "native-like" lipid bilayer environment compared to agents such as detergents or liposomes. Numerous proteins have been assembled into nanodiscs and these constructs have proven to be useful in studying membrane protein structure and function by solution NMR and Cryo-electron microscopy (Cryo-EM).
[00229] As used herein, the term "conventional nanodiscs" refers to discoidal, nanoscale phospholipid bilayers encompassed by a membrane scaffold protein (MSP) e.g., two molecules of amphipathic alpha- helical protein wrapped around the perimeter of the disc in an anti-parallel fashion. The hydrophobic face of the scaffold protein serves to sequester the hydrocarbon tails of the phospholipids away from the solvent and limits the size of the disc. In some embodiments of any of the aspects, the membrane scaffold protein can be apolipoprotein. These conventional nanodiscs are lipid-protein nanoparticles roughly 10 nm in diameter.
[00230] Described herein are three "non-conventional" nanodiscs: covalently circularized nanodiscs (cNDs) and polygonal nanodiscs.
[00231] Covalently circularized nanodiscs (cNDs): Described herein is the covalently linkage of the N and C termini of ApoA-I protein variants and circularization of the proteins on a Cu2+ chip to produce uniformly sized nanodiscs. To accommodate the analysis of larger membrane proteins, it is also
demonstrated herein that high molecular weight circularized variants can be used to prepare circularized nanodiscs of up to 80 nm in diameter.
[00232] Polygonal nanodiscs: The present technology also relates to the production of polygonal nanodiscs. The inventors determined that at suboptimal lipid concentrations, the circularized high molecular weight variants could form nanodiscs having non-circular shapes and that these can increase the chance for crystallization.
[00233] Described herein are several applications for the nanodisc structures including their use in solution NMR and Cryo-EM studies, permitting structural and functional studies of larger membrane proteins, permitting the study of membrane protein interactions with other proteins, permitting the study of viral entry into cells, and their use as vaccine platforms.
EXAMPLE 2
[00234] Described herein are covalently circularized phospholipid bilayer nanodiscs (cNDs) of various sizes up to 80 nm in diameter with a very narrow size distribution. Producing nanodiscs of increased size is highly desirable for incorporating larger integral membrane proteins (IMP), molecular complexes, oligomers of IMP, and pore-forming proteins into the discoidal bilayer for detailed biophysical investigation. This alone makes the cNDs described herein of interest to chemists engaged in pharmacological, membrane/lipid, and general biophysics research. Also, the cNDs described herein can permit new opportunities in crystallization, drug and nucleic acid delivery, vaccine platform, cell free expression of larger membrane proteins (IMP) and molecular complexes.
[00235] In Addition to cNDs, described herein are polygonal nanodiscs that offer numerous exciting applications.
[00236] Using an in vitro system that best mimics the in vivo physicochemical environment surrounding an integral membrane protein (IMP) is critical for fully understanding its molecular behavior in a biologically relevant context. Although micelles and bicelles have been used extensively in the study of IMPs, the presence of detergent often causes destabilization and rapid loss of function of the incorporated protein [1]. Furthermore, detergents can hinder interactions between an IMP and its cytosolic partner(s). Until recently, liposomes were the only means to harbor membrane proteins in a detergent-free bilayer environment. However, liposomes have a tendency to aggregate and are heterogeneous in size. Moreover, liposomes are not compatible with crystallization and solution-state NMR.
[00237] Nanodiscs on the other hand provide a detergent-free lipid bilayer model that is compatible with solution NMR, are not prone to aggregation, and do not suffer from the geometric distortion often
inherent in other membrane substitutes. A conventional nanodisc is composed of a nanometer-sized phospholipid bilayer encircled by two copies of a helical, amphipathic membrane scaffold proteins (MSPs) [2, 3] . MSPs are truncated forms of apolipoprotein Al, which is the major protein component of high-density lipoprotein. There are several different variants of MSP that can be used to assemble nanodiscs of various sizes ranging from 7-17 nm average diameter [4,5] . These different variants of MSP are commercially available (cube-biotech.com) and have been used for over a decade to study a variety of IMPs.
[00238] The use of nanodiscs for multidimensional NMR experiments, as required for complete three- dimensional structural assignment, remains challenging and is still in its early stages. Furthermore, to the best of our knowledge, there has been no membrane proteins successfully crystallized in nanodiscs. A challenging hurdle is that the diameter of the nanodisc particle can vary broadly independent of the MSP chain length in a single preparation [5, 6] . This size heterogeneity can result in a variable number of membrane proteins being incorporated into each disc [6] .
[00239] Covalently circularized nanodiscs (cNDs). To improve homogeneity, stability and expand the sizes of nanodiscs, sortase A [7] was used to covalently link the N and C termini of several apoAl variants. As shown in Figure 2A, the protein constructs contain the consensus sequence recognized by sortase A, which are a LPXTG sequence (SEQ ID NO: 51) near the C terminus and a single glycine residue at the N terminus. These two sites are sufficient to ensure covalent linkage between the N and C termini of a protein [8] while still conserving the function to form nanodiscs.
[00240] Initially, circularization was performed over a Cu+2 chip (Figure 2B). Immobilizing proteins on the Cu+2 chip for circularization reduces the chances of intermolecular head-to-tail linkage between two different molecules and decreases reaction time. Negative stain EM was used to confirm that circularized protein retains its ability to assemble into nanodiscs and to assess the size-homogeneity of the discs. The acquired EM images revealed uniformly sized nanodiscs and approximately 90% of the nanodiscs were found to have a diameter between 1 1- 12 nm, as opposed to 32% of nanodiscs assembled with the un-circularized construct (Fig. IE). Using these circularization methods, several high molecular weight (MW) circularized variants were produced and used to prepare circularized nanodiscs (cND) of up to 80 nm in diameter (Fig. 3C). To scale up the circularization reaction, we a method for circularization in solution and also over nickel beads was developed, permitting production of miligram quantities of circularized proteins.
[00241] Polygonal nanodiscs. It was observed that while performing screens to optimize the lipid-to- scaffold-protein ratio, at suboptimal lipid concentrations the circularized high MW variants could also form large nanodiscs of well-defined geometric non-circular shapes (Figs. 4A-4D). The 3X-, 4X-, 5X-,
and 6X-circularized scaffold proteins spontaneously formed triangular, square, pentagonal, and hexagonal shaped nanodiscs. The flexible linkers (LPGTGS (SEQ ID NO: 44)) between each copy of scaffold protein that result from sortase ligation enable these high MW circularized species to assemble nanodiscs with these atypical but well-defined shapes. Each side of these shapes appears to be formed by one copy of scaffold protein. These polygonal nanodiscs can increase the chance for crystallization by encouraging more efficient crystal packing, reducing the degrees of freedom in the scaffold protein by covalent closure, and increasing the stability and homogeneity of the resulting nanodisc.
[00242] Applications for the nanodiscs described herein include:
1- facilitating solution NMR and cryo EM studies of membrane proteins in physiologically relevant conditions (more stable and more homogenous than conventional nanodiscs).
2- Permit structural and functional studies of large membrane proteins (eg. mammalian
respiratory complex) in bilayer.
3- Permit studying membrane protein intaractions with another membrane protein or cytosolic partner.
4- Permit constructions and studying many membrane pores (eg. proapoptotic proteins BAX and BAK pores, anthrax pore etc)
5- Permit studying virus entry to cells (Fig. 6) and screening for potential inhibitors against virus entry.
6- Cell-free expression for large membrane proteins and complexes.
7- Permit Residual Dipolar Coupling (RDC) measurements (detergent free, homogenous effect, charge tunable).
8- Crystallization and 2D lattice.
9- Vaccination (many copies of membrane proteins per disc).
10- Enable studying lipid rafts.
1 1- Studying the fusion of synaptic vesicle membranes with planar bilayer membranes.
[00243] Described herein is the validation of circularized nanodiscs as a novel vaccine platform: Because cNDs particles permit the functional reconstitution of envelope/membrane proteins, the gp41 transmembrane segment plus the highly conserved membrane proximal region (MPER-TM) of HIV, which is an important target for vaccine development, can be incorporated into cNDs and their potential to elicit an immune response and confer immunity to HIV virus challenge investigated. The improved stability, homogeneity and bigger sizes of cNDs relative to conventional nanodiscs make them an ideal platform for vaccine development.
[00244] Described herein is the design of polygonal nanodiscs and testing for crystallization. To improve the yield and prevent these shapes from becoming circular, a series of constructs can are designed with variable numbers of helices (2-6 helices) between each flexible linker. 2 or 3 helices can be fused together to increase the rigidity (Figure 5). In addition, a series of constructs can be based on the amphipathic peptide 18A [9]. The assembled nanodiscs can be examined by negative stain. After scaling up the production of polygonal nanodiscs, 2D or 3D crystallization can be performed with or without incorporated membrane protein. Stable and well-characterized membrane protein can be used for crystallization trials.
[00245] References cited
[1] Bowie JU. Stabilizing membrane proteins. Current opinion in structural biology. 2001;11 :397-402.
[2] Denisov IG, Grinkova YV, Lazarides AA, Sligar SG. Directed self-assembly of monodisperse phospholipid bilayer Nanodiscs with controlled size. J Am Chem Soc. 2004; 126:3477-87.
[3] Bayburt TH, Grinkova YV, Sligar SG. Self-assembly of discoidal phospholipid bilayer nanoparticles with membrane scaffold proteins. Nano Lett. 2002;2:853-6.
[4] Ritchie TK, Grinkova YV, Bayburt TH, Denisov IG, Zolnerciks JK, Atkins WM, et al. Chapter 11 - Reconstitution of membrane proteins in phospholipid bilayer nanodiscs. Methods in enzymology.
2009;464:211-31.
[5] Hagn F, Etzkorn M, Raschle T, Wagner G. Optimized phospholipid bilayer nanodiscs facilitate highresolution structure determination of membrane proteins. Journal of the American Chemical Society. 2013;135: 1919-25.
[6] Raschle T, Hiller S, Yu TY, Rice AJ, Walz T, Wagner G. Structural and functional characterization of the integral membrane protein VDAC-1 in lipid bilayer nanodiscs. Journal of the American Chemical Society. 2009; 131 : 17777-9.
[7] Chen I, Dorr BM, Liu DR. A general strategy for the evolution of bond-forming enzymes using yeast display. Proceedings of the National Academy of Sciences of the United States of America.
2011;108: 11399-404.
[8] Antes JM, Popp MW, Ernst R, Chew GL, Spooner E, Ploegh HL. A straight path to circular proteins. The Journal of biological chemistry. 2009;284: 16028-36.
[9] Anantharamaiah GM, Jones JL, Brouillette CG, Schmidt CF, Chung BH, Hughes TA, et al. Studies of synthetic peptide analogs of the amphipathic helix. Structure of complexes with dimyristoyl
phosphatidylcholine. The Journal of biological chemistry. 1985;260: 10248-55.
EXAMPLE 3
[00246] Design and applications of circularized nanodiscs for studying membrane proteins and viral entry.
[00247] Described herein is a process for producing covalently circularized nanodiscs covering a wide range of defined sizes up to 80 nm in diameter and in a variety of geometric shapes. Further described herein is the use of large nanodiscs to address the poorly understood question of how simple non- enveloped viruses translocate their genomes across membranes to initiate infection, and demonstrate the feasibility of using 50 nm nanodiscs to determine the structure of the RNA translocation pore of poliovirus by cryo-electron microscopy.
[00248] Phospholipid bilayer nanodiscs provide a detergent-free lipid bilayer model, enabling biochemical and biophysical characterization of membrane proteins in a physiologically relevant environment1. A conventional nanodisc is composed of a nanometer-sized phospholipid bilayer patch encircled by two a-helical, amphipathic membrane scaffold proteins (MSPs)2' 3. MSPs are truncated forms of apolipoprotein Al (apoAl), which is the major protein component of high-density lipoprotein. To date, however, the utility of this system for structural studies has been severely limited by the heterogeneity of size and the number of membrane proteins enclosed, and only small nanodiscs could be constructed with the currently available protein scaffolds4"7. To resolve these problems described herein are three different methods to covalently link the N and C termini of newly engineered variants based on apoAl, and the production of nanodiscs with a large range of discrete sizes and defined geometric shapes. The protein constructs described herien contain the consensus sequence recognized by sortase A (LPGTG (SEQ ID NO: 53)) near the C terminus and a single glycine residue at the N terminus (Fig. 2A). These two sites are sufficient to ensure covalent linkage between the N and C termini of a protein 8 while still conserving the function to form nanodiscs.
[00249] Initially, the NW11 construct, which assembles an 11 nm nanodisc, was used to optimize the circularization over a Cu+2 chip (Fig. 2B). In this scheme, the Cu2+ is saturated with un-circularized NW11 protein prior to evolved sortase9 addition. Upon successful completion, the circularized NW 11 (cNWl 1) is liberated to the solution and can be further purified via nickel affinity chromatography. Immobilizing NW11 on the Cu2+ chip for circularization reduces the chances for head-to-tail linkage of two neighboring NW11 molecules and also offers a quick reaction time. Reaction completion was confirmed by SDS-PAGE gel shift (Fig. 2C), and reaction fidelity was confirmed via tandem mass spectrometry (MS/MS) (Fig. 2D). Next, it was tested whether the final circularized product was still capable of assembling nanodiscs. Indeed, cNWl 1 assembled nanodiscs, and the acquired electron microscopy (EM) images revealed uniformly sized nanodiscs. Nearly 89% of the nanodiscs were found to have a diameter between 11-12 nm as opposed to 32% for nanodiscs assembled with the linear
counterpart (Fig. 2E). Even though circularization over a Cu chip usually results in a very clean final product, the approach is limited to small-scale production of circularized protein.
[00250] In order to scale up the production of cNWl 1, the circularization reaction was performed over nickel beads (Fig. 9A). SDS-PAGE analysis showed that cNWl 1 was produced as a mixture with higher molecular weight species that likely arose from head-to-tail ligation of neighboring NWl 1 monomers followed by circularization (Fig. 9B, lane 1). Adding lipids to the already immobilized NWl 1 made the intramolecular circularization the dominant pathway, and higher molecular species were only observed in trace quantities (Fig. 9b, lane 2).
[00251] To increase the yield of cNWl 1, the circularization reaction was performed in solution (Fig. 10). Evolved sortase was added to a dilute NWl 1 solution ([NWl 1] < 15 uM) to suppress linking two or more copies of NWl 1. The reaction was quenched with a covalent sortase inhibitor AAEK210, and cNWl 1 was purified via reverse nickel affinity chromatography. Reaction completion was readily confirmed by SDS-PAGE analysis. With this method, mg quantities of cNWl 1 that is >95% monomeric were produced. Also, an array of higher molecular weight circularized species were produced by adding sortase to a concentrated NWl 1 solution (>100 μΜ). Indeed larger nanodiscs up to 80 nm in diameter were produced (Fig.11).
[00252] Circular dichroism (CD) spectroscopy was used to assess the effect of circularization on the thermal stability of lipid-free and lipid-bound cNWl 1. cNWl 1 has increased thermostability with an apparent midpoint melting temperature (Tm) of 65.4°C compared to 53.8°C for MSP ID 1. Similarly, Lipid-bound cNWl 1 demonstrated better stability compared to lipid-bound MSP ID 1 (Tm of 90°C vs 84.5°C) (Fig. 12A, 12B). The stability of Voltage-Dependent Anion Channel 1 (VDAC 1) in LDAO micelles is increased from 63.8 to 73°C by insertion into MSP 1D 1 nanodiscs, and to 82.2°C when inserted into cNWl 1 nanodiscs (Fig. 12C). Insertion of VDAC 1 into the smaller cNW9 nanodiscs maintains the high Tm of 82°C (Fig. 12D) and limits the number of embedded channels to a single one (Fig. 12E) avoiding the previously observed problem of undefined numbers of embedded channels5. Furthermore, covalent circularization enhances the proteolytic stability of nanodiscs (Figs. 13A-13D).
[00253] During efforts to optimize the lipids/ circularized scaffold proteins ratios, it was observed that at suboptimal lipid proportions the circularized high molecular weight variants could also form nanodiscs of well-defined, non-circular shapes (Fig. 4). The 3X-, 4X-, 5X-, and 6X-cNWl 1 spontaneously formed triangular, square, pentagonal, and hexagonal shaped nanodiscs. The flexible linkers (LPGTGS (SEQ ID NO: 44)] between each copy of NWl 1 that result from sortase ligation enable these high MW
circularized species to assemble nanodiscs with these unusual but well-defined shapes. Each side of these
shapes appears to be formed by one copy of NW11. These polygonal nanodiscs are useful for crystallization efforts by encouraging more efficient crystal packing relative to circular nanodiscs.
[00254] Inspired by the large nanodiscs resulting from ligation of two or more NW11 molecules, DNA constructs NW30 and NW50 were designed to produce sortaggable variants that assemble 30- and 50-nm nanodiscs, respectively. SDS-PAGE analysis (Figs. 3A, 3B) illustrates the purification and circularization of NW30 and NW50. Unlike cNWl 1, the circularized NW30 and NW50 migrate slower than the linear forms. Surprisingly, the cNW30 forms homogenous -15 nm instead of 30 nm nanodiscs as confirmed by negative-stain (Fig 3A). It appears that the protein crosses and folds over itself to form a double belt that can support the bilayer with a single polypeptide. On the other hand, as predicted, circularized NW50 assembled homogenous 50 nm nanodiscs.
[00255] With the characterization of the circularized nanodiscs (cNDs) in place, the cNW50 nanodiscs were used as a model to study the question of how simple non-enveloped viruses transfer their genomes across membranes to initiate infection. Unlike enveloped viruses, non-enveloped viruses lack an external membrane, and the delivery of their genome into cells requires translocation across a membrane to gain access to the inside of the host cell u' 12. Although there are now several model systems being used to study this process, the mechanism of genome translocation remains poorly understood13, and a more detailed structural analysis of the membrane-associated forms of the cell -entry intermediates is required. So far, mechanistic insights have been limited, due in part to technical difficulties involved in direct visualization of viral gene delivery and sample heterogeneity due to size heterogeneity of liposomes. The availability of large nanodiscs with defined size encouraged structural studies provides resolutions sufficient to gain insights into the mechanism of R A translocation. As a proof of principal the cNW50 nanodiscs were used to visualize the RNA-translocation pore of poliovirus.
[00256] Poliovirus (30 nm diameter) is the prototype member of the enterovirus genus of the picornavirus family, which are positive-sense, single-stranded RNA viruses with ~7500b genomes enclosed by an icosahedral capsid, and lacking an envelope14. Viral infection is mediated by a specific receptor, CD155 (also known as the poliovirus receptor, PVR)15. Upon raising the temperature from 4°C to 37°C the receptor catalyzes a conformational rearrangement and expansion of the virus particle. The expanded virus is then endocytosed by a non-canonical, actin-independent pathway16, and the RNA is released across the endosomal membrane, leaving an intact empty particle that is then transported to the perinuclear region. A 50-nm nanodisc is sufficiently large to accommodate multiple CD155 copies and has enough surface area to act as a surrogate membrane for the RNA-translocation complex during viral uncoating (Fig. 6A). Similar to studies that used liposomes17"19, here 50-nm nanodiscs containing lipids derivatized with a NTA nickel-chelating head group were generated and functionalized with the His-
tagged CD 155 ectodomain. The receptor-decorated nanodiscs were incubated with poliovirus for 5 minutes at 4°C. The complex was then heated to 37°C for 15 minutes to initiate receptor-mediated viral uncoating (Fig. 6B). Negative-stain EM confirmed virus binding to the CD 155-decorated nanodiscs and subsequent insertion of viral components into and across the membrane (Fig. 6C). Additionally, the negative-stain EM images indicated that the virus started to form a pore in the nanodisc. To obtain a view of the molecular interactions involved in the RNA-translocation complex as well as to elucidate in more detail the formation of a pore, cryo-EM studies were conducted using an FEI Polara electron microscope. Figure 6D and 13 show the dark RNA-filled virus next to the slightly larger 50 nm nanodisc. The nanodisc is tilted in Figure 8E and tethered to the virus in Figure 6F. The formation of a putative pore inside the nanodiscs (Fig. 6G, 6H), through which the virus ejects its RNA was visualized. The images indicate that the pore is formed by several viral proteins whose number and identities are currently being determined. The availability of the circularized 50-nm nanodiscs greatly facilitates imaging as compared to using liposomes because the nanodiscs are more homogenous in size and shape, and allow for the use of a thinner ice layer. Also, RNA can be visualized more easily in the absence of large liposomal membranes. In order to reduce complexity even further, cNW30 nanodiscs (15 nm) decorated with CD 155 were used. Surprisingly, the virus also tethers to this smaller nanodisc (Fig. 61), forms a pore and ejects RNA, leaving an empty viral capsid behind (Fig. 6J). The quality of the data collected on the virus- nanodisc complexes represents a vast improvement over data previously used to obtain low-resolution structural models of the translocation complex using the receptor-decorated liposome model20, and indicates that the nanodisc model permits determination of structures with greatly improved resolution and quality.
[00257] In conclusion, it is demonstrated herein that it is possible to construct covalently circularized nanodiscs with a wide range of geometric shapes and sizes. The ability to make stable cNDs at variable sizes up to 80 nm diameter provides a tool to tightly embed much larger membrane proteins or their intra- and extra-membrane complexes than previous nanodiscs systems have allowed. Moreover, the newly engineered covalently circularized nanodiscs produce nanodiscs with high homogeneity in size and shape and have significantly improved stability compared to non-circularized forms, both of which greatly facilitate their use for cryo-EM and other biophysical approaches. The utility of this model system to probe an outstanding question in the field of virology is demonstrated and the data indicate that the system is suitable for the structural and functional study of other large protein/membrane complexes.
[00258] Expression ofNW9, NW11, NW30 andNW50. NW9, NW1 1, NW30 and NW50 (all in pET- 28a) containing a TEV-cleavable N-terminal His6 tag (SEQ ID NO: 54) and a C-terminal sortase- cleavable His6 tag (SEQ ID NO: 54) were transformed into BL21-Gold (DE3) competent E. coli cells
(Agilent). 3L cell cultures were grown at 37°C, 200 rpm in Luria broth (LB) medium supplemented with 50 μg/ml Kanamycin, and expression was induced with 1 mM IPTG at an OD600 of 0.8 for 3 hours at 37°C (NW9 and NW11) or 16 hours at 18°C (NW30 and NW50). Cells were harvested by centrifugation (7000xg, 15 minutes, 4°C) and cell pellets were stored at -80°C.
[00259] Purification ofNW9 and NW11. Cell pellets expressing NW9 or NW11 were resuspended in lysis buffer (50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 1% Triton X-100) and lysed by sonication on ice. Lysate was centrifuged (35,000xg, 50 minutes, 4°C) and the supernatant was filtered and loaded onto Ni2+-NTA column. The column was washed with lysis buffer then with buffer A (50 mM Tris, pH 8.0, 500 mM NaCl). To recover additional protein from the insoluble fractions, the pellets recovered from lysate centrifugation were dissolved in denaturing buffer (50 mM Tris, pH 8.0, 500 mM NaCl, 6M guanidine hydrochloride), centrifuged (35,000xg, 50 minutes, 4°C), and the supernatant was applied to the same Ni2+-NTA column containing bound protein from the soluble fraction. The column was washed with denaturing buffer, and NW9 and NW11 were refolded on-column with 10 column volumes (CV) buffer A. Resin was then washed with 10 CV of the following: buffer A + 1% Triton X-100, buffer A + 50 mM sodium cholate, buffer A, and buffer A + 20 mM imidazole. Proteins were eluted with buffer A + 500 mM imidazole, TEV (His6-tagged (SEQ ID NO: 54); produced in-house) was added to cleave the N- terminal His6 tag (SEQ ID NO: 54), and the samples were dialyzed against 50 mM Tris-HCl, pH 8.0, 20 mM NaCl, 1 mM EDTA, 2 mM DTT at 4°C for 16 hours. NW9 and NW11 (still containing a C-terminal His6 tag (SEQ ID NO: 54)) were exchanged into nanodisc-assembly buffer (50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 0.02% NaN3) using centricon concentrators (10 kDa MW cutoff, Millipore).
[00260] Purification ofiNW30 andNW50. NW30 and NW50 were purified under denaturing conditions and refolded as follows. Pellets of cells expressing NW30 or NW50 were resuspended in denaturing lysis buffer (50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 6M guanidine hydrochloride) and lysed by sonication on ice. Lysate was centrifuged (35000xg, 50 minutes, 4°C) and the supernatant was filtered and loaded onto Ni2+-NTA column. Resin was washed with 10 column volumes (CV) of denaturing lysis buffer to remove unbound proteins, and NW30 and NW50 were refolded on-column with 10 CV buffer A (50 mM Tris HC1, pH 8.0, 500 mM NaCl). Resin was washed with 10 CV of the following: buffer A + 1% Triton X-100, buffer A + 50 mM sodium cholate, buffer A, and buffer A + 20 mM imidazole.
Proteins were eluted with buffer A + 500 mM imidazole, TEV was added to cleave the N-terminal His6 tag (SEQ ID NO: 54), and samples were dialyzed against 50 mM Tris, pH 8.0, 20 mM NaCl, 1 mM EDTA, 2 mM DTT at 4°C for 16 hours. NW30 and NW50 (still containing a Cterminal His6 tag (SEQ ID NO: 54)) were further purified by size exclusion chromatography (SEC; Superdex 200 16/60 [GE Healthcare] equilibrated in 20 mM Tris-HCl, pH 7.5, 500 mM NaCl, 50 mM sodium cholate, 0.5 mM
EDTA). SEC fractions containing NW30 and NW50 were further purified over Ni2+-NTA resin to remove truncation products (which lack a C-terminal His6 tag (SEQ ID NO: 54)). Purified proteins were exchanged into nanodisc assembly buffer (50 mM Tris HC1, pH 8.0, 500 mM NaCl, 0.02% NaN3) using centricon concentrators (30 kDa MW cutoff, Millipore).
[00261] MSP circularization. A 50 mL reaction was prepared with 10 μΜ NWs and 5 μΜ (final concentrations) freshly made evolved sortase in 300 mM Tris-HCl, pH 7.5, 150 mM NaCl, and 10 mM CaC12. The reaction was incubated at 4°C for 16 hours or at 25°C for 4 hours with gentle shaking on a rotating platform. A covalent sortase inhibitor AAEK2 was added to a concentration of 500 μΜ, and the solution was incubated further for 30 minutes at room temperature with gentle shaking. Proteins that did not undergo circularization were removed by binding to Ni2+-NTA column. Circularized NWs (cNWs) were further purified by size-exclusion chromatography (Superdex 75 16/60) equilibrated in 20 mM Tris HC1, pH 7.5, 500 mM NaCl, 50 mM sodium cholate, 0.5 mM EDTA.
[00262] Reconstitution of cNWll, cNW30 and cNW50 nanodiscs. cNWs:lipid ratios of 1 :60, 1 :75, 1 : 1000 and 1 :4000 were used to assemble cNW9, cNWl 1, cNW30, cNW50 nanodiscs respectively. Lipids (POPC:POPG 3:2, solubilized in sodium cholate) and cNWs were incubated on ice for 1 hour. After incubation, sodium cholate was removed by the addition of Bio-beads SM-2 (Bio-Rad) and incubation on ice for 1 hour followed by overnight incubation at 4°C. The nanodisc preparations were filtered through 0.45-μπι nitrocellulose-filter tubes to remove the Bio-beads. The nanodisc preparations were further purified by size-exclusion chromatography while monitoring the absorbance at 280 nm on a Superdex 200 10x300 column (for cNW9 and cNWl 1 nanodiscs) or Superose 6 10/300 column (for cNW30 and cNW50 nanodiscs) equilibrated in 20 mM Tris HC1, pH 7.5, 100 mM NaCl, 0.5 mM EDTA. Fractions corresponding to the size of each nanodisc were collected and concentrated. The purity of nanodisc preparations was checked using SDS-PAGE.
[00263] In vitro reconstitution ofVDAC-1 into POPC/POPG nanodiscs. In order to assemble VDAC- 1 into POPC/POPG nanodiscs, 15 μΜ of VDAC-1 (solubilized in LDAO), 150 μΜ of cNWl 1 and 8.5 mM lipids (POPC:POPG 3 :2, solubilized in sodium cholate) were incubated over ice for 1 hour. After incubation, LDAO and sodium cholate were removed by the addition of Bio-beads SM-2™ (Bio-Rad) and incubation on ice for 1 hour followed by overnight incubation at 4°C. The disc preparation was filtered through 0.45-μπι nitrocellulosefilter tubes to remove the Bio-beads™. To remove the VDAC-free nanodiscs, the sample was mixed with Ni2+-NTA resin for 1 hour at 4°C. The resin bed volume was equal to the assembly mixture. The resin was washed with buffer E (20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 15 mM imidazole). Nanodiscs containing VDAC were eluted with buffer E containing 0.3 M imidazole.
[00264] The nanodisc preparation was further purified by size-exclusion chromatography while monitoring the absorbance at 280 nm on a Superdex 200 10x300 column (GE Healthcare) with 20 mM Tris-HCl, pH 7.5, 0.1 mM NaCl at 0.5 mL/minute. Fractions corresponding to the size of the VDAC- nanodisc complex were collected and concentrated. The purity of VDAC containing nanodiscs was checked using SDS-PAGE.
[00265] Negative-stain electron microscopy. Samples were prepared by conventional negative staining as described previously21. Briefly, 3.5 μΐ of nanodisc samples were adsorbed to carbon-coated copper grids and stained with 0.75% (w/v) uranyl formate. EM images were collected with a Philips CM 10™ electron microscope (FEI) equipped with a tungsten filament and operated at an acceleration voltage of 100 kV. Images were recorded with a Gatan 1 K χ 1 K™ CCD camera (Gatan, Inc.,
Pleasanton, CA, USA). Images were analyzed with the Image J™ software22.
[00266] Cryo-electron microscopy. A 3.5 ul droplet of the poliovirus-nanodisc complex was loaded onto a glow-discharged holey grid (Protochips, Morrisville, NC). The excess liquid was removed from the grid surface before it was rapidly plunged into liquid ethane. Grids were transferred to an FEI Polara™ electron microscope operating at an acceleration voltage of 300 keV. Micrographs were acquired on a K2 Summit™ camera (Gatan, Pleasanton, CA) in super-resolution mode using SerialEM23™, whereby 25 frames were collected to a total dose of 30 electrons per square angstrom. These frames were aligned and averaged using motioncorr24.
[00267] Table 1 - Characterization of intact NW proteins by mass spectrometry.
[00268] References
1. Bayburt, T.H., Carlson, J.W. & Sligar, S.G. J Struct Biol 123, 37-44 (1998).
2. Bayburt, T.H., Grinkova, Y.V. & Sligar, S.G. Nano Letters 2, 853-856 (2002).
3. Ritchie, T.K. et al. Methods Enzymol 464, 211-31 (2009).
4. Hagn, F., Etzkorn, M., Raschle, T. & Wagner, G. J Am Chem Soc 135, 1919-25 (2013).
5. Raschle, T. et al. J Am Chem Soc 131, 17777-9 (2009).
6. Grinkova, Y.V., Denisov, I.G. & Sligar, S.G. Protein Eng Des Sel 23, 843-8 (2010).
7. Raschle, T., Hiller, S., Etzkorn, M. & Wagner, G. Current opinion in structural biology 20, 471-9 (2010).
8. Antos, J.M. et al. J Biol Chem 284, 16028-36 (2009).
9. Chen, I., Dorr, B.M. & Liu, D R. Proc Natl Acad Sci U S A 108, 11399-404 (2011).
10. Maresso, A.W. et al. J Biol Chem 282, 23129-39 (2007).
11. Hogle, J.M. Annual Review of Microbiology 56, 677-702 (2002).
12. Tuthill, T.J., Groppelli, E., Hogle, J.M. & Rowlands, D.J. Cell Entry by Non-Enveloped Viruses 343, 43-89 (2010).
13. Marsh, M. & Helenius, A. Cell 124, 729-40 (2006).
14. Tuthill, T.J., Groppelli, E., Hogle, J.M. & Rowlands, D.J. Curr Top Microbiol Immunol 343, 43- 89 (2010).
15. Mendelsohn, C.L., Wimmer, E. & Racaniello, V.R. Cell 56, 855-65 (1989).
16. Brandenburg, B. et al. PLoS Biol 5, el83 (2007).
17. Tuthill, T.J., Bubeck, D., Rowlands, D.J. & Hogle, J.M. J Virol 80, 172-80 (2006).
18. Bubeck, D., Filman, D.J. & Hogle, J.M. Nat Struct Mol Biol 12, 615-8 (2005).
19. Strauss, M., Levy, H.C., Bostina, M., Filman, D.J. & Hogle, J.M. J Virol 87, 3903-14 (2013).
20. Strauss, M. et al. J Virol 89, 4143-57 (2015).
21. Ohi, M., Li, Y., Cheng, Y. & Walz, T. Biol Proced Online 6, 23-34 (2004).
22. Schneider, C.A., Rasband, W.S. & Eliceiri, K.W. Nat Methods 9, 671-5 (2012).
23. Mastronarde, D.N. J Struct Biol 152, 36-51 (2005).
24. Li, X., Grigorieff, N. & Cheng, Y. J Struct Biol 172, 407-12 (2010).
[00269] Protein sequences
[00270] SEQ ID No: 1 NW9
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGA AALEHHHHHH
[00271] SEQ ID NO: 2 NW11
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00272] SEQ ID NO: 3 NW30
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTG
AAALEHHHHHH
[00273] SEQ ID NO: 4 NW50
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTT KLNTQLPGTGAAALEHHHHHH
EXAMPLE 4: Covalently Circularized Nanodiscs for Structural and Functional Studies of Membrane Proteins
[00274] The physicochemical environment enveloping a membrane protein in vitro is critical to fully understand the molecular behavior in a biologically relevant context. Although micelles and bicelles have produced significant results, detergents can alter dynamic protein behavior and hinder interactions between a membrane protein and its cytosolic partner(s). Conventional nanodiscs are composed of a nanometer-sized phospholipid bilayer encircled by two a helical, amphipathic membrane scaffold proteins (MSPs). These particles provide a unique detergent free lipid bilayer model enabling biochemical and biophysical characterization of membrane proteins in a physiologically relevant medium. Recently, nanodiscs have been used to investigate the structure and function of different membrane proteins using solution NMR.
[00275] Although the MSPs used in a particular nanodisc preparation are the same length, the distribution in diameter of an assembled disc can be broad. This can result in a variable number of membrane proteins incorporating into each disc, and obtaining a sample with a mixed population of membrane proteins per nanodisc that lead to confounding results. To overcome these issues described herein are nanodiscs assembled with circularized MSPs (cMSP). Described herein are different methods to covalently link the N and C terminus of an MSP polypeptide using evolved sortase. Sortase reaction fidelity has been confirmed by mass spectrometry of the cMSP polypeptide. The homogeneity in particle diameter was a narrow distribution using negative -stain EM. Using the circularization method, nanodiscs of different sizes up to 100 nm in diameter can be constructed.
[00276] Methods
[00277] Described herein are three methods to create circularized MSP.
[00278] A- creating circularized MSP over Cu+2 (Fig. 8). This method results in the cleanest product. It is suitable for, e.g., small-scale production of circularized MSP.
[00279] B- Circularization of MSP over Ni2+ bead. His-tagged MSP is attached to Ni beads then some lipids are added to MSP and finally sortase is added. Adding lipid to MSP first can minimizes the multimerization by-products and maximize the intramolecular circularization. This method is suitable for, e.g., large-scale production of cMSP.
[00280] C- Circularization of MSP in solution. His-tagged MSP is diluted in sortase buffer (MSP final cone < 15 uM) then sortase is added. The reaction is quenched by adding the sortase covalent inhibitor AAEK2 (final cone 0.5 mM). The reaction mixture is run through Ni column and the flow through collected. This method is suitable for, e.g., large-scale production of cMSP.
[00281] Results
[00282] Figs. 2E demonstrates, via negative stain EM, that the circularized nanodiscs described herein are more homogenous than conventional nanodiscs. Figs. 2C-2E depict characterization of the
circularized nanodiscs. Large nanodisc sizes can be achieved with the methods described herein (Fig. 3A-3C).
[00283] It is specifically contemplated herein that the presently described circularized nanodiscs can be used for the following non-limiting applications:
Small circularized nanodiscs (<12 nm)
1- facilitating solution NMR studies of membrane proteins in physiologically relevant conditions (more stable and more homogenous than conventional nanodiscs)
2- Allow for detergent titrations and the transfer of NMR assignments (detergent to nanodisc) because of its high stability.
Large circularized nanodiscs (10- 100 nm)
1- Permit structural and functional studies of large membrane proteins (eg. FepA and mammalian respiratory complex) in bilayer
2- Permit studying membrane protein intaractions with another membrane protein or cytosolic partner
3- Permit constructions and studying many membrane pores (eg. proapoptotic proteins BAX and BAK pores, anthrax pore etc)
4- Permit studying virus entry to cells (Figs. 6A-6J) and screening for potential inhibitors against virus entry
5- Cell-free expression for large membrane proteins and complexes.
6- Permit Residual Dipolar Coupling (RDC) measurements (detergent free, homogenous effect, charge tunable)
7- Crystallization and 2D lattice
8- Limited proteolysis of membrane proteins (more stable than conventional nanodisc)
9- Vaccination (many copies of membrane proteins per disc)
10- Studying how Apolipoprotein A- l interact with lipids since the size of the large nanodisc is suitable for cryo-EM size range.
1 1- Permit studying lipid rafts.
12- Studying the fusion of synaptic vesicle membranes with planar bilayer membranes. [00284] Protein sequences
[00285] SEQ ID NO: 6 NW9 (assemble ~ 9 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGA AALEHHHHHH
[00286] SEQ ID NO : 7 NW 10 (assemble ~ 10 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00287] SEQ ID NO : 8 NW 18 (assemble ~ 18 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00288] SEQ ID NO: 9 NW20 (assemble ~ 20 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQLPGTGAAALEHHHHHH
[00289] SEQ ID NO: 10 NW27 (assemble ~ 27 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGA
AALEHHHHHH
[00290] SEQ ID NO: 11 NW30 (assemble ~ 30 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTG
AAALEHHHHHH
[00291] SEQ ID NO: 12 NW36 (assemble ~ 36 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00292] SEQ ID NO: 13 NW40 (assemble ~ 40 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHH
HH
[00293] SEQ ID NO: 14 NW45 (assemble ~ 45 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGA
AALEHHHHHH
[00294] SEQ ID NO: 15 NW50 (assemble ~ 50 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTOLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00295] SEQ ID NO: 16 NW54 (assemble ~ 54 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00296] SEQ ID NO: 17 NW60 (assemble ~ 60 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTOLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMS
KDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMR
DRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALE
DLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00297] SEQ ID NO: 18 NW63 (assemble ~ 63 nm)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGA
AALEHHHHHH
[00298] SEQ ID NO: 19 NW70 (assemble ~ 70 nm)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMS
KDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMR
DRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALE
DLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDA
LRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL
ESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00299] SEQ ID NO: 20 NW72 (assemble ~ 72 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR
AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN
GGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQ
EFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLGEEMRDRAR AHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ GLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALEHHHHHH
[00300] SEQ ID NO: 21 NW80 (assemble ~ 80 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMS
KDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMR
DRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALE
DLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDA
LRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL
ESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQK
KWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDE
LRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALE
EYTKKLNTQLPGTGAAALEHHHHHH
[00301] SEQ ID NO: 22 NW90 (assemble -90 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMS
KDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMR
DRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALE
DLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDA
LRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL
ESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQK
KWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDE
LRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALE
EYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR
QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLE
ALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
LPGTGAAALEHHHHHH
[00302] SEQ ID NO : 23 NW 100 (assemble ~ 100 nm nanodisc)
MGSSHHHHHHENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTH
LAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFK
VSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQ
EEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ
RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT
KKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKV
EPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKE
NGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVT
QEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGA
RQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYH
AKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKE
TEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEK
LSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTL
SEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMS
KDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMR
DRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALE
DLRQGLLPVLESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDA
LRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL
ESFKVSFLSALEEYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQK
KWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDE
LRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALE
EYTKKLNTQGTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR
QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLE
ALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
GTPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAE
LQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGAR
LAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLPGTGAAALE
HHHHHH
[00303] SEQ ID NO: 5
1 mkaavltlav lfltgsqarh fwqqdeppqs pwdrvkdlat vyvdvlkdsg rdyvsqfegs
61 algkqlnlkl ldnwdsvtst fsklreqlgp vtqefwdnle keteglrqem skdleevkak
121 vqpylddfqk kwqeemelyr qkveplrael qegarqklhe lqeklsplge emrdrarahv
181 dalrthlapy sdelrqrlaa rlealkengg arlaeyhaka tehlstlsek akpaledlrq
241 gllpvlesfk vsflsaleey tkklntq
EXAMPLE 5
[00304] A loopable membrane scaffold protein was designed based on SEQ ID NO: 2, with the inclusion of substitution mutations at residues 36, 110, and 175 (SEQ ID NO: 62, NW11_3C). SDS- PAGE analysis of the circularized form of this protein is depicted in Fig. 19.
EXAMPLE 6: A NEW GENERAL-PURPOSE PHOSPHOLAMBAN-BASED SCAFFOLD FOR PEPTIDE IMMUNOGEN CONSTRUCTION
[00305] The methods and compositions described herein relate to antiviral immunology. In some embodiments of any of the aspects, the invention involves the reconstruction of immunogens using the phospholamban (PLN) TM helix as a general stable, low-cost scaffold. Potential applications include subunit vaccine construction as well as the production of diagnostic antibodies.
[00306] It is estimated that 2.3 million people become newly infected annually with the human immunodeficiency virus (HIV), the virus that causes AIDS, one of the most deadly infectious diseases in the history of mankind. A major challenge of HIV-1 vaccine development has been the great diversity of viral isolates. Developing a vaccine that overcomes the diversity of HIV-1 is likely to require a strategy that directs antibody (Ab) responses toward conserved regions of the viral Envelope (Env). However, the generation of neutralizing Abs (NAbs) targeting these regions through vaccination has proven to be very difficult. One conserved region of particular interest is the membrane proximal external region (MPER) of Env located within the gp41ectodomain. MPER Plays an important role in membrane fusion and contains epitopes of three well-characterized human broadly neutralizing monoclonal Abs; 2F5, 4E10, and 10E8.
[00307] In order to direct the immune response to this region, the phospholamban (PLN, Figs. 20A- 20B) transmembrane helix was used as a scaffold for attaching MPER, displaying up to 5 copies per complex on the membrane surface (Figs. 21A-21B). The phospholamban (PLN) TM helix provides a stable pentameric TM scaffold that coincidentally share the first three amino acid residues at the beginning of the PLN-TM region "LFI" with the natural TM sequence of HXB2-gp41 immediately following the MPER segment. Preliminary negative-stain EM images show that pre-formed 10E8 binds to MPER-PLN chimara incorporated in nanodisc (Figs. 22A-22B). Moreover, immunogenicity data indicate that mice immunized with MPER-PLN chimera elicited antibodies specific to MPER.
[00308] Immunized mice received membrane presented MPER-phospholamban fusion protein displayed on nanodiscs (lOOug of MPER-phospholamban:nanodisc per mouse). Mice were immunized three times at 3 -week intervals via subcutaneous tail-base injection in conjunction with 5ug/mouse CDN adjuvant-loaded liposomes. No MPER-specific IgG antibodies are detected in any naive mice. A MPER- specific antibody response is generated to nanodisc delivered MPER-immunogen (Fig 27). When nanodiscs containing MPER-Phospholamban were administered to mice, high titer immune responses specific to both MPER and human MSP, the membrane scaffold protein that wrap around nanodisc, were generated after two immunizations (Fig. 28)
[00309] PLN-TM offers the following advantages as a vaccine scaffold:
a. Stable pentameric scaffold TM that share the first three amino acid residues with the natural TM sequence of HXB2-gp41 immediately following the MPER segment.
b. MPER-PLN chimera (-50 AA) can be synthesized by conventional peptide synthesis techniques as well as expressed in E. coli or other expression systems. c. Permits mixing and control of how many MPER arms are present per nanodisc thus control distances between each MPER copy.
d. Pore formation can be clearly shown by negative-stain EM that permits verification of incorporation and whether there are aggregations or not.
e. The hybrid MPER-PLN can be readily incorporated into nanodisc or liposomes to permit preparation of immunogens.
f. Mice that were immunized with nanodiscs including PLN-TM displaying MPER elicited MPER- specific Ab responses.
[00310] SEQ ID NO: 113 Phospholamban transmembrane domain
LFINFCLILICLLLICIIV
[00311] SEQ ID NO: 114 Phospholamban transmembrane domain
LFVNFCLILICLLLICIIV
Claims
1. A vaccine scaffold polypeptide comprising at least the transmembrane domain of a single a-helix transmembrane protein, or a variant thereof.
2. The polypeptide of claim 1, wherein the single a-helix transmembrane protein is selected from the group consisting of:
phospholamban; influenza M2 channel protein; stannin; Vpu; HIV Vpu; parainfluenza 5 fusion protein; parainfluenza fusion protein; E protein; SARS-CoV E; SH protein; and RSV-SH.
3. The polypeptide of any of claims 1-2, wherein the transmembrane domain is the sequence of one of SEQ ID NOs: 95-101, 1 13, or 1 14.
4. The polypeptide of any of claims 1-2, wherein the variant of the transmembrane domain is a sequence with at least 90% homology to one of SEQ ID NO: 95-101, 1 13 or 1 14.
5. An immunogenic conjugate polypeptide comprising:
a. at least one antigen polypeptide conjugated to;
b. a vaccine scaffold polypeptide of claims 1-4.
6. The polypeptide of claim 5, wherein the antigen polypeptide is conjugated to the N-terminus of the vaccine scaffold polypeptide.
7. The polypeptide of claim 5 wherein the antigen polypeptide is conjugated to the C-terminus of the vaccine scaffold polypeptide.
8. The polypeptide of any of claims 5-7, wherein the antigen polypeptide is a viral envelope protein, a cell surface protein, or portion thereof.
9. The polypeptide of any of claims 5-8, wherein the antigen polypeptide is an HIV protein or
portion thereof.
10. The polypeptide of any of claims 5-9, wherein the antigen polypeptide is the membrane proximal external region (MPER) of Env.
1 1. The polypeptide of any of claims 5-9, wherein the antigen polypeptide is the 10E8 epitope or the
4E10 epitope.
12. The polypeptide of any of claims 5-1 1, comprising multiple repeats of the same antigen
polypeptide.
13. The polypeptide of any of claims 5-12, comprising multiple different antigen polypeptides.
14. The polypeptide of any of claims 12-13, wherein the antigen polypeptides or repeats thereof are separated by a linker.
15. The polypeptide of claim 14, wherein the linker is hydrophobic.
16. The polypeptide of claim 14, wherein the linker is hydrophilic.
17. The polypeptide of any of claims 14-16, wherein the linker is from 1 to 5 amino acids in length.
18. The polypeptide of any of claims 5-17, wherein the immunogenic polypeptide comprises from 1 to 5 copies of the antigen polypeptide.
19. The polypeptide of any of claims 5-18, wherein the antigen polypeptide and the vaccine scaffold polypeptide are joined by a linker.
20. The polypeptide of claim 19, wherein the linker is hydrophobic.
21. The polypeptide of claim 19, wherein the linker is hydrophilic.
22. The polypeptide of any of claims 19-21, wherein the linker is from 1 to 5 amino acids in length.
23. A nucleic acid encoding the vaccine scaffold polypeptide of any of claims 1-5 or the
immunogenic conjugate polypeptide of any of claims 5-22.
24. A polypeptide complex comprising a polymeric complex of the polypeptides of any of claims 1-
23.
25. A composition comprising a polypeptide complex of claim 24 and/or the immunogenic conjugate polypeptide of any of claims 5-22 embedded in the phospholipid bilayer of a liposome or nanodisc.
26. The composition of claim 25, wherein the phospholipid bilayer comprises a viral membrane lipid; anionic lipid; or synthetic lipid.
27. The composition of claim 25, wherein the phospholipid bilayer comprises cholesterol.
28. The composition of any of claims 25-27, wherein each liposome or nanodisc comprises 10 or fewer copies of the antigen polypeptide.
29. The composition of any of claims 25-28, wherein each liposome or nanodisc comprises 5 or fewer copies of the antigen polypeptide.
30. A pharmaceutical composition comprising the composition of any of claims 25-29 and a
pharmaceutically acceptable carrier.
31. The composition of claim 30, further comprising an adjuvant.
32. A method of inducing an immune response in a subject, the method comprising administering to the subject a composition of any of claims 25-31.
33. The method of claim 32, wherein the immune response comprises immunization.
34. The method of claims 32-33, wherein the subject is further administered an adjuvant.
35. The method of claim 34, wherein the compositions of any of claims 24-30 is admixed with the adjuvant prior to administration.
36. The method of any of claims 32-35, wherein the administration is a prime administration and/or a boost administration.
37. The method of any of claims 32-36, wherein the subject is further administered a second vaccine.
38. The method of any of claims 32-37, further comprising a step of isolating from the subject: a. an antibody that specifically binds to the antigen polypeptide;
b. a nucleic acid encoding an antibody that specifically binds to the antigen polypeptide; or c. a cell comprising a nucleic acid sequence encoding an antibody that specifically binds to the antigen polypeptide.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662363395P | 2016-07-18 | 2016-07-18 | |
| US62/363,395 | 2016-07-18 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018017443A1 true WO2018017443A1 (en) | 2018-01-25 |
Family
ID=60992492
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/042307 Ceased WO2018017442A1 (en) | 2016-07-18 | 2017-07-17 | Methods and compositions relating to covalently circularized nanodiscs |
| PCT/US2017/042308 Ceased WO2018017443A1 (en) | 2016-07-18 | 2017-07-17 | Immunogenic compositions and methods relating thereto |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/042307 Ceased WO2018017442A1 (en) | 2016-07-18 | 2017-07-17 | Methods and compositions relating to covalently circularized nanodiscs |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US11053301B2 (en) |
| EP (1) | EP3484912B1 (en) |
| AU (1) | AU2017299505B2 (en) |
| CA (1) | CA3030855A1 (en) |
| WO (2) | WO2018017442A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023028497A1 (en) * | 2021-08-24 | 2023-03-02 | The Regents Of The University Of California | Compositions and methods comprising lipid associated transmembrane domains |
| EP4161944A4 (en) * | 2020-06-09 | 2024-08-07 | The University of Queensland | A fusion protein |
| WO2025071970A1 (en) * | 2023-09-26 | 2025-04-03 | Duke University | Membrane proximal external region (mper) from hiv that stimulates broadly neutralizing antibodies (bnabs) |
Families Citing this family (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110117312B (en) * | 2018-02-07 | 2022-03-18 | 安升(上海)医药科技有限公司 | Lipid binding protein-antigen capture module complex, and preparation method and application thereof |
| EP3876909A4 (en) * | 2018-11-08 | 2022-09-28 | Nasr, Mahmoud | NANODIKS FOR THE PREVENTION AND TREATMENT OF PATHOGENIC INFECTIONS AND METHODS OF USE THEREOF |
| CN114667293A (en) * | 2019-09-24 | 2022-06-24 | Mvrix株式会社 | Nano-perforators with enhanced antiviral activity |
| CN111450243B (en) * | 2020-04-29 | 2022-08-26 | 合肥中科长木生物科技有限公司 | Influenza virus nano vaccine and preparation method thereof |
| US20220211624A1 (en) * | 2021-01-06 | 2022-07-07 | Washington University | Fusion protein nanodisk compositions and methods of treatment |
| WO2023284742A1 (en) * | 2021-07-13 | 2023-01-19 | Westlake Therapeutics (Hangzhou) Co. Limited | Cells modified by conjugated n-terminal glycine and uses thereof |
| EP4465967A1 (en) * | 2022-01-20 | 2024-11-27 | Emory University | Phosphate membrane nanodiscs conjugated to therapeutic agents and medical uses thereof |
| KR102610178B1 (en) * | 2023-02-07 | 2023-12-06 | 엠브릭스 주식회사 | Nanodisc containing membrane scaffold protein fused with angiotensin converting enzyme 2 |
| US20250152681A1 (en) * | 2022-02-21 | 2025-05-15 | Research & Business Foundation Sungkyunkwan University | Nanodisc comprising angiotensin converting enzyme 2 |
| CN116622754A (en) * | 2023-05-31 | 2023-08-22 | 南开大学 | A kind of transmembrane protein nanodisk with fixed-point labeling and its preparation method and application |
| KR102743940B1 (en) * | 2023-10-06 | 2024-12-19 | 엠브릭스 주식회사 | Nanodisc with angiotensin converting enzyme 2 and Fc fragment and uses thereof |
| WO2025137409A1 (en) * | 2023-12-21 | 2025-06-26 | University Of Florida Research Foundation, Incorporated | Supercharged lipid nanodiscs and methods of use |
| WO2025244967A1 (en) * | 2024-05-20 | 2025-11-27 | The Brigham And Women's Hospital, Inc. | Compositions and methods for donor-specific antibody screening and tissue typing |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110305723A1 (en) * | 2001-01-19 | 2011-12-15 | Cytos Biotechnology Ag | Molecular Antigen Array |
| US20130337002A1 (en) * | 2010-12-02 | 2013-12-19 | Bionor Immuno As | Peptide scaffold design |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7622437B2 (en) | 2000-11-20 | 2009-11-24 | The Board Of Trustees Of The University Of Illinois | Tissue factor compositions and methods |
| US7083958B2 (en) | 2000-11-20 | 2006-08-01 | The Board Of Trustees Of The University Of Illinois | Membrane scaffold proteins |
| US7592008B2 (en) * | 2000-11-20 | 2009-09-22 | The Board Of Trustees Of The University Of Illinois, A Body Corporate And Politic Of The State Of Illinois | Membrane scaffold proteins |
| WO2002040501A2 (en) | 2000-11-20 | 2002-05-23 | The Board Of Trustees Of The University Of Illinois | Membrane scaffold proteins |
| WO2010087994A2 (en) | 2009-01-30 | 2010-08-05 | Whitehead Institute For Biomedical Research | Methods for ligation and uses thereof |
| EP2832741A1 (en) | 2013-07-30 | 2015-02-04 | Commissariat A L'energie Atomique Et Aux Energies Alternatives | Method of crystallization of membrane proteins and to compositions, devices and kits to conduct such method |
| WO2018213372A1 (en) * | 2017-05-16 | 2018-11-22 | President And Fellows Of Harvard College | Nucleic acid-lined nanodiscs |
-
2017
- 2017-07-17 AU AU2017299505A patent/AU2017299505B2/en active Active
- 2017-07-17 WO PCT/US2017/042307 patent/WO2018017442A1/en not_active Ceased
- 2017-07-17 US US16/317,924 patent/US11053301B2/en active Active
- 2017-07-17 EP EP17831615.4A patent/EP3484912B1/en active Active
- 2017-07-17 CA CA3030855A patent/CA3030855A1/en active Pending
- 2017-07-17 WO PCT/US2017/042308 patent/WO2018017443A1/en not_active Ceased
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110305723A1 (en) * | 2001-01-19 | 2011-12-15 | Cytos Biotechnology Ag | Molecular Antigen Array |
| US20130337002A1 (en) * | 2010-12-02 | 2013-12-19 | Bionor Immuno As | Peptide scaffold design |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4161944A4 (en) * | 2020-06-09 | 2024-08-07 | The University of Queensland | A fusion protein |
| WO2023028497A1 (en) * | 2021-08-24 | 2023-03-02 | The Regents Of The University Of California | Compositions and methods comprising lipid associated transmembrane domains |
| WO2025071970A1 (en) * | 2023-09-26 | 2025-04-03 | Duke University | Membrane proximal external region (mper) from hiv that stimulates broadly neutralizing antibodies (bnabs) |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3030855A1 (en) | 2018-01-25 |
| US20190233501A1 (en) | 2019-08-01 |
| EP3484912B1 (en) | 2021-10-20 |
| AU2017299505A1 (en) | 2019-01-31 |
| WO2018017442A1 (en) | 2018-01-25 |
| EP3484912A1 (en) | 2019-05-22 |
| US11053301B2 (en) | 2021-07-06 |
| AU2017299505B2 (en) | 2021-10-21 |
| EP3484912A4 (en) | 2020-01-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11053301B2 (en) | Methods and compositions relating to covalently circularized nanodiscs | |
| US12234265B2 (en) | Stabilized RSV F proteins and uses thereof | |
| JP2023527556A (en) | Engineered coronavirus spike (S) proteins and methods of their use | |
| JP2023526422A (en) | Coronavirus antigen compositions and their uses | |
| US11160860B2 (en) | HSV antigenic peptides and HSV protein vaccines | |
| CN103747797A (en) | Liposome formulation | |
| WO2022232648A1 (en) | Prefusion-stabilized lassa virus glycoprotein complex and its use | |
| AU2023378958A1 (en) | Self-assembling lipid nanoparticles for targeted delivery of therapeutic agents | |
| WO2021249786A1 (en) | Sars-cov2 diagnostic polypeptides and methods | |
| JP2024529044A (en) | Leptospirosis virulence regulatory proteins and uses thereof | |
| IL322050A (en) | Pharmaceutical compositions for delivery of herpes simplex virus glycoprotein c, glycoprotein d, and glycoprotein e antigens and related methods | |
| US20250051386A1 (en) | Compositions and methods for purifying polyribonucleotides | |
| US20230181722A1 (en) | Coronavirus antigen compositions and their uses | |
| US20260069679A1 (en) | Coronavirus spike protein-based vaccines | |
| US10428128B2 (en) | Helix-grafted proteins as inhibitors of disease-relevant protein-protein interactions | |
| RU2795459C2 (en) | Stabilized f rsv proteins and their use | |
| WO2025002352A1 (en) | Pharmaceutical composition containing cationic lipid and use thereof | |
| WO2025072921A1 (en) | Chimeric influenza virus hemagglutinin mrna-based vaccines and uses thereof | |
| WO2025137325A1 (en) | Immunization schedules to elicit broadly-neutralizing antibodies against human immmunodeficiency virus (hiv) | |
| KR20260057400A (en) | SARS-COV2 therapeutic virus-like particles | |
| HK40097472A (en) | Coronavirus vaccine | |
| CN120025459A (en) | Human papillomavirus mRNA vaccine | |
| WO2022174156A1 (en) | Prophylactic broad spectrum vaccine for sars-cov-2 | |
| Badten et al. | Evaluation of highly conserved |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17831616 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17831616 Country of ref document: EP Kind code of ref document: A1 |

