WO2018013483A1

WO2018013483A1 - Kv1.3 channel blocking peptides and uses thereof

Info

Publication number: WO2018013483A1
Application number: PCT/US2017/041376
Authority: WO
Inventors: Feng Wang; Changming Fang; Rongsheng E. Wang; Ying Wang; Peter G. Schultz
Original assignee: The California Institute For Biomedical Research
Priority date: 2016-07-11
Filing date: 2017-07-10
Publication date: 2018-01-18

Abstract

Disclosed herein are Kv1.3 channel inhibitor peptides and compositions comprising a peptide Kv1.3 inhibitor connected to an antibody sequence. These molecules may be useful for the treatment of T-cell mediated diseases and conditions such as autoimmune diseases.

Description

KV1.3 CHANNEL BLOCKING PEPTIDES AND USES THEREOF

CROSS-REFERENCE

[0001] This application claims the benefit of U.S. Provisional Patent Application Serial No. 62/360,921 filed July 11, 2016, U.S. Provisional Patent Application Senal No. 62/519,429 filed June 14, 2017, and U.S. Provisional Patent Application Serial No. 62/519,611 filed June 14, 2017, all of which are incorporated herein by reference.

BACKGROUND OF THE INVENTION

[0002] Autoreactive memory T lymphocytes are generally believed to mediate the pathogenesis of autoimmune diseases such as multiple sclerosis (MS), type 1 diabetes mellitus, rheumatoid arthritis (RA), and psoriasis. Unfortunately, almost all clinically used therapeutics for autoimmune diseases and other T-cell mediated inflammatory disorders are based on general inhibition or depletion of T cells and other leukocytes. Non-selective immunosuppression by drugs such as steroids, FK 06, and cyclosporine often leads to severe side effects including opportunistic infections. Therapeutics designed to specifically inhibit the function of effector memory T (T_EM) cells without impairing the function of naive T cells or memory T cells may offer an improved risk/benefit profile for the treatment of autoimmune diseases and for organ transplantation. One therapeutic target that is the focus of considerable interest is the potassium channel Kvl .3, which together with the calcium -activated K⁺ channel IKCal, is required to mediate membrane potential and calcium signaling in T cells. T_EM cells have been observed to up-regulate Kvl.3 upon activation with no change in IKCal levels. In contrast, naive and central memory T (T_CM) cells upregulate IKCal after activation with little change in Kvl .3 expression. Thus, inhibitors of Kvl.3 activity are expected to specifically inhibit the activation of T_EM cells, and thereby selectively ameliorate T-cell mediated inflammatory diseases without compromising normal immune responses.

[0003] It has proven challenging to generate either small molecules or antibodies that potently and selectively block Kvl.3 activity. On the other hand, a number of peptide toxins with multiple disulfide bonds from spiders, scorpions, and anemones are known to block specific ion channels, including Kvl.3. Nonetheless, only a few selective, potent peptide inhibitors of the Kvl.3 channel have been developed. A synthetic derivative of stichodactyla toxin (shk) with an unnatural amino acid (shk-186) is the most advanced; this peptide has demonstrated efficacy in preclinical models and is currently in a phase I clinical trial for treatment of psoriasis. However, small peptides like shk-186 are rapidly cleared by the kidney after administration, resulting in short circulating half-lives (< 10 mm in rats), and as a result, frequent injections. In addition, it is generally difficult to fold peptides with multiple disulfide bonds, which complicates commercial production. Thus, there is a compelling need for the development of long -acting, selective Kvl.3 inhibitors for the treatment of chronic inflammatory diseases.

SUMMARY OF THE INVENTION

[0004] In one aspect of the disclosure, provided herein are Kvl .3 inhibitor molecules comprising a peptide inhibitor of Kvl .3, including antibody fusions comprising the Kvl.3 inhibitor connected to an antibody sequence. Various antibody fusions disclosed have similar in vitro biological activities on suppression of T_EM cell activation as their Kvl .3 peptide inhibitor components, but with longer plasma half-lives. Such increase in half-life may provide for reduced injection frequency and increased compliance in clinical use. In some cases, the plasma half-life of fusion proteins is about, 10-, 20-, 50-, or 100-fold longer than corresponding peptide K l .3 peptide inhibitors alone. Furthermore, various antibody fusions have been generated to reduce antigen binding. For instance, antibody fusions are provided using a palivizumab scaffold where RSV binding is reduced or eliminated.

[0005] In one aspect, provided herein is a polypeptide comprising SEQ ID NO: 36:

I(X1)(Z1)VG(X2)(X3)E(Z2)(X4)P(X5)(Z3)(X6)AQ(X7)G(Z4)(X8)(X9)GK(Z5)MNRK(Z6)K(Z7)

(X10)(X11)(Z8);

wherein:

Zl, Z2, Z3, Z4, Z5, Z6, Z7, and Z8 are independently selected from C, A, G, S, I, and L;

X I is selected from S and K;

Χ2 is selected from S and P;

Χ3 is selected from P and K;

Χ4 is selected from P and L;

Χ5 is selected from K and P;

Χ6 is selected from R and G;

Χ7 is no amino acid or T;

Χ8 is selected from K and P;

Χ9 is selected from N and Y;

Χ10 is selected from Y and N;

X I I is selected from Y, R, F, and G; and

the polypeptide does not comprise the following combination of amino acids: Zl is C, Z2 is C, Z3 is C, Z4 is C, Z5 is C, Z6 is C, Z7 is C, Z8 is C, XI is S, X2 is S, X3 is P, X4 is P, X5 is K, X6 is R, Χ7 is no ammo acid, X8 is K, X9 is N, X10 is Y, and XI 1 is Y.

[0006] In some embodiments, (i) Z 1 is C, (ii) Z2 is C, (iii) Z3 is C, (iv) Z4 is C, (v) Z5 is C, (vi) Z6 is C, (vii) Z7 is C, (viii) Z8 is C, or (ix) any combination of (i) - (viii). In some embodiments, (i) XI is K, (ii) X2 is P, (iii) X3 is K, (iv) X4 is L, (v) X5 is P, (vi) X6 is G, (vii) X7 is T, (viii) X8 is P, (ix) X9 is Y, (x) X10 is N, (xi) XI 1 is selected from R, F, and G, or (xii) any combination of (i) - (xi). In some embodiments, the polypeptide comprises a sequence selected from SEQ ID NOS: 37-63.

[0007] Further provided is a composition comprising the polypeptide. In some embodiments, the composition comprises an antibody or antibody fragment connected to the polypeptide. In some

embodiments, the antibody fragment comprises at least one, at least two, or at least three CDRs of an antibody light chain and/or heavy chain; wherein optionally one or more of the at least one, two, or three CDRs has been modified to reduce antigen binding In some embodiments, the antibody or antibody fragment comprises one or more sequences selected from SEQ ID NOS: 21-32 and 101-130. In some embodiments, the polypeptide is positioned within the antibody or antibody fragment. In some embodiments, at least about 10, 20, 30, 40 or 50 contiguous amino acids of the antibody or antibody fragment are positioned N-terminal to the polypeptide, and at least about 10, 20, 30, 40 or 50 contiguous amino acids of the antibody or antibody fragment are positioned C-terminal to the polypeptide.

[0008] Further provided is a composition comprising an antibody region modified by insertion of the polypeptide into the antibody region; wherein the unmodified antibody region comprises a first CDR, a second CDR, and a third CDR, and the modification comprises: (a) positioning the polypeptide (i) between two amino acids of the first CDR, (ii) between an amino acid of the antibody region and the first amino acid of the first CDR, (iii) between an amino acid of the antibody region and the last amino acid of the first CDR; or (b) replacing at least one amino acid of the first CDR with the polypeptide. In some embodiments, the first CDR of the unmodified antibody region is selected from: a CDR1 of an antibody light chain, a CDR2 of an antibody light chain, a CDR3 of an antibody light chain, a CDR1 of an antibody heavy chain, a CDR2 of an antibody heavy chain, and a CDR3 of an antibody heavy chain. In some embodiments, the first CDR of the unmodified antibody region is selected from SEQ ID NOS: 21-32 and 101-123. In some embodiments, the antibody region comprises: (1) a heavy chain of an antibody variable domain, (2) a light chain of an antibody variable domain; (3) at least about 10, 20, 30, 40 or 50 contiguous amino acids; or (4) any combination of (1)- (4). In some embodiments, the polypeptide is connected to the antibody region by one or more linkers and/or extension peptides. In some embodiments, the polypeptide is inserted into the antibody region in an insert region comprising a first extension peptide, the polypeptide, and a second extension peptide. In some embodiments, the first extension peptide and the second extension peptide each form a helical secondary structure.

[0009] Further provided is a method of binding a channel selected from: Kvl . l, Kvl .2, Kvl.3, Kvl.4, Kvl.5, Kvl .6, Kvl.7, Kv2.1, Kv3.1, Kv3.2, Kvl l . l, Kcl . l, Kc2.1, Kc3.1, Navl.2, Navl .4, KCa3.1, Navl.5, and Cavl.2; the method comprising combining the polypeptide of any of claims 1-17 with the channel; wherein if the channel is in an in vitro solution, combining comprises combining the channel and the polypeptide in the in vitro solution; and wherein if the channel is located in a subject, the method comprises administering the polypeptide to the subject.

[0010] Further provided is a method of treating a subject comprising a disease or condition, the method comprising administering to the subject the polypeptide. In some embodiments, the disease is an autoimmune disease or condition thereof.

[0011] In one aspect, provided herein is a composition comprising an antibody region first modified by insertion of a therapeutic polypeptide into the antibody region; wherein the unmodified antibody region comprises a first CDR, a second CDR, and a third CDR; and wherein the first CDR, the second CDR, the third CDR, or a combination thereof, has been further modified to reduce or eliminate antigen binding.

[0012] The composition of claim 21, wherein the first modification comprises (a) positioning the therapeutic polypeptide (i) between two amino acids of the first CDR, (ii) between an amino acid of the antibody region and the first amino acid of the first CDR, (iii) between an amino acid of the antibody region and the last amino acid of the first CDR; or (b) replacing at least one amino acid of the first CDR with the therapeutic polypeptide; and wherein the modified antibody region comprises at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 amino acids. In some embodiments, the therapeutic peptide is a peptide inhibitor of a voltage-gated channel. In some embodiments, the first CDR of the unmodified antibody region is selected from: a CDRl of an antibody light chain, a CDR2 of an antibody light chain, a CDR3 of an antibody light chain, a CDRl of an antibody heavy chain, a CDR2 of an antibody heavy chain, and a CDR3 of an antibody heavy chain. In some embodiments, the first CDR is selected from SEQ ID NOS: 21-32 and 101-123. In some embodiments, the first CDR comprises the sequence "FGG." In some embodiments, the antibody region is modified from a heavy chain variable domain of a palivizumab antibody having SEQ ID NO: 2, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 2. In some embodiments, the antibody region is modified from a light chain variable domain of a palivizumab antibody having SEQ ID NO: 1, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 1. In some embodiments, the composition comprises SEQ ID NO: 101: SMITX(i)X(ii)X(iii)FDV, wherein X(i) is selected from F, A, G, and P, X(ii) is selected from G, A, S, T, and P; and X(iii) is selected from G, A, V, L, and P.

[0013] Further provided is a method of treating a subject comprising an autoimmune disease or condition thereof, the method comprising administering to the subject the composition.

BRIEF DESCRIPTION OF THE DRAWINGS

[0014] The foregoing summary, as well as the following detailed description of the disclosure, will be better understood when read in conjunction with the appended figures. However, the disclosure is not limited to the precise examples shown and according to common practice, the various features of the drawings are not to- scale. In some cases, the dimensions of the various features are arbitrarily expanded or reduced for clarity. Included in the drawings are the following figures.

[0015] FIG. 1 shows an exemplary design of humanized anti-Kv 1.3 antibodies. Solution NMR structures of Toxin B (PDB ID: 2KIR) and Toxin A peptides (PDB ID: 2K90) are shown with the corresponding sequences (disulfide bonds are indicated). Peptides were grafted into CDR3L and CDR2H of Synagis antibody (Fab fragment X-ray crystal structure depicted, PDB ID: 2HWZ), or into CDR3H (red) of BVK antibody (Fab fragment depicted, PDB ID: 1BVK).

[0016] FIGS. 2(A-B) show in vivo pharmacological performance of Syn-Toxin A-CDR3L (SEQ ID NOS: 7, 3). FIG. 2A shows pharmacokinetics at a single dose of 2 mg kg, via subcutaneous injection. FIG. 2B shows the pharmacokinetic profile of Syn-Toxin A-CDR3L in rat by i.v. injection. A single dose (2 mg/kg) of antibody fusion protein was administered by i.v. injection into Sprague-Dawley rats (n=3). Samples were analyzed by sandwich ELISA based on its binding to Kvl.3-overexpressing CHO cells. The estimated terminal half-life is 54. Oh.

[0017] FIG. 3 shows in vivo inhibition of delayed type hypersensitivity reaction in rats (n = 8 per group) by subcutaneous administration of Syn-Toxin A-CDR3L (SEQ ID NOS: 7, 3) (5 mg/kg), SHK peptide (100 μg/kg), Toxin A peptide (100 μg/kg), and PBS vehicle groups. All treatment groups were challenged on the left ear with 1 mg/mL ovalbumin/complete Freund's adjuvant on day 7, except the "sham" group which had both ears injected with PBS. Peptides were injected with a single dose on the day of challenge (IX), or at one dose/day starting 24h ahead of challenge (2X). Syn-Toxin A-CDR3L was injected with a single dose 24h ahead of challenge (IX), or one dose/day 48h ahead of challenge (2X). Shown are the ear thickness differences between left and right ear 24 h after ovalbumin challenge.

DETAILED DESCRIPTION OF THE INVENTION

[0018] Described herein are Kvl .3 inhibitors and compositions comprising Kvl .3 inhibitors. Exemplary compositions are antibody fusions comprising a Kvl .3 inhibitor connected to an antibody or antibody fragment, e.g., via one or more extension peptides and/or linker peptides. In some cases, the antibody or antibody fragment has been modified to reduce or eliminate antigen binding. For antibody fusions where the Kvl .3 inhibitor is positioned within the complementary determining region (CDR) of the antibody, such antigen binding modification may be made at one or more CDRs different from the CDR in which the Kvl .3 peptide inhibitor is fused, or the same CDR in which the Kvl .3 peptide inhibitor is positioned.

[0019] Various Kvl .3 inhibitors and Kvl .3 inhibitor antibody fusions described herein selectively suppress effector memory T (T_EM) cell activation while having improved half-lives over the Kvl .3 peptide inhibitor alone. For example, various fusion antibodies provided have shown improved plasma half-life and serum stability in rodents compared to Kvl .3 peptide inhibitor alone. Accordingly, Kvl .3 inhibitor antibody fusions described herein may provide selective immunosuppression for the treatment of autoimmune diseases.

[0020] Kvl .3 inhibitors provided herein, and compositions thereof, include those having SEQ ID NOS: 12- 15, 131, and 36-63. In some cases, the Kvl .3 inhibitor comprises SEQ ID NO: 36

(I(X 1)(Z 1)VG(X2)(X3)E(Z2)(X4)P(X5)(Z3)(X6)AQ(X7)G(Z4)(X8)(X9)GK(Z5)MNRK(Z6)K(Z7)(X 10)(X1 1)(Z8)), where each of X l-Xl l and Z 1-Z8 may be any natural or unnatural amino acid, or may indicate absence of an amino acid. As a non-limiting example, XI is S or K; X2 is S or P; X3 is P or K; X4 is P or L; X5 is K or P; X6 is R or G; X7 is T or indicates no amino acid present at this position; X8 is K or P; X9 is N or Y; X10 is Y or N; XI 1 is Y, R, F or G; Zl is C, A, G, S, I, or L; Z2 is C, A, G, S, I, or L; Z3 is C, A, G, S, I, or L; Z4 is C, A, G, S, I, or L; Z5 is C, A, G, S, I, or L; Z6 is C, A, G, S, I, or L; Z7 is C, A, G, S, I, or L; and Z8 is C, A, G, S, I, or L.

[0021] According to one feature of the subject matter described herein, a Kvl .3 inhibitor antibody fusion comprises a Kvl .3 inhibitor connected via one or more extension and/or linker peptides to, or otherwise positioned within, a CDR of an antibody or antibody fragment. The Kvl .3 inhibitor may be positioned within the antibody such that at least 10 amino acids of the antibody are N-terminal to the Kvl .3 inhibitor and at least 10 amino acids of the antibody are C-terminal to the Kvl .3 inhibitor. The Kvl .3 inhibitor may be selected from SEQ ID NOS: 12-15, 131, and 36-63. An exemplary configuration of a CDR antibody fusion is depicted by Formulas I-IV, wherein T is a therapeutic peptide comprising a Kvl .3 peptide inhibitor, L is a linker peptide, A is an antibody or fragment thereof (e.g. , variable domain), and E is an extension peptide. An antibody fusion described herein may comprise one or more polypeptide chains having any one of Formulas I- IV. ErL_i-T-L_j-E^ A

Formula I

A

Formula II

Formula III

Formula IV

[0022] The antibody or antibody fragment A may comprise or be derived from a heavy chain or a light chain variable domain, where an insert portion comprises any one of therapeutic peptide T, extension peptide E, and linker L is fused to a CDR of the variable domain, with optional replacement of one or more of the CDR amino acids. The CDR may be CDRIH, CDR2H, CDR3H, CDRIL, CDR2L or CDR3L. In some cases, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids of the CDR of the antibody A are replaced with the insert portion. In some cases, no amino acids of the CDR of the antibody A are replaced with the insert portion, and the insert portion is inserted in between any two amino acids of the CDR, between the antibody and the first amino acid of the CDR, or between the antibody and the last amino acid of the CDR. In addition, the insert portion may comprise, and/or be connected to the antibody A via one or more linkers. For instance, a linker is positioned between A and El and/or between E2 and A in any of Formulas I-IV. Additional modifications to the vanable domain may be made to reduce or eliminate antigen binding.

[0023] Antibody fusions comprising a Kvl .3 peptide inhibitor may be used to treat a disease or condition in a subject in need thereof. Generally, a method of treatment comprises administering to the subject a composition comprising the Kvl .3 inhibitor, e.g., an antibody fusion. In some embodiments, the antibody fusion comprises a first antibody chain having the formula of I, II, III, IV, or any modification, portions, or additions thereof; and an optional second antibody chain. The second antibody chain may or may not be an antibody fusion. The subject may be one comprising an autoimmune disease, having or expecting to have an organ transplant, or one having an affliction related thereto.

[0024] In various instances, connection of an antibody or antibody fragment to a Kvl .3 peptide inhibitor as described herein has an effect of increasing half-life or otherwise improving delivery of the Kvl.3 peptide inhibitor. In some cases, the half-life of the Kvl .3 peptide inhibitor is improved by at least 10-, 20-, 30-, 40-, 50-, 60-, 70-, 80-, 90-, 100-, or 150-fold.

[0025] In some cases, the Kvl .3 peptide inhibitor and antibody are recombinantly produced from a genetic construct, and then expressed in vitro using cell culture techniques. In some embodiments, a construct encoding a Kvl.3 peptide inhibitor connected to a CDR of a first antibody is co-expressed with a second construct comprising a second antibody, to produce a recombinant Kvl .3 inhibitor antibody fusion protein. For instance, the first antibody may comprise a heavy chain or portion thereof, and the second antibody may comprise a light chain or portion thereof, or vice versa. Such first and second antibodies may be expressed and then connected via disulfide bond, or in other instances, the antibodies are produced together from a single construct, e.g., to produce a scFv. Genetic fusion constructs may also comprise one or more extension peptides, linker peptides and/or proteolytic cleavage sites.

[0026] Before the present methods and compositions are described, it is to be understood that this disclosure is not limited to a particular method or composition described. The terminology used is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims. Examples are put forth so as to provide those of ordinary skill in the art with a disclosure and description of how to make and use the present compositions and methods, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some

experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.

[0027] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.

[0028] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction. [0029] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.

[0030] As used herein and in the appended claims, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. For example, reference to "a cell" includes a plurality of such cells and reference to "the peptide" includes reference to one or more peptides and equivalents thereof, e.g. polypeptides, known to those skilled in the art, and so forth.

Kvl .3 Inhibitor Antibody Fusions

[0031] In one aspect, provided herein is a Kvl .3 inhibitor antibody fusion comprising a Kvl .3 inhibitor connected to an antibody at the CDR position. The Kvl .3 inhibitor need not be connected directly to the antibody, and may be connected via one or more extension peptides and/or linker peptides. In some instances, "connected to" indicates that the Kvl.3 inhibitor is positioned within the CDR (sometimes referred to as a CDR fusion), which includes: the Kvl.3 inhibitor is positioned between two amino acids of the CDR, the Kvl .3 inhibitor is positioned between the antibody and the first amino acid of the CDR, the Kvl .3 inhibitor is positioned between the antibody and the last amino acid of the CDR, and/or the Kvl .3 inhibitor replaces a portion or all of the CDR and thus is positioned where the CDR previously existed. In some cases, the CDR fusion comprises a first antibody portion, the Kvl .3 inhibitor, and a second antibody portion. For example, the first antibody portion comprises one or more framework regions and, if applicable, any other CDRs N- terminal to the CDR where the Kvl .3 inhibitor is positioned, and the second antibody portion comprises one or more framework regions and/or Fc regions, and if applicable, any other CDRs C-terminal the CDR where the Kvl.3 inhibitor is positioned. Each of the first and second antibody portions may independently have a length selected from: at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, or at least about 50 amino acids. In some cases, positioned within the CDR indicates that no amino acids of the CDR are deleted. In some cases, positioned within the CDR indicates that at least 1, 2, 3, 4, 5, 6, 7, 8 or the entire CDR is replaced by the Kvl.3 inhibitor.

[0032] In many antibody fusions, the Kvl .3 inhibitor is part of an insert portion that is positioned withm the CDR of the antibody. The insert portion may comprise one or more extension peptides and/or linker peptides. The connections discussed herein include peptide bonds, and as such, the antibody fusions may be produced from a genetic construct comprising DNA encoding for the antibody fusion. "Positioned within" and "inserted" may indicate the location of the Kvl .3 inhibitor within a polypeptide comprising both the Kvl .3 inhibitor and antibody, and as such, may not be not indicative of the method in which the Kvl .3 inhibitor is produced. For instance, "inserted" does not necessarily limit the antibody fusions to those generated by modifying the DNA encoding the antibody by insertion of the DNA encoding for the Kvl .3 inhibitor, but may also or alternatively indicate that the DNA encoding the antibody and Kvl .3 inhibitor is de novo synthesized.

[0033] Exemplary Kvl .3 peptide inhibitors of the antibody fusions described include Toxin A (SEQ ID NO: 13), Toxin B (SEQ ID NO: 15), Toxin XX (SEQ ID NO: 36), Toxins C-Z and Toxins AA-CC (SEQ ID NOS: 37-63), and Stichodactyla toxin (ShK, SEQ ID NO: 131,

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC). The Kvl .3 inhibitor may be part of an insert portion that replaces one or more amino acids of the CDR. In other cases, the insert portion is connected to the CDR, without CDR amino acid removal. The insert portion comprises the Kvl .3 inhibitor and optionally one or more extension peptides and/or linker peptides. In some cases, one extension peptide is upstream of the Kvl .3 inhibitor sequence and a second extension peptide is downstream of the Kvl .3 inhibitor sequence. The two extension peptides may form a coiled-coil or a beta-sheet. In some cases, a linker peptide connects on either side of an extension peptide. For example, a linker is present between antibody sequence and extension peptide sequence, and/or between extension peptide sequence and Kvl .3 peptide inhibitor sequence. In various embodiments, a Kvl .3 inhibitor antibody fusion has Formula I, Formula Π, Formula III, or Formula IV.

[0034] As used herein, an antibody portion of a Kvl .3 inhibitor antibody fusion refers to an amino acid sequence of an antibody, where "antibody" includes antibody and fragments thereof. The antibody may comprise a heavy chain sequence, a light chain sequence, both a heavy chain sequence and a light chain sequence, or any portion or combination thereof. In many cases, the antibody portion of a fusion comprises a variable domain modified at one or more CDRs with a Kvl .3 peptide inhibitor. Modification of a CDR includes the following configurations: the Kvl .3 inhibitor is positioned between two amino acids of the CDR, the Kv 1.3 inhibitor is positioned between the antibody and the first amino acid of the CDR, the Kv 1.3 inhibitor is positioned between the antibody and the last amino acid of the CDR, and/or the Kvl.3 inhibitor replaces a portion or all of the CDR and thus is positioned where the CDR previously existed. In some cases, the variable domain has been modified to reduce or eliminate antigen binding.

[0035] The antibody portion of a Kvl.3 inhibitor antibody fusion described herein may be any portion or fragment of an antibody. In some cases, an antibody is chimeric, engineered, recombinant, and/or humanized. The antibody portion of Kvl.3 inhibitor antibody fusion may comprise an entire antibody molecule or any polypeptide comprising fragment of an antibody including, but not limited to: heavy chain, light chain, variable domain, antigen binding domain, constant domain, complementarity determining region (CDR), framework region, single domain antibody, fragment antigen binding (Fab) region, Fab', F(ab')2, F(ab')3, Fab', fragment crystallizable (Fc) region, single chain variable fragment (scFV), di-scFv, single domain antibody, trifunctional antibody, chemically linked F(ab')2, and any portion or combination thereof. In some embodiments, an antibody heavy chain comprises an entire heavy chain or a portion of a heavy chain. For example, a variable domain or region thereof derived from a heavy chain may be referred to as a heavy chain or a region of a heavy chain. In some embodiments, an antibody light chain comprises an entire light chain or a portion of a light chain. For example, a variable domain or region thereof derived from a light chain may be referred to as a light chain or a region of a light chain. The antibody portion may be bispecific or trispecific. A single domain antibody includes, but is not limited to, a single monomeric variable antibody domain. In some cases, an antibody portion of a Kvl .3 inhibitor antibody may be mammalian, human engineered or fully human, bovine, murine, non-human primate, avian, or shark. The single domain antibody may be a shark variable new antigen receptor antibody fragment (VNAR). The antibody may be derived from any type known to one of skill in the art including, but not limited to, IgA, IgD, IgE, IgG, IgM, IgY, IgW. The antibody portion may be a glycoprotein. The antibody portion may comprise one or more functional units, including but not limited to, 1, 2, 3, 4, and 5 units. The antibody portion may comprise one or more units connected by one or more disulfide bonds. The antibody portion may comprise one or more units connected by a peptide linker, for example, a scFv antibody. The antibody may be a recombinant antibody including antibodies with amino acid mutations, substitutions, and/or deletions. The antibody may be a recombinant antibody comprising chemical modifications. In some cases, an antibody portion of an antibody fusion is an amino acid sequence of palivizumab. The palivizumab may have been modified to reduce binding to RSV. In some cases, an antibody portion of an antibody fusion is an amino acid sequence of BVK.

[0036] Non-limiting examples of antibody fragments include a variable domain, single domain antibody, constant domain, complementarity determining region (CDR), framework region, fragment antigen binding (Fab) region, antigen binding domain, fragment crystallizable (Fc) region, and combinations thereof, e.g., a single chain variable fragment (scFv). As used herein, an antigen binding domain is not limited to an antibody fragment capable of binding an antigen, but also includes antibody fragments derived from an antibody fragment capable of binding an antigen, wherein the derivatization comprises reducing or eliminating antigen binding. In such cases, the amino acid length of the antibody binding fragment that has been derivatized to reduce or eliminate antigen binding is the same, or within 10% of, the amino acid length of the antigen binding fragment from which it was derived (i.e. the antigen binding fragment that binds to an antigen). In some cases, an antigen binding domain is an antibody region comprising the CDR1, CDR2, and CDR3 of an antibody heavy chain, and the CDR1, CDR2, and CDR3 of an antibody light chain; wherein one or more of the CDRs has been mutated or otherwise altered in amino acid sequence identity to reduce or eliminate antigen binding. For CDR antibody fusions, an antigen binding domain is an antibody region comprising the CDR1, CDR2, and CDR3 of an antibody heavy chain, and the CDR1, CDR2, and CDR3 of an antibody light chain; wherein one or more of the CDRs has been mutated or otherwise altered in amino acid sequence identity to reduce or eliminate antigen binding, and one or more of the CDRs has been modified by insertion of a Kvl .3 inhibitor, where the modifications may occur at the same or different CDRs. In some cases, an antigen binding fragment comprises a CDR1, CDR2, and CDR3 of only a heavy chain sequence or only a light chain sequence, where one or more CDRs are modified by insertion of a Kvl .3 inhibitor and/or reduction or elimination of antigen binding. Accordingly, an antigen binding fragment may be a single chain or dual chain connected, e.g., by disulfide bonds.

[0037] In some cases, a composition (e.g., insert, antibody fusion protein) comprises "at least a portion" of an antibody or antibody fragment. In certain instances, "at least a portion" indicates that at least about 80%, 85%, 90%, or 95% of the length of the antibody or antibody fragment is present in the composition. For example, an antibody fusion comprising at least a portion of heavy chain having SEQ ID NO: 2 (450 amino acids), comprises at least about 360 amino acids (80%), 382 amino acids (85%), 405 amino acids (90%) or 427 amino acids (95%) of the heavy chain. The "at least a portion of may be a continuous amino acid sequence, or the sum of two continuous amino acid sequences that are separated by a Kvl .3 inhibitor. For example, an antibody fusion comprising a Kvl .3 inhibitor and at least a portion of an antibody variable domain may comprise a first continuous amino acid sequence of the antibody variable domain, the Kvl.3 inhibitor, and a second continuous amino acid sequence of the antibody variable domain, where the first and second continuous amino acid sequences of the antibody variable domain add up to at least about 80%, 85%, 90%, or 95% of the sequence length of an antibody variable domain. In some cases, an antibody fusion comprises at least a portion of an antibody or an antibody fragment selected from: an antibody variable domain and/or an antigen binding fragment (e.g., a fragment comprising a CDR1, CDR2, and CDR3 of an antibody heavy chain and/or antibody light chain); wherein the antibody fusion comprises a first antibody or antibody fragment region, a Kvl .3 inhibitor, and a second antibody or antibody fragment region; and wherein the "at least a portion" indicates that the sum of the length of the first antibody or antibody fragment region and the length of the second antibody or antibody fragment region is at least about 80%, 85%, 90%, or 95% of the length of the antibody variable domain and/or antigen binding fragment.

[0038] A Kvl.3 inhibitor antibody fusion may comprise a Kvl.3 inhibitor selected from SEQ ID NOS: 13, 15, 131, and 36-63 positioned within a CDR of at least a portion of an antibody variable domain. The CDR may be a CDR1, CDR2, or CDR3 of the heavy chain, or the CDR1, CDR2, or CDR3 of the light chain.

[0039] A Kvl.3 inhibitor antibody fusion may comprise a first chain comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 7-11, 64-93, and 33-35. A Kvl.3 inhibitor antibody fusion may comprise a first chain comprising a sequence of about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more amino acids from any one of SEQ ID NOS: 7-11, 64-93, and 33-35. Further disclosed herein are nucleotide constructs comprising a nucleotide sequence encoding for a Kvl .3 inhibitor antibody fusion comprising a first chain comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 7-11, 64-93 and 33-35. The nucleotide construct may be a plasmid for expression in a host cell. For example, a mammalian or bacterial expression plasmid.

[0040] A Kvl.3 inhibitor antibody fusion may comprise a first chain comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 7-11, 64-93, and 33-35; and a second chain comprising an ammo acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 1-6, 93-100. A Kvl .3 inhibitor antibody fusion may comprise a first chain comprising a sequence of about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more amino acids from any one of SEQ ID NOs: 7-11, 64-93, and 33-35; and a second chain comprising an amino acid sequence of about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more amino acids from any one of SEQ ID NOs: 1-6, 93-100. The first chain may comprise a heavy chain variable domain of an antibody and the second chain may comprise a light chain of an antibody, and vice versa. The first and second chains may be connected by one or more disulfide bonds. Antibodies

[0041] The Kvl.3 inhibitor antibody fusions disclosed herein comprise one or more antibody portions. An antibody portion of an antibody fusion is a sequence of amino acids from an antibody. An antibody portion may comprise an entire antibody sequence or a fragment thereof. An antibody portion may comprise an antibody heavy chain, antibody light chain, or a combination thereof. An antibody portion may comprise two or more antibody chains or portions thereof. An antibody portion may comprise three or more antibody chains or portions thereof. An antibody portion may comprise four or more antibody chains or portions thereof. In various embodiments, an antibody portion comprises a variable domain comprising one or more CDRs. In some cases, the antibody portion comprises a variable domain that has been modified or otherwise engineered to reduce or eliminate antigen binding.

[0042] The antibody portion of Kvl .3 inhibitor antibody fusions described herein may comprise one or more mutations and/or modifications which reduce complement dependent and antibody -dependent cell-mediated cytotoxicities (ADCC). For example, an antibody portion of a fusion has the following mutations: E233P, L234V, L235A, AG236, A327G, A330S, and P331S.

[0043] The antibody portion may comprise an entire antibody molecule or any polypeptide comprising fragment of an antibody including, but not limited to, heavy chain, light chain, variable domain, constant domain, complementarity determining region (CDR), antigen binding fragment, single domain antibody, framework region, fragment antigen binding (Fab) region, Fab', F(ab')2, F(ab')3, Fab', fragment crystallizable (Fc) region, single chain variable fragment (scFV), di-scFv, single domain antibody, trifunctional antibody, chemically linked F(ab')2, and any combination thereof. In some embodiments, an antibody heavy chain may comprise an entire heavy chain or a portion of a heavy chain. For example, a variable domain or region thereof derived from a heavy chain may be referred to as a heavy chain or a region of a heavy chain. In some embodiments, an antibody light chain may comprise an entire light chain or a portion of a light chain. For example, a variable domain or region thereof derived from a light chain may be referred to as a light chain or a region of a light chain. A single domain antibody includes, but is not limited to, a single monomeric variable antibody domain, for example, a shark variable new antigen receptor antibody fragment (VNAR).

[0044] The antibody may be derived from any type known to one of skill in the art including, but not limited to, IgA, IgD, IgE, IgG, IgM, IgY, IgW. The antibody portion may comprise one or more units, including but not limited to, 1, 2, 3, 4, and 5 units. Functional units may include, but are not limited to, non-antibody portions, heavy chain, light chain, variable domain, antigen binding fragment, single domain antibody, constant domain, complementarity determining region (CDR), framework region, fragment antigen binding (Fab) region, Fab', F(ab')2, F(ab')3, Fab', fragment crystallizable (Fc) region, single chain variable fragment (scFV), di-scFv, single domain antibody, trifunctional antibody, chemically linked F(ab')2, and any combination or fragments thereof. Non-antibody portions include, but are not limited to, carbohydrates, lipids, small molecules and therapeutic peptides. The antibody portion may comprise one or more units connected by one or more disulfide bonds. The antibody portion may comprise one or more units connected by a peptide linker, for example, a scFv antibody. The antibody may be a recombinant antibody including antibodies with amino acid mutations, substitutions, and/or deletions. The antibody may be a recombinant antibody comprising chemical modifications. The antibody may comprise a whole or part of an antibody-drug conjugate. [0045] In some embodiments, an antibody portion comprises one or more contiguous amino acid sequences. In some cases, an antibody portion comprises a first amino acid sequence, a Kvl .3 inhibitor, and a second amino acid sequence. The total antibody portion may comprise at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, or more amino acids. The first amino acid sequence of the antibody portion may comprise from about 10 to about 100 amino acids, from about 10 to about 75 amino acids, from about 10 to about 50 amino acids, or from about 10 to about 30 amino acids. The second amino acid sequence may comprise from about 10 to about 400 amino acids, from about 10 to about 300 amino acids, from about 10 to about 200 amino acids, from about 10 to about 100 amino acids, or from about 10 to about 100 amino acids. In some cases, the first amino acid sequence of the antibody portion comprises at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150 or more amino acids. In some cases, the second amino acid sequence of the antibody portion comprises at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 175, 200, 250, 300 or more amino acids.

[0046] An antibody portion of a Kvl .3 inhibitor antibody fusion may comprise a first chain comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 1-6, 93-100. The antibody portion of the Kvl.3 inhibitor antibody fusion may comprise a second chain comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 1-6, 93-100. An antibody portion of a Kvl.3 inhibitor antibody fusion may comprise a first chain comprising a sequence of about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more amino acids from any one of SEQ ID NOs: 1-6, 93-100. The antibody portion of the Kvl.3 inhibitor antibody fusion may comprise a second chain comprising an amino acid sequence of about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more amino acids from any one of SEQ ID NOs: 1-6, 93-100. An antibody portion of a Kvl.3 inhibitor antibody fusion may comprise a palivizumab CDR or other region thereof. An antibody portion of a Kvl.3 inhibitor antibody fusion may comprise a heavy chain and a light chain. The heavy and light chain may be connected by a linker or by a disulfide bond.

[0047] The antibody portion of the Kvl .3 inhibitor antibody fusion may comprise at least a portion of a variable domain. The antibody portion may comprise 1, 2, 3, 4, 5 or more variable domains or portions thereof. The antibody portion of the Kvl .3 inhibitor antibody fusion may comprise at least a portion of a constant domain. The antibody portion may comprise 1, 2, 3, 4, 5 or more constant domains or portions thereof. The antibody portion of the Kvl .3 inhibitor antibody fusion may comprise at least a portion of a complementarity-determining region (CDR). The antibody portion may comprise 1, 2, 3, 4, 5 or more CDRs or portions thereof.

[0048] An antibody portion of a Kvl .3 inhibitor antibody fusion may comprise a first CDR comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 21-32. An antibody portion of a Kvl.3 inhibitor antibody fusion may comprise a second CDR comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 21-32. An antibody portion of a Kvl .3 inhibitor antibody fusion may comprise a third CDR comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to any one of SEQ ID NOS: 21-32, 101-123. In some cases, the first CDR, second CDR, and/or third CDR is modified by an addition, deletion and/or amino acid mutation. In some cases, the first CDR, second CDR and/or third CDR is modified by insertion of a Kvl.3 peptide inhibitor, extension peptide, linker, or combination thereof. In some embodiments, a first CDR comprising an amino acid sequence identical to a sequence selected from SEQ ID NOS: 26 and 117-123 is modified to comprise an insertion sequence comprising a Kvl.3 peptide inhibitor, an extension peptide, a linker, or a combination thereof. In some embodiments, a first CDR comprising an amino acid sequence identical to SEQ ID NO: 29 is modified to comprise an insertion sequence comprising a Kvl .3 peptide inhibitor, an extension peptide, a linker, or a combination thereof.

[0049] In some embodiments, the antibody portion of a Kvl.3 inhibitor antibody fusion comprises one or more antibody portions selected from SEQ ID NOS: 125-128.

[0050] In some embodiments, the antibody portion of a Kvl.3 inhibitor antibody fusion comprises at least a portion of a variable domain comprising SEQ ID NO: 129 and/or SEQ ID NO: 130. In some cases, the antibody fusion comprises at least about 80%, 85%, 90%, or 95% of the variable domain.

[0051] In some embodiments, the antibody portion of a Kvl.3 inhibitor antibody is not specific for a mammalian target. In some embodiments, the antibody is an anti-viral antibody. In some embodiments, the antibody is an anti-bacterial antibody. In some embodiments, the antibody is an anti-parasitic antibody. In some embodiments, the antibody is an anti-fungal antibody. In some embodiments, the antibody portion is derived from an antibody vaccine.

[0052] In some embodiments, a Kvl.3 inhibitor antibody comprises an antibody sequence from, but not limited to, actoxumab, bezlotoxumab, CR6261, edobacomab, efungumab, exbivirumab, felvizumab, foravirumab, ibalizumab (TMB-355, TNX-355), libivirumab, motavizumab, nebacumab, pagibaximab, palivizumab, panobacumab, rafivirumab, raxibacumab, regavirumab, sevirumab (MSL-109), suvizumab, tefibazumab, tuvirumab, and urtoxazumab.

[0053] In some embodiments, a Kvl.3 inhibitor antibody comprises an antibody sequence from antibodies targeting Clostridium difficile, Orthomyxoviruses (Influenzavirus A, Influenzavirus B, Influenzavirus C, Isavirus, Thogotovirus), Escherichia coli, Candida, Rabies, Human Immunodeficiency Virus, Hepatitis, Staphylococcus, Respiratory Syncytial Virus, Pseudomonas aeruginosa, Bacillus anthracis, Cytomegalovirus, or Staphylococcus aureus.

[0054] A Kvl.3 inhibitor antibody may comprise an antibody sequence from an anti-viral antibody. The anti-viral antibody may be directed against an epitope of a viral protein. The anti-bacterial antibody may target one or more viruses including, but not limited to, Adenoviruses, Herpesviruses, Poxviruses,

Parvoviruses, Reoviruses, Picomaviruses, Togaviruses, Orthomyxoviruses, Rhabdoviruses, Retroviruses and Hepadnaviruses. The viral protein may be from a respiratory syncytial virus. The viral protein may be an F protein of the respiratory syncytiral virus. The epitope may be in the A antigenic site of the F protein. The anti -viral antibody may be based on or derived from palivizumab. The antibody may be based on or derived from an anti -viral vaccine. The anti -viral antibody may be based on or derived from exbivirumab, foravirumab, libiviramab, rafivirumab, regavirumab, sevirumab, tuvirumab, felvizumab, motavizumab, palivizumab, and/or suvizumab.

[0055] A Kvl.3 inhibitor antibody may comprise an antibody sequence from an anti-viral antibody G. The antibody portion may comprise at least a portion of an anti -viral antibody G. The antibody portion may comprise an amino acid sequence that is at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of an anti-viral antibody G. In some embodiments the antibody portion comprises an amino acid sequence of an anti-viral antibody M.

[0056] In some cases, an antibody portion of a Kvl .3 inhibitor antibody fusion comprises a palivizumab antibody sequence. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of a palivizumab antibody. For example, the antibody portion comprises an amino acid sequence at least 80%, 85%, 90%, or 95% identical to a sequence selected from one or more of: 1-3, 21-26, 93-124. As another example, the antibody portion comprises at least 10 contiguous amino acids of a sequence selected from one or more of: 1-3, 21-26, 93-124.

[0057] A Kvl.3 inhibitor antibody may comprise an antibody sequence from an exbivirumab, foravirumab, libivirumab, rafivirumab, regavirumab, sevirumab, tuvirumab, felvizumab, motavizumab, palivizumab, and/or suvizumab antibody. The antibody portion may comprise at least a portion of an exbivirumab, foravirumab, libivirumab, rafivirumab, regavirumab, sevirumab, tuvirumab, felvizumab, motavizumab, palivizumab, and/or suvizumab antibody. An antibody Kvl.3 inhibitor antibody may comprise an antibody sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of an exbivirumab, foravirumab, libivirumab, rafivirumab, regavirumab, sevirumab, tuvirumab, felvizumab, motavizumab, palivizumab, and/or suvizumab antibody.

[0058] A Kvl.3 inhibitor antibody may comprise an antibody sequence from an anti-bacterial antibody. The anti-bacterial antibody may be directed against an epitope of a bacterial protein. The anti-bacterial antibody may target bacteria including, but not limited to, Acetobacter aurantius, Agrobocterium radiobacter, Anaplasma phagocy tophi lum, Azorhizobium caulinodans, Bacillus anthracis, Bacillus brevis, Bacillus cereus, Bacillus subtilis, Bacteroides fragilis, Bacteroides gingivalis, Bacteroides melaninogenicus, Bartonella quintana, Bordetella bronchiseptica, Bordetella pertussis, Borrelia burgdorferi, Brucella abortus, Brucella melitensis, Brucella suis, Burkholderia mallei, Burkholderia pseudomallei, Burkholderia cepacia,

Calymmatobacterium granulomatis, Campylobacter coli, Campylobacter fetus, Campylobacter jejuni, Campylobacter pylori, Chlamydia trachomatis, Chlamydophila pneumoniae, Chlamydophila psittaci, Clostridium botulinum, Clostridium difficile, Corynebacterium diphtheriae, Corynebacterium fusiforme, Coxiella burnetii, Enterobacter cloacae, Enterococcus faecalis, Enterococcus faecium, Enterococcus galllinarum, Enterococcus maloratus, Escherichia coli, Francisella tularensis, Fusobacterium nucleatum, Gardnerella vaginalis, Haemophilus influenzae, Haemophilus parainfluenzae, Haemophilus pertussis, Haemophilus vaginalis, Helicobacter pylori, Klebsiella pneumoniae, Lactobacillus acidophilus, Lactococcus lactis, Legionella pneumophila, Listeria monocytogenes, Methanobacterium extroquens, Microbacterium multiforme, Micrococcus luteus, Moraxella catarrhalis, Mycobacterium phlei, Mycobacterium smegmatis, Mycobacterium tuberculosis, Mycoplasma genitalium, Mycoplasma hominis, Mycoplasma pneumonie, Neisseria gonorrhoeae, Neisseria meningitidis, Pasteurella multocida, Pasteurella tularensis,

Peptostreptococcus, Porphyromonas gingivalis, Prevotella melaninogenica, Pseudomonas aeruginosa, Rhizobium radiobacter, Rickettsia rickettsii, Rothia dentocariosa, Salmonella enteritidis, Salmonella typhi, Salmonella typhimurium, Shigella dysenteriae, Staphylococcus aureus, Staphylococcus epidermidis, Stenotrophomonas maltophilia, Streptococcus pneumoniae, Streptococcus pyogenes, Treponema pallidum, Treponema denticola, Vibrio cholerae, Vibrio comma, Vibrio parahaemolyticus, Vibrio vulnificus, Yersinia enterocolitica and Yersinia pseudotuberculosis . The antibody may be based on or derived from a bacterial vaccine. The anti -viral antibody may be based on or derived from nebacumab, panobacumab, raxibacumab, edobacomab, pagibaximab, and/or tefibazumab.

[0059] A Kvl.3 inhibitor antibody may comprise an antibody sequence from an anti-bacterial antibody G. The antibody portion may comprise at least a portion of an anti-bacterial antibody G. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of an anti-bacterial antibody G. In some embodiments the antibody portion comprises an amino acid sequence based on or derived from an antibacterial antibody M.

[0060] The antibody portion may comprise an antibody sequence from a Nebacumab, Panobacumab, Raxibacumab, Edobacomab, Pagibaximab, and/or Tefibazumab antibody. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of a nebacumab, panobacumab, raxibacumab, edobacomab, pagibaximab, and/or tefibazumab antibody.

[0061] The antibody portion may comprise an antibody sequence from an anti-parasitic antibody. The antiparasitic antibody may be directed against an epitope of a parasite protein. The anti-parasitic antibody may target parasites or parasite proteins including, but not limited to parasites Acanthamoeba, Balamuthia mandrillaris, Babesia (B. divergens, B. bigemina, B. equi, B. microfti, B. duncani), Balantidium coli, Blastocystis, Cryptosporidium, Dientamoeba fragilis, Entamoeba histolytica, Giardia lamblia, Isospora belli, Leishmania, Naegleria fowleri, Plasmodium falciparum, Plasmodium vivax, Plasmodium ovale curtisi, Plasmodium ovale wallikeri, Plasmodium malariae, Plasmodium knowlesi, Rhinosporidium seeben, Sarcocystis bovihominis,Sarcocystis suihominis, Toxoplasma gondii, Trichomonas vaginalis, Trypanosoma brucei, Trypanosoma cruzi, Cestoda, Taenia multiceps, Diphyllobothrium latum, Echinococcus granulosus, Echinococcus multilocularis, Echinococcus vogeli, Echinococcus oligarthrus, Hymenolepis nana,

Hymenolepis diminuta, Taenia saginata, Taenia solium, Bertiella mucronata, Bertiella studeri, Spirometra erinaceieuropaei, Clonorchis sinensis; Clonorchis viverrini, Dicrocoelium dendriticum, Fasciola hepatica, Fasciola gigantica, Fasciolopsis buski, Gnathostoma spinigerum, Gnathostoma hispidum, Metagonimus yokogawai, Opisthorchis viverrini, Opisthorchis felineus, Clonorchis sinensis, Paragonimus westermani; Paragonimus africanus; Paragonimus caliensis; Paragonimus kellicotti; Paragonimus skrjabini; Paragonimus uterobilateralis, Schistosoma sp., Schistosoma mansoni, Schistosoma haematobium, Schistosoma japonicum, Schistosoma mekongi, Echinostoma echinatum, Trichobilharzia regenti, Schistosomatidae, Ancylostoma duodenale, Necator americanus, Angiostrongylus costaricensis, Anisakis, Ascaris sp. Ascaris lumbricoides, Baylisascaris procyonis, Brugia malayi, Brugia timori, Dioctophyme renale, Dracunculus medinensis, Enterobius vermicularis, Enterobius gregorii, Halicephalobus gingivalis, Loa filaria, Mansonella streptocerca, Onchocerca volvulus, Strongyloides stercoralis, Thelazia californiensis, Thelazia callipaeda, Toxocara canis, Toxocara cati, Trichinella spiralis, Trichinella britovi, Trichinella nelsoni, Trichinella nativa, Trichuris trichiura, Trichuris vulpis, Wuchereria bancrofti, Archiacanthocephala, Moniliformis moniliformis,

Linguatula serrata, Oestroidea, Calliphoridae, Sarcophagidae, Tunga penetrans, Dermatobia hominis, Ixodidae, Argasidae, Cimex lectularius, Pediculus humanus, Pediculus humanus corporis, Pthirus pubis, Demodex folliculorum/brevis/canis, Sarcoptes scabiei, Cochliomyia hominivorax, and Pulex irritans.

[0062] The antibody portion may comprise an antibody sequence from an anti-parasitic antibody G. The antibody portion may comprise at least a portion of an anti -parasitic antibody G. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of an anti -parasitic antibody G.

[0063] The antibody portion may comprise an antibody sequence from an anti-fungal antibody. The antibacterial antibody may be directed against an epitope of a fungal protein. The anti-fungal antibody may target fungi or fungal proteins including, but not limited to Cryptococcus neoformans, Cryptococcus gattii, Candida albicans, Candida tropicalis, Candida stellatoidea, Candida glabrata, Candida krusei, Candida parapsilosis, Candida guilliermondii, Candida viswanathii, Candida lusitaniae, Rhodotorula mucilaginosa,

Schizosaccharomyces pombe, Saccharomyces cerevisiae, Brettanomyces bruxellensis, Candida stellata, Schizosaccharomyces pombe, Torulaspora delbrueckii, Zygosaccharomyces bailii, Yarrowia lipolytica, Saccharomyces exiguus and Pichia pastoris. The anti-fungal antibody may be based on or derived from efungumab.

[0064] The antibody portion may comprise an antibody sequence from an anti-fungal antibody G. The antibody portion may comprise at least a portion of an anti -fungal antibody G. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of an anti -fungal antibody G.

[0065] The antibody portion may comprise an antibody sequence from a trastuzumab antibody G antibody. The antibody portion may comprise at least a portion of a trastuzumab antibody G antibody. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of a trastuzumab antibody G antibody.

[0066] The antibody portion may comprise an antibody sequence from an anti-Her2 antibody. The antibody portion may comprise at least a portion of an anti-Her2 antibody. The antibody portion may comprise an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, or 97% or more identical to at least a portion of an anti-Her2 antibody.

[0067] The antibody portion may comprise an antibody sequence from an anti-cancer antibody. Examples of anti -cancer antibody include, but are not limited to, abciximab, adalimumab, alemtuzumab, basiliximab, belimumab, bevacizumab, brentuximab, canakinumab, certolizumab, cetuximab, daclizumab, denosumab, eculizumab, efalizumab, gemtuzumab, golimumab, ibritumomab, infliximab, ipilimumab, muromonab-cd3, natalizumab, ofatumumab, omalizumab, palivizumab, panitumumab, ranibizumab, rituximab, tocilizumab, tositumomab, trastuzumab.

[0068] The antibody portion of a Kvl .3 inhibitor antibody may comprise at least a portion of a human antibody. The antibody portion may comprise at least a portion of a humanized antibody. The antibody portion may comprise at least a portion of a chimeric antibody. The antibody portion may be based on or derived from a human antibody. The antibody portion may be based on or derived from a humanized antibody. The antibody portion may be based on or derived from a chimeric antibody. The antibody portion may be based on or derived from a monoclonal antibody. The antibody portion may be based on or derived from a polyclonal antibody. The antibody portion may comprise at least a portion of an antibody from a mammal, avian, reptile, amphibian, or a combination thereof. The mammal may be a human. The mammal may be a non-human primate. The mammal may be a dog, cat, sheep, goat, cow, rabbit, or mouse.

Kvl.3 Peptide Inhibitors and Additional Therapeutic Peptides

[0069] In one aspect, provided herein is a Kvl.3 inhibitor comprising an amino acid sequence selected from SEQ ID NOS: 12-15, 131, and 36-63, and compositions comprising the Kvl.3 inhibitor. In some embodiments, the Kvl .3 inhibitor comprises SEQ ID NO: 36

(I(X1)(Z1)VG(X2)(X3)E(Z2)(X4)P(X5)(Z3)(X6)AQ(X7)G(Z4)(X8)(X9)GK(Z5)MNRK(Z6)K(Z7)(X10)(X1 1)(Z8)), wherein XI is S or K; X2 is S or P; X3 is P or K; X4 is P or L; X5 is K or P; X6 is R or G; X7 is T or indicates no amino acid present at this position; X8 is K or P; X9 is N or Y; X10 is Y or N; XI 1 is Y, R, F or G; Zl is C, A, G, S, I, or L; Z2 is C, A, G, S, I, or L; Z3 is C, A, G, S, I, or L; Z4 is C, A, G, S, I, or L; Z5 is C, A, G, S, I, or L; Z6 is C, A, G, S, I, or L; Z7 is C, A, G, S, I, or L; and Z8 is C, A, G, S, I, or L. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 37, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 37 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 38, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 38 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 39, or an amino acid sequence diffenng in amino acid sequence from SEQ ID NO: 39 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 40, or an amino acid sequence diffenng in amino acid sequence from SEQ ID NO: 40 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 41, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 41 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 42, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 42 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 43, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 43 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 44, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 44 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 45, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 45 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 46, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 46 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 47, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 47 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 48, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 48 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 49, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 49 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 50, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 50 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 51, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 51 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 52, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 52 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 53, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 53 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 54, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 54 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 55, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 55 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 56, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 56 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 57, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 57 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 58, or an amino acid sequence diffenng in amino acid sequence from SEQ ID NO: 58 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 59, or an amino acid sequence diffenng in amino acid sequence from SEQ ID NO: 59 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 60, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 60 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 61, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 61 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 62, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 62 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 63, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 63 by fewer than 4 amino acid deletions and/or substitutions. In some embodiments, the Kvl .3 peptide inhibitor comprises SEQ ID NO: 131, or an amino acid sequence differing in amino acid sequence from SEQ ID NO: 131 by fewer than 4 amino acid deletions and/or substitutions.

[0070] Further disclosed herein are antibody fusion proteins comprising a therapeutic peptide, such as a Kvl .3 peptide inhibitor. Non-limiting examples of Kvl.3 peptide inhibitors include Toxin A, Toxin B, Toxin XX, Toxins C-Z, Toxins AA-CC, and Shk-toxin (SEQ ID NO: 131,

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC). The therapeutic peptide may be connected to/within a CDR of an antibody variable domain, optionally with one or more extension peptides and/or linkers. In some cases, the variable domain has been modified to reduce antigen binding.

[0071] In some embodiments, a Kvl.3 inhibitor peptide provided herein binds to a cation channel, such as a potassium, sodium, and/or calcium channel; and or an anion channel such as a chlorine channel. Therapeutic peptides may bind to both receptors and voltage-gated channels. Non-limiting examples of channels or receptors include kanate; a-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid (AMP A); N-methyl-D- aspartate (NMD A) and acetylcholine receptors (such as .alpha.9/.alpha.10 subtype (nAChR)); serotonin (5- hydroxytryptamine, 5-HT) receptors; and glycine and .gamma. -butyric (GAB A) receptors. Intracellular receptors include cyclic AMP (cAMP), cyclic GMP (cGMP), Ca2+, and G-protein receptors. In various cases, a therapeutic peptide binds to a voltage gated channel, such as Kvl .3, but may also bind to one or more of the following channels: Kvl. l, Kvl.2, Kvl.4, Kvl .5, Kvl .6, Kvl .7, Kv2.1 , Kv3.1 , Kv3.2, Kvl l .1 (hERG), Kcl . l, Kc2.1, Kc3.1, KCa3.1, Navl .2, Navl.4, Navl.5, and Cavl .2 channels. A therapeutic peptide may be a naturally occurring toxin, or modified from a naturally occurring toxin, the naturally occurring toxin being from a snake, scorpion, spider, bee, snail or sea anemone. A therapeutic peptide may be a synthetic peptide. In some cases, a therapeutic peptide comprises from about 1 to about 5, or 1, 2, 3, 4 or 5 disulfide bonds.

[0072] In various cases, a therapeutic peptide is an inhibiting peptide which includes any toxin-based therapeutic that decreases or eliminates a biological activity that normally results based on the interaction of a compound with a receptor and/or channel, including biosynthetic activity, catalytic activity, receptor activity, signal transduction pathway activity, gene transcription or translation, cellular protein transport, and the like. In some cases, the inhibiting peptide is an inhibitor of Kvl .3. In some cases, the inhibiting peptide is an inhibitor of Kvl .l, Kvl.2, Kvl.3, Kvl.4, Kvl.5, Kvl .6, Kvl .7, Kv2.1 , Kv3.1, Kv3.2, Kvl l .1, Kcl. l, Kc2.1, Kc3.1, Navl .2, Navl .4, KCa3.1, Navl .5, and Cavl .2, or any combination thereof. In some cases, a peptide inhibitor of Kvl .3 also inhibits one or more of Kvl . l, Kvl .2, Kvl .3, Kvl .4, Kvl.5, Kvl.6, Kvl.7, Kv2.1 , Kv3.1, Kv3.2, Kvl 1.1, Kcl. l, Kc2.1, Kc3.1, Navl .2, Navl.4, KCa3.1, Navl .5, and Cavl.2. Accordingly, reference herein to a "Kvl.3 inhibitor" is inclusive of a molecule that binds to a receptor and/or voltage-gated channel, such as Kvl. l, Kvl.2, Kvl .3, Kvl .4, Kvl .5, Kvl .6, Kvl.7, Kv2.1 , Kv3.1, Kv3.2, Kvl l .1, Kcl . l, Kc2.1, Kc3.1, Navl.2, Navl .4, KCa3.1, Navl.5, and Cavl .2 channels.

[0073] In some embodiments, a Kvl.3 inhibitor comprising SEQ ID NO: 13 binds to Kvl.3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kvl .1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kvl.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kvl .4. In some embodiments, a Kvl.3 inhibitor comprising SEQ ID NO: 13 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kc l . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 13 binds to Navl .5. In some embodiments, a Kvl 3 inhibitor comprising SEQ ID NO: 13 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0074] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 15 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 15 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to K l .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 15 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 15 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0075] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 36 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0076] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kvl 1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to K l .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 37 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 37 binds to Cavl .2. In some cases, the Kvl .3 mhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0077] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 38 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 38 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 38 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 38 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 38 binds to Kv3.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 38 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 38 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 38 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0078] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 39 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 39 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0079] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 40 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 40 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 40 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0080] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 41 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 41 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 41 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 41 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 41 binds to Kv3.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 41 binds to Kv3 2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 41 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Navl .4. In some embodiments, a K l .3 inhibitor comprising SEQ ID NO: 41 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 41 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0081] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 42 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 42 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 42 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 42 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 42 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 42 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0082] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 43 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 43 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Navl 2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 43 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0083] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kvl .1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 44 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 44 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 44 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 44 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0084] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 45 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 45 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 45 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0085] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 46 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 46 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 46 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0086] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 47 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 47 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 47 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0087] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 48 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 48 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to K l .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kvl l . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 48 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0088] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 49 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 49 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 49 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 49 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0089] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 50 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 50 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0090] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 51 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 51 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 51 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 51 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 51 binds to Kv3.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 51 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 51 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 51 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel. [0091] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 52 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 52 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kv 1.4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kvl l . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 52 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0092] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kvl l . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 53 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0093] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kvl l . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 54 binds to Navl .5. In some embodiments, a Kvl 3 inhibitor comprising SEQ ID NO: 54 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0094] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kvl l . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 55 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0095] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 56 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0096] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kvl 1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to K l . . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 57 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 57 binds to Cavl .2. In some cases, the Kvl .3 mhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0097] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 58 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 58 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 58 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 58 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 58 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 8 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 58 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0098] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl .3. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 59 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 59 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[0099] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 60 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 60 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kvl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 60 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[00100] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 61 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 61 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 61 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 61 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 61 binds to Kv3.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 61 binds to Kv3 2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 61 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[00101] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 62 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 62 binds to Kvl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO : 62 binds to Kv 1.4. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 62 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kvl .6. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kvl .7. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kv3.2. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 62 binds to Kv 1 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kcl . l . In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Kc3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Navl .2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Navl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 62 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl .3 inhibitor that "binds to" a channel, inhibits the channel.

[00102] In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kvl .3. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO : 63 binds to Kv 1.1. In some embodiments, a Kv 1.3 inhibitor comprising SEQ ID NO: 63 binds to Kvl.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kv 1.4. In some embodiments, a Kvl.3 inhibitor comprising SEQ ID NO: 63 binds to Kvl .5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kvl .6. In some embodiments, a K l .3 inhibitor comprising SEQ ID NO: 63 binds to Kvl .7. In some embodiments, a Kvl.3 inhibitor comprising SEQ ID NO: 63 binds to Kv2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kv3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kv3.2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kvl 1.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kcl .l . In some embodiments, a Kvl.3 inhibitor comprising SEQ ID NO: 63 binds to Kc2.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Kc3.1. In some embodiments, a Kvl.3 inhibitor comprising SEQ ID NO: 63 binds to Navl2. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Navl .4. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to KCa3.1. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Navl.5. In some embodiments, a Kvl .3 inhibitor comprising SEQ ID NO: 63 binds to Cavl .2. In some cases, the Kvl .3 inhibitor is present in a composition and/or antibody fusion. In some cases, a Kvl.3 inhibitor that "binds to" a channel, inhibits the channel.

[00103] An antibody fusion may comprise a therapeutic peptide inhibitor comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 13. An antibody fusion may comprise a therapeutic peptide inhibitor comprising a sequence of about 5, 10, 20, or all amino acids from SEQ ID NO: 13. An antibody fusion may comprise a therapeutic peptide inhibitor comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 15. An antibody fusion may comprise a therapeutic peptide inhibitor comprising a sequence of about 5, 10, 20, or all amino acids from SEQ ID NO: 15. An antibody fusion may comprise a variant of a therapeutic peptide inhibitor, which includes a peptide having one or more amino acid additions, deletions, or substitutions as compared to a therapeutic peptide inhibitor selected from any one of SEQ ID NOS: 13 and 15. Variants of therapeutic peptide inhibitors include those having one or more conservative amino acid substitutions. A conservative substitution may involve a substitution found in one of the following conservative substitutions groups: Group 1: Alanine (Ala; A), Glycine (Gly; G), Serine (Ser; S), Threonine (Thr; T); Group 2: Aspartic acid (Asp; D), Glutamic acid (Glu; E); Group 3: Asparagine (Asn; N), Glutamine (Gin; Q); Group 4: Arginine (Arg; R), Lysine (Lys; K), Histidine (His; H); Group 5: Isoleucine (He; I), Leucine (Leu; L), Methionine (Met; M), Valine (Val; V); and Group 6: Phenylalanine (Phe; F), Tyrosine (Tyr; Y), Tryptophan (Trp; W). Additionally, amino acids may be grouped into conservative substitution groups by similar function, chemical structure, or composition. For example, an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and He. Other groups including amino acids that are considered conservative substitutions for one another may include: sulfur-containing: Met and Cys; acidic: Asp, Glu, and Asn; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, and Glu; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, He, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. [00104] A Kvl .3 inhibitor antibody fusion may comprise a Kvl.3 peptide inhibitor comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 13. A Kvl .3 inhibitor antibody fusion may comprise Kvl .3 peptide inhibitor comprising a sequence of about 5, 10, 20, or all amino acids from SEQ ID NO: 13. A Kvl .3 inhibitor antibody fusion may comprise a Kvl .3 peptide inhibitor comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 15. A Kvl .3 inhibitor antibody fusion may comprise Kvl .3 peptide inhibitor comprising a sequence of about 5, 10, 20, or all amino acids from SEQ ID NO: 15.

An antibody fusion may comprise a therapeutic peptide inhibitor comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to a sequence selected from SEQ ID NOS: 36-63, 131. An antibody fusion may comprise a therapeutic peptide inhibitor comprising a sequence of about 5, 10, 20, or all amino acids from a sequence selected from SEQ ID NOS: 36-63, 131. An antibody fusion may comprise a variant of a therapeutic peptide inhibitor, which includes a peptide having one or more amino acid additions, deletions, or substitutions as compared to a therapeutic peptide inhibitor selected from any one of SEQ ID NOS: 36-63, 131. Variants of therapeutic peptide inhibitors include those having one or more conservative amino acid substitutions. A conservative substitution may involve a substitution found in one of the following conservative substitutions groups: Group 1 : Alanine (Ala; A), Glycine (Gly; G), Serine (Ser; S), Threonine (Thr; T); Group 2: Aspartic acid (Asp; D), Glutamic acid (Glu; E); Group 3 : Asparagine (Asn; N), Glutamine (Gin; Q); Group 4: Arginine (Arg; R), Lysine (Lys; K), Histidine (His; H); Group 5 : Isoleucine (lie; I), Leucine (Leu; L), Methionine (Met; M), Valine (Val; V); and Group 6: Phenylalanine (Phe; F), Tyrosine (Tyr; Y), Tryptophan (Trp; W). Additionally, amino acids may be grouped into conservative substitution groups by similar function, chemical structure, or composition. For example, an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and He. Other groups including amino acids that are considered conservative substitutions for one another may include: sulfur-containing: Met and Cys; acidic: Asp, Glu, and Asn; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, and Glu; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, He, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp.

Extension Peptides and Linkers

[00105] Kvl .3 inhibitor antibody fusion proteins may comprise one or more extension peptides and/or linkers. In some cases, a Kvl .3 peptide inhibitor is fused with one or more extension peptides within an insert portion into a CDPv or an antibody variable domain. In some cases, the insert portion replaces one or more amino acids (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) of the CDR. In some cases, the insert portion does not replace an amino acid of the CDR. The insert portion may comprise: a first extension sequence, Kvl .3 peptide inhibitor, and a second extension sequence. The first and second extension sequences may comprise amino acid sequences which form a coiled coil. The first and second extension sequences may comprise amino acid sequences which form a beta sheet. The insert portion may further comprise one or more linkers. In some cases, a linker comprises between 1 and 50 amino acids, between 1 and 20 amino acids, between 1 and 10 amino acids, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids. In some cases, a linker comprises at least 5, 6, 7, 8, 9, 10, 15, 20, or 30 amino acids. In some cases, the linker does not comprise regular secondary structure (e.g., beta strand, turn, helix).

[00106] The Kvl .3 antibody fusion may have Formula I. The CDR fused with the Kvl .3 peptide inhibitor may be a CDR3 of an antibody light chain. The CDR fused with the Kvl .3 peptide inhibitor may be a CDR2 of an antibody light chain. The CDR fused with the Kvl .3 peptide inhibitor may be a CDR1 of an antibody light chain. The CDR fused with the Kvl .3 peptide inhibitor may be a CDR3 of an antibody heavy chain. The CDR fused with the Kvl .3 peptide inhibitor may be a CDR2 of an antibody heavy chain. The CDR fused with the Kvl .3 peptide inhibitor may be a CDR1 of an antibody heavy chain.

[00107] A Kvl .3 inhibitor antibody fusion may comprise a first extension peptide comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 16. A Kvl .3 inhibitor antibody fusion may comprise a second extension peptide comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 17.

[00108] A Kvl .3 inhibitor antibody fusion may comprise a first extension peptide comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 18. A Kvl .3 inhibitor antibody fusion may comprise a second extension peptide comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 19.

[00109] A Kvl .3 inhibitor antibody fusion may comprise a linker comprising an amino acid sequence that is identical to or at least about 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO: 20.

Vectors, Host Cells and Recombinant Methods

[00110] Antibody fusion proteins, as disclosed herein, may be expressed and purified by known recombinant and protein purification methods. In some instances, the activity of the antibody fusion protein is affected by expression and/or purification methods. For example, the activity of an antibody fusion protein configured for use as a therapeutic, is enhanced or attenuated based on the identity of the expression vector, identity of the recombinant host, identity of the cell line, expression reaction conditions, purification methods, protein processing, or any combination thereof. Expression reaction conditions include, but are not limited to, temperature, % C0₂, media, expression time, cofactors, and chaperones. Purification methods include, but are not limited to, purification temperatures, chromatography resins, protease inhibitors, and buffer compositions.

[00111] Antibody fusion proteins, as disclosed herein, may be expressed by recombinant methods. Generally, a nucleic acid encoding an antibody fusion protein may be isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding the antibody fusion protein may be prepared by PCR amplification and sequenced using conventional procedures (e.g., by using

oligonucleotide probes that are capable of binding specifically to nucleotides encoding Antibody fusion proteins). In an exemplary embodiment, nucleic acid encoding an antibody fusion protein is PCR amplified, restriction enzyme digested and gel purified. The digested nucleic acid may be inserted into a replicable vector. The replicable vector containing the digested antibody fusion protein insertion may be transformed or transduced into a host cell for further cloning (amplification of the DNA) or for expression. Host cells may be prokaryotic or eukaryotic cells.

[00112] Polynucleotide sequences encoding polypeptide components (e.g. , antibody portion, Kvl .3 peptide inhibitor) of the antibody fusion proteins may be obtained by PCR amplification. Polynucleotide sequences may be isolated and sequenced from cells containing nucleic acids encoding the polypeptide components. Alternatively, or additionally, polynucleotides may be synthesized using nucleotide synthesizer or PCR techniques. Once obtained, sequences encoding the polypeptide components may be inserted into a recombinant vector capable of replicating and expressing heterologous polynucleotides in prokaryotic and/or eukaryotic hosts.

[00113] In addition, phage vectors containing replicon and control sequences that are compatible with the host microorganism may be used as transforming vectors in connection with these hosts. For example, bacteriophage such as λΟΕΜ™-1 1 may be utilized in making a recombinant vector which may be used to transform susceptible host cells such as E. coli LE392.

[00114] Antibody fusion proteins may be expressed intracellularly (e.g., cytoplasm) or extracellularly (e.g., secretion). For extracellular expression, the vector may comprise a secretion signal which enables translocation of the antibody fusion proteins to the outside of the cell.

[00115] Suitable host cells for cloning or expression of antibody fusion proteins-encoding vectors include prokaryotic or eukaryotic cells. The host cell may be a eukaryotic. Examples of eukaryotic cells include, but are not limited to, Human Embryonic Kidney (HEK) cell, Chinese Hamster Ovary (CHO) cell, fungi, yeasts, invertebrate cells (e.g., plant cells and insect cells), lymphoid cell (e.g. , YO, NSO, Sp20 cell). Other examples of suitable mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); baby hamster kidney cells (BHK); mouse Sertoli cells; monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TR1 cells; MRC 5 cells; and FS4 cells. The host cell may be a prokaryotic cell (e.g., E. coli ).

[00116] Host cells may be transformed with vectors containing nucleotides encoding an antibody fusion proteins. Transformed host cells may be cultured in media. The media may be supplemented with one or more agents for inducing promoters, selecting transformants, or amplifying or expressing the genes encoding the desired sequences. Methods for transforming host cells are known in the art and may include electroporation, calcium chloride, or polyethylene glycol/DMSO.

[00117] Alternatively, host cells may be transfected or transduced with vectors containing nucleotides encoding an antibody fusion proteins. Transfected or transduced host cells may be cultured in media. The media may be supplemented with one or more agents for inducing promoters, selecting transfected or transduced cells, or expressing genes encoding the desired sequences.

[00118] The expressed antibody fusion proteins may be secreted into and recovered from the periplasm of the host cells or transported into the culture media. Protein recovery from the periplasm may involve disrupting the host cell. Disruption of the host cell may comprise osmotic shock, sonication or lysis. Centrifugation or filtration may be used to remove cell debris or whole cells. The antibody fusion proteins may be further purified, for example, by affinity resin chromatography.

[00119] Alternatively, antibody fusion proteins that are secreted into the culture media may be isolated therein. Cells may be removed from the culture and the culture supernatant being filtered and concentrated for further purification of the proteins produced. The expressed polypeptides may be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assay.

[00120] Antibody fusion proteins production may be conducted in large quantity by a fermentation process. Various large-scale fed-batch fermentation procedures are available for production of recombinant proteins. Large-scale fermentations have at least 1000 liters of capacity, preferably about 1,000 to 100,000 liters of capacity. These fermentors use agitator impellers to distribute oxygen and nutrients, especially glucose (a preferred carbon/energy source). Small scale fermentation refers generally to fermentation in a fermentor that is no more than approximately 100 liters in volumetric capacity, and can range from about 1 liter to about 100 liters.

[00121] In a fermentation process, induction of protein expression is typically initiated after the cells have been grown under suitable conditions to a desired density, e.g., an OD550 of about 180-220, at which stage the cells are in the early stationary phase. A variety of inducers may be used, according to the vector construct employed, as is known in the art and described herein. Cells may be grown for shorter periods prior to induction. Cells are usually induced for about 12-50 hours, although longer or shorter induction time may be used.

[00122] To improve the production yield and quality of the antibody fusion proteins disclosed herein, various fermentation conditions may be modified. For example, to improve the proper assembly and folding of the secreted antibody fusion proteins polypeptides, additional vectors overexpressing chaperone proteins, such as Dsb proteins (DsbA, DsbB, DsbC, DsbD and or DsbG) or FkpA (a peptidylprolyl cis,trans-isomerase with chaperone activity) may be used to co-transform the host prokaryotic cells. The chaperone proteins have been demonstrated to facilitate the proper folding and solubility of heterologous proteins produced in bacterial host cells.

[00123] To minimize proteolysis of expressed heterologous proteins (especially those that are proteolytically sensitive), certain host strains deficient for proteolytic enzymes may be used for the present disclosure. For example, host cell strains may be modified to effect genetic mutation(s) in the genes encoding known bacterial proteases such as Protease III, OmpT, DegP, Tsp, Protease I, Protease Mi, Protease V, Protease VI and combinations thereof. Some E. coli protease-deficient strains are available.

[00124] Standard protein purification methods known in the art may be employed. The following procedures are exemplary of suitable purification procedures: fractionation on immunoaffmity or ion-exchange columns, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation -exchange resin such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography and gel filtration using, for example, Sephadex G-75. [00125] Antibody fusion proteins may be concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon^® ultrafiltration unit.

[00126] Protease inhibitors or protease inhibitor cocktails may be included in any of the foregoing steps to inhibit proteolysis of the antibody fusion proteins.

[00127] In some cases, an antibody fusion protein may not be biologically active upon isolation. Various methods for "refolding" or converting a polypeptide to its tertiary structure and generating disulfide linkages, may be used to restore biological activity. Such methods include exposing the solubilized polypeptide to a pH usually above 7 and in the presence of a particular concentration of a chaotrope. The selection of chaotrope is very similar to the choices used for inclusion body solubilization, but usually the chaotrope is used at a lower concentration and is not necessarily the same as chaotropes used for the solubilization. In most cases the refolding/oxidation solution will also contain a reducing agent or the reducing agent plus its oxidized form in a specific ratio to generate a particular redox potential allowing for disulfide shuffling to occur in the formation of the protein's cysteine bridge(s). Some of the commonly used redox couples include

cysteine/cystamine, glutathione (GSH)/dithiobis GSH, cupric chloride, dithiothreitol(DTT)/dithiane DTT, and 2-mercaptoethanol(bME)/di-thio-b(ME). In many instances, a cosolvent may be used to increase the efficiency of the refolding, and common reagents used for this purpose include glycerol, polyethylene glycol of various molecular weights, arginine and the like.

Compositions

[00128] Disclosed herein are compositions comprising a K l.3 inhibitor, an antibody fusion protein and/or component of an antibody fusion protein disclosed herein. The compositions may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more Kvl .3 inhibitors and/or antibody fusion proteins. The Kvl .3 inhibitors and antibody fusion proteins may be different. Alternatively, they may be the same or similar. The antibody fusion proteins may comprise different antibody portions, therapeutic peptides or a combination thereof.

[00129] The compositions may further comprise one or more pharmaceutically acceptable salts, excipients or vehicles. Pharmaceutically acceptable salts, excipients, or vehicles for use in the present pharmaceutical compositions include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.

[00130] Neutral buffered saline or saline mixed with serum albumin are exemplary appropriate carriers. The pharmaceutical compositions may include antioxidants such as ascorbic acid; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or antibodies; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine;

monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, pluronics, or polyethylene glycol (PEG). Also by way of example, suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol, and the like. Suitable preservatives include benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like. Hydrogen peroxide also may be used as preservative. Suitable cosolvents include glycerin, propylene glycol, and PEG. Suitable complexing agents include caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxy-propyl-beta-cyclodextrin.

Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal, and the like. The buffers may be conventional buffers such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HCl. Acetate buffer may be about pH 4-5.5, and Tris buffer may be about pH 7-8.5. Additional pharmaceutical agents are set forth in Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company, 1990.

[00131] The composition may be in liquid form or in a lyophilized or freeze-dried form and may include one or more lyoprotectants, excipients, surfactants, high molecular weight structural additives and or bulking agents (see, for example, U.S. Patent Nos. 6,685,940, 6,566,329, and 6,372,716). In one embodiment, a lyoprotectant is included, which is a non -reducing sugar such as sucrose, lactose or trehalose. The amount of lyoprotectant generally included is such that, upon reconstitution, the resulting formulation will be isotonic, although hypertonic or slightly hypotonic formulations also may be suitable. In addition, the amount of lyoprotectant should be sufficient to prevent an unacceptable amount of degradation and/or aggregation of the protein upon lyophilization. Exemplary lyoprotectant concentrations for sugars (e.g., sucrose, lactose, trehalose) in the pre-lyophilized formulation are from about 10 mM to about 400 mM. In another embodiment, a surfactant is included, such as for example, nonionic surfactants and ionic surfactants such as polysorbates (e.g., polysorbate 20, polysorbate 80); poloxamers (e.g., poloxamer 188); poly(ethylene glycol) phenyl ethers (e.g. , Triton); sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl-or stearyl-sarcosine; linoleyl, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g., lauroamidopropyl); myristamidopropyl-,

palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl ofeyl- taurate; the MONAQUAT™ series (Mona Industries, Inc., Paterson, N.J.), polyethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol (e.g., Pluronics, PF68 etc). Exemplary amounts of surfactant that may be present in the pre-lyophilized formulation are from about 0.001-0.5%. High molecular weight structural additives (e.g., fillers, binders) may include for example, acacia, albumin, alginic acid, calcium phosphate (dibasic), cellulose, carboxymethylcellulose, carboxymethylcellulose sodium, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, microcrystalline cellulose, dextran, dextrin, dextrates, sucrose, tylose, pregelatinized starch, calcium sulfate, amylose, glycine, bentonite, maltose, sorbitol, ethylcellulose, disodium hydrogen phosphate, disodium phosphate, disodium pyrosulfite, polyvinyl alcohol, gelatin, glucose, guar gum, liquid glucose, compressible sugar, magnesium aluminum silicate, maltodextrin, polyethylene oxide, polymethacrylates, povidone, sodium alginate, tragacanth microcrystalline cellulose, starch, and zein. Exemplary concentrations of high molecular weight structural additives are from 0.1% to 10% by weight. In other embodiments, a bulking agent (e.g., mannitol, glycine) may be included. [00132] Compositions may be suitable for parenteral administration. Exemplary compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as intraarticular, subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral (intraparenchymal),

intracerebroventricular, intramuscular, intraocular, intraarterial, or intralesional routes. A parenteral formulation typically will be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.

[00133] Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringers' dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present, such as, for example, antimicrobials, anti -oxidants, chelating agents, inert gases and the like. See generally, Remington's

Pharmaceutical Science, 16th Ed., Mack Eds., 1980.

[00134] Compositions described herein may be formulated for controlled or sustained delivery in a manner that provides local concentration of the product (e.g., bolus, depot effect) and/or increased stability or half-life in a particular local environment. The compositions may comprise the formulation of antibody fusion proteins, polypeptides, nucleic acids, or vectors disclosed herein with particulate preparations of polymeric compounds such as polylactic acid, polygly colic acid, etc., as well as agents such as a biodegradable matrix, injectable microspheres, microcapsular particles, microcapsules, bioerodible particles beads, liposomes, and implantable delivery devices that provide for the controlled or sustained release of the active agent which then may be delivered as a depot injection. Techniques for formulating such sustained -or controlled-delivery means are known and a variety of polymers have been developed and used for the controlled release and delivery of drugs. Such polymers are typically biodegradable and biocompatible. Polymer hydrogels, including those formed by complexation of enantiomeric polymer or polypeptide segments, and hydrogels with temperature or pH sensitive properties, may be desirable for providing drug depot effect because of the mild and aqueous conditions involved in trapping bioactive protein agents. See, for example, the description of controlled release porous polymeric microparticles for the delivery of pharmaceutical compositions in WO 93/15722.

[00135] Suitable materials for this purpose include polylactides (see, e.g., U.S. Patent No. 3,773,919), polymers of poly-(a-hydroxycarboxylic acids), such as poly-D-(-)-3-hydroxybutyric acid (EP 133,988A), copolymers of L-glutamic acid and gamma ethyl -L-glutamate (Sidman et al, Biopolymers, 22: 547-556 (1983)), poly(2-hydroxyethyl-methacrylate) (Langer et al, J. Biomed. Mater. Res., 15: 167-277 (1981), and Langer, Chem. Tech., 12: 98-105 (1982)), ethylene vinyl acetate, or poly-D(-)-3-hydroxybutyric acid. Other biodegradable polymers include poly(lactones), poly(acetals), poly(orthoesters), and poly(orthocarbonates). Sustained-release compositions also may include liposomes, which may be prepared by any of several methods known in the art (see, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82: 3688-92 (1985)). The carrier itself, or its degradation products, should be nontoxic in the target tissue and should not further aggravate the condition. This may be determined by routine screening in animal models of the target disorder or, if such models are unavailable, in normal animals.

[00136] The antibody fusion proteins disclosed herein may be microencapsulated.

[00137] A pharmaceutical composition disclosed herein can be administered to a subject by any suitable administration route, including but not limited to, parenteral (intravenous, subcutaneous, intraperitoneal, intramuscular, intravascular, intrathecal, intravitreal, infusion, or local), topical, oral, or nasal administration.

[00138] Formulations suitable for intramuscular, subcutaneous, peritumoral, or intravenous injection can include physiologically acceptable sterile aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, and sterile powders for reconstitution into sterile injectable solutions or dispersions. Examples of suitable aqueous and non-aqueous carriers, diluents, solvents, or vehicles including water, ethanol, polyols (propyleneglycol, polyethylene-glycol, glycerol, cremophor and the like), suitable mixtures thereof, vegetable oils (such as olive oil) and injectable organic esters such as ethyl oleate. Proper fluidity is maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. Formulations suitable for subcutaneous injection also contain optional additives such as preserving, wetting, emulsifying, and dispensing agents.

[00139] For intravenous injections, an active agent can be optionally formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline buffer.

[00140] Parenteral injections optionally involve bolus injection or continuous infusion. Formulations for injection are optionally presented in unit dosage form, e.g., in ampoules or in multi dose containers, with an added preservative. The pharmaceutical composition described herein can be in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Pharmaceutical formulations for parenteral administration include aqueous solutions of an active agent in water soluble form. Additionally, suspensions are optionally prepared as appropriate oily injection suspensions.

[00141] Alternatively or additionally, the compositions may be administered locally via implantation into the affected area of a membrane, sponge, or other appropriate material on to which an antibody fusion protein disclosed herein has been absorbed or encapsulated. Where an implantation device is used, the device may be implanted into any suitable tissue or organ, and delivery of an antibody fusion protein, nucleic acid, or vector disclosed herein may be directly through the device via bolus, or via continuous administration, or via catheter using continuous infusion.

[00142] A pharmaceutical composition comprising an antibody fusion protein disclosed herein may be formulated for inhalation, such as for example, as a dry powder. Inhalation solutions also may be formulated in a liquefied propellant for aerosol delivery. In yet another formulation, solutions may be nebulized.

Additional pharmaceutical composition for pulmonary administration include, those described, for example, in WO 94/20069, which discloses pulmonary delivery of chemically modified proteins. For pulmonary delivery, the particle size should be suitable for delivery to the distal lung. For example, the particle size may be from 1 um to 5 um; however, larger particles may be used, for example, if each particle is fairly porous. [00143] Certain formulations comprising an antibody fusion protein disclosed herein may be administered orally. Formulations administered in this fashion may be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules. For example, a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized. Additional agents may be included to facilitate absorption of a selective binding agent. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders also may be employed.

[00144] Another preparation may involve an effective quantity of an antibody fusion protein in a mixture with non-toxic excipients which are suitable for the manufacture of tablets. By dissolving the tablets in sterile water, or another appropriate vehicle, solutions may be prepared in unit dose form. Suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.

[00145] Suitable and/or preferred pharmaceutical formulations may be determined in view of the present disclosure and general knowledge of formulation technology, depending upon the intended route of administration, delivery format, and desired dosage. Regardless of the manner of administration, an effective dose may be calculated according to patient body weight, body surface area, or organ size.

[00146] Further refinement of the calculations for determining the appropriate dosage for treatment involving each of the formulations described herein are routinely made in the art and is within the ambit of tasks routinely performed in the art. Appropriate dosages may be ascertained through use of appropriate dose- response data.

[00147] The compositions disclosed herein may be useful for providing prognostic or providing diagnostic information.

[00148] "Pharmaceutically acceptable" may refer to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.

[00149] "Pharmaceutically acceptable salt" may refer to a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound.

[00150] "Pharmaceutically acceptable excipient, carrier or adjuvant" may refer to an excipient, carrier or adjuvant that may be administered to a subject, together with at least one antibody of the present disclosure, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.

[00151] "Pharmaceutically acceptable vehicle" may refer to a diluent, adjuvant, excipient, or carrier with which at least one antibody of the present disclosure is administered.

Kits

[00152] Further disclosed herein are kits which comprise one or more Kvl .3 inhibitors, antibody fusion proteins or compositions thereof. The Kvl .3 inhibitors and antibody fusion proteins may be packaged in a manner which facilitates their use to practice methods of the present disclosure. For example, a kit comprises a Kvl.3 inhibitor and/or antibody fusion protein described herein packaged in a container with a label affixed to the container or a package insert that describes use of the composition in practicing the method. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. The container may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The kit may comprise a container with the Kvl .3 inhibitor and/or antibody fusion protein contained therein. The kit may comprise a container with an antibody portion of an antibody fusion protein and/or Kvl.3 peptide inhibitor. The kit may further comprise a package insert indicating that the first and second compositions may be used to treat a particular condition. Alternatively, or additionally, the kit may further comprise a second (or third) container comprising a pharmaceutically -acceptable buffer (e.g., bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution). It may further comprise other materials desirable from a commercial and user standpoint, including, but not limited to, other buffers, diluents, filters, needles, and syringes. The antibody fusion protein may be packaged in a unit dosage form. The kit may further comprise a device suitable for administering the antibody fusion protein according to a specific route of administration or for practicing a screening assay. The kit may contain a label that describes use of the antibody fusion protein composition.

[00153] The composition comprising the Kvl .3 inhibitor and/or antibody fusion protein may be formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to mammals, such as humans, bovines, felines, canines, and murines. Typically, compositions for intravenous administration comprise solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and/or a local anaesthetics such as lignocaine to ease pain at the site of the injection. Generally, the ingredients may be supplied either separately or mixed together in unit dosage form. For example, the antibody fusion protein may be supplied as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of the antibody fusion protein. Where the composition is to be administered by infusion, it may be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline may be provided so that the ingredients may be mixed prior to administration.

[00154] The amount of the composition described herein which will be effective in the treatment, inhibition and/or prevention of a disease or disorder associated with aberrant expression and/or activity of a Kvl .3 peptide inhibitor may be determined by standard clinical techniques. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation may also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro, animal model test systems or clinical trials. Therapeutic Use

[00155] Further disclosed herein are Kvl.3 inhibitors and antibody fusion proteins comprising a therapeutic Kvl .3 inhibitor peptide, for treating, alleviating, inhibiting and/or preventing one or more diseases and/or conditions. In some embodiments, the disease or condition is an autoimmune disease and/or a condition related thereto. In some embodiments, the condition is organ transplant.

[00156] Methods of treatment may comprise administering to a subject in need thereof a composition comprising one or more Kvl.3 inhibitor and/or antibody fusion proteins disclosed herein. The Kvl .3 inhibitor and/or antibody fusion may comprise Toxin A, Toxin B, Toxin C, Toxin D, Toxin E, Toxin F, Toxin G, Toxin H, Toxin I, Toxin J, Toxin K, Toxin L, Toxin M, Toxin N, Toxin O, Toxin P, Toxin Q, Toxin R, Toxin S, Toxin T, Toxin U, Toxin V, Toxin W, Toxin X, Toxin Y, Toxin Z, Toxin AA, Toxin BB, Toxin CC, Toxin XX, and/or Shk toxin (SEQ ID NO: 131, RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC) The composition may further comprise a pharmaceutically acceptable carrier. The Kvl.3 inhibitor and/or antibody fusion protein may be substantially purified (e.g., substantially free from substances that limit its effect or produce undesired side -effects). The subject may be an animal, including but not limited to animals such as cows, pigs, sheep, goats, rabbits, horses, chickens, cats, dogs, mice, etc. The subject may be a mammal. The subject may be a human. The subject may be a non-human primate. The subject may be a bovine. The subject may be an avian, reptile or amphibian.

[00157] Provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 13. Provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 15. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 36. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 37. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 38. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 39. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 40. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 41. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 42. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 43. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 44. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 45. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 46. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 47. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 48. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 49. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 50. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 51. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 52. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 53. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 54. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 55. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 56. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 57. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 58. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 59. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 60. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 61. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 62. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 63. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 131.

[00158] Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 7. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 8. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 9. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 10. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 11. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 64. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 65. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 66. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 67. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 68. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 69. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 70. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 71. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 72. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising admimstenng to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 73. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 74. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 75. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 76. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 77. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 78. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 79. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 80. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 81. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 82. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 83. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 84. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising admimstenng to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 85. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 86. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 87. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 88. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 89. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 90. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 91. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 92. Further provided herein is a method of treating an autoimmune disease or condition thereof in a subject, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 93.

[00159] An autoimmune disease may be a T-cell mediated autoimmune disease. Non-limiting examples of autoimmune diseases and conditions thereof include multiple sclerosis (MS), type 1 diabetes mellitus, rheumatoid arthritis (RA), psoriasis, lupus, Sjogren's syndrome, scleroderma, dermatomyositis, Hasmimoto's thyroiditis, Addison's disease, celiac disease, Crohn's disease, pernicious anemia, pemphigus vulgaris, vitiligo, autoimmune hemolytic anemia, idiopathic thrombocytopenic purpura, myasthenia gravis, Ord's thyroiditis, Graves' disease, Guillain-Barre syndrome, acute disseminated encephalomyelitis, opsoclonus-myoclonus syndrome, ankylosing spondylitisis, antiphospholipid antibody syndrome, aplastic anemia, autoimmune hepatitis, Goodpasture's syndrome, Reiter's syndrome, Takayasu's arteritis, temporal arteritis, Wegener's granulomatosis, alopecia universalis, Behcet's disease, chronic fatigue, dysautonomia, endometriosis, interstitial cystitis, neuromyotonia, scleroderma, and vulvodynia. Lupus can include, but may be not limited to, acute cutaneous lupus erythematosus, subacute cutaneous lupus erythematosus, chronic cutaneous lupus erythematosus, discoid lupus erythematosus, childhood discoid lupus erythematosus, generalized discoid lupus erythematosus, localized discoid lupus erythematosus, chilblain lupus erythematosus (hutchinson), lupus erythematosus-lichen planus overlap syndrome, lupus erythematosus panniculitis (lupus erythematosus profundus), tumid lupus erythematosus, verrucous lupus erythematosus (hypertrophic lupus erythematosus), complement deficiency syndromes, drug-induced lupus erythematosus, neonatal lupus erythematosus, and systemic lupus erythematosus.

[00160] Also provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 13. Provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 15. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 36. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 37. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 38. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 39. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 40. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 41. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an ammo acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 42. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 43. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 44. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 45. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 46. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 47. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 48. Further provided herein is a method of treating a subject priorto, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 49. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 50. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 51. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 52. Further provided herein is a method of treating a subject prior to, dunng and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 53. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 54. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl.3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 55. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 56. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 57. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 58. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 59. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 60. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a K l .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%), 95%, or 99% identical to SEQ ID NO: 61. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 62. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 63. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising a Kvl .3 inhibitor and/or antibody fusion comprising a peptide having an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 131.

[00161] Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 7. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 8. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 9. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 10. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 11. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 64. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 65. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 66. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 67. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 68. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 69. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 70. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 71. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 72. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 73. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 74. Further provided herein is a method of treating a subject prior to, during and or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 75. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 76. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 77. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 78. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 79. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 80. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 81. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 82. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 83. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 84. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 85. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 86. Further provided herein is a method of treating a subject prior to, during and or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 87. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 88. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 89. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 90. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 91. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising admimstenng to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 92. Further provided herein is a method of treating a subject prior to, during and/or after an organ transplant, the method comprising administering to the subject a composition comprising an antibody fusion comprising an amino acid sequence identical to or at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 93.

Pharmacological Properties

[00162] Further disclosed herein are methods of improving one or more pharmacological properties of a Kvl.3 peptide inhibitor. Kvl .3 peptide inhibitors include those having SEQ ID NOS: 13, 15, and 36-63. The method may comprise producing an antibody fusion protein disclosed herein. Examples of pharmacological properties may include, but are not limited to, half-life, stability, solubility, immunogenicity, toxicity, bioavailability, absorption, liberation, distribution, metabolization, and excretion. Liberation may refer to the process of releasing of a Kvl .3 peptide inhibitor from the pharmaceutical formulation. Absorption may refer to the process of a substance entering the blood circulation. Distribution may refer to the dispersion or dissemination of substances throughout the fluids and tissues of the body. Metabolization (or

biotransformation, or inactivation) may refer to the recognition by an organism that a foreign substance is present and the irreversible transformation of parent compounds into daughter metabolites. Excretion may refer to the removal of the substances from the body.

[00163] The half-life of a Kvl .3 peptide inhibitor may greater than the half-life of the non-fused Kvl .3 peptide inhibitor. The half-life of the Kvl.3 peptide inhibitor may be greater than 4 hours, greater than 6 hours, greater than 12 hours, greater than 24 hours, greater than 36 hours, greater than 2 days, greater than 3 days, greater than 4 days, greater than 5 days, greater than 6 days, greater than 7 days, greater than 8 days, greater than 9 days, greater than 10 days, greater than 11 days, greater than 12 days, greater than 13 days, or greater than 14 days when administered to a subject. The half-life of the Kvl.3 peptide inhibitor may be greater than 50 hours when administered to a subject. The half-life of the Kvl .3 peptide inhibitor may be greater than 100 hours when administered to a subject.

[00164] As discussed herein, extension of half-life is measured within any subject and/or biological sample of a subject. For example, half-life is measured in human, mouse, rat, or other subject serum. The half -life may be measured after administration of a Kvl .3 inhibitor to a subject. The half-life may be measured after a Kvl .3 inhibitor is incubated in a biological sample isolated from a subject.

[00165] The half-life of the Kvl.3 peptide inhibitor may increase by at least about 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20 or more hours. The half-life of the Kvl.3 peptide inhibitor may increase by at least about 10 hours. The half-life of the Kv 1.3 peptide inhibitor may increase by at least about 20 hours . The half-life of the Kv 1.3 peptide inhibitor may increase by at least about 30 hours. The half-life of the Kvl.3 peptide inhibitor may increase by at least about 40 hours.

[00166] The half-life of a Kvl.3 peptide inhibitor antibody fusion may be at least about 2, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200 or 300-fold greater than the half-life of the non-fused Kvl .3 peptide inhibitor. The half-life of a Kvl.3 peptide inhibitor antibody fusion may be at least about 10-fold greater than the half-life of the non-fused Kvl .3 peptide inhibitor. The half-life of a Kvl .3 peptide inhibitor antibody fusion may be at least about 50-fold greater than the half-life of the non-fused Kvl .3 peptide inhibitor.

[00167] The half-life of a Kvl.3 peptide inhibitor antibody fusion described herein may be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 150%, or 200% greater than the half-life of the non-fused Kvl.3 peptide inhibitor. The half-life of a Kvl.3 peptide inhibitor antibody fusion described herein may be at least about 50% greater than the half-life of the non-fused Kvl.3 peptide inhibitor.

EXAMPLES

[00168] The activity data provided in the following examples are generally obtained using the antibodies defined in the example and exemplified by the provided SEQ ID. It is to be understood that the activities of any antibody fusion protein disclosed herein may be enhanced or attenuated depending on conditions not relating to antibody fusion protein sequence, for example, expression and purification conditions.

Example 1: Generation ofKvl.3 inhibitor antibody fusion proteins

[00169] Peptide synthesis: Toxin B (SEQ ID NO: 15) and Toxin A (SEQ ID NO: 13) toxin peptides were synthesized on solid-phase by InnoPep, Inc (San Diego, CA). Peptide folding, HPLC purification, and LC- MS validation were performed based on published procedures.

[00170] Cloning of antibody expression vectors: The genes encoding Toxin peptides A-Z and AA-CC (SEQ ID NOS: 13, 15, and 37-63) were synthesized by IDT (Coralville, IA) and amplified by polymerase chain reaction using PfuUltra II DNA polymerase (Agilent Technologies, CA). The DNA fragments encoding the heavy and light chains of palivizumab (Syn, SEQ ID NOS: 1-3), or modified palivizumab (SEQ ID NOS: 93- 100), and BVK, along with the linkers (coiled-coil or β-strand) were also synthesized by IDT and amplified by PCR The fusion gene fragments were assembled by overlap extension PCR and digested with the restriction enzymes EcoRI-HF and Nhel-HF (New England Biolabs, MA), followed by DNA gel extraction. The final expression vectors for the fusion antibodies were constructed by in-frame ligation of the assembled DNA into the pFuse backbone (Invivogen, CA) using T4 DNA ligase. The sequences of the resulting mammalian expression vectors were confirmed by DNA sequencing (GENEWIZ, CA). Constructs encoding for the following fusions were generated in this manner: Syn-Toxin A-CDR3L (coiled-coil) (SEQ ID NO: 7); BVK- Toxin A-CDR3H (β-strand) (SEQ ID NO: 8); BVK-Toxin B-CDR3H (β-strand) (SEQ ID NO: 9); Syn-Toxin B-CDR3L (coiled-coil) (SEQ ID NO: 10); Syn-Toxin B-CDR2H (coiled-coil) (SEQ ID NO: 11); Toxin A LC fusion (SEQ ID NO: 65), Toxin C LC fusion (SEQ ID NO: 66), Toxin D LC fusion (SEQ ID NO: 67), Toxin E LC fusion (SEQ ID NO: 68), Toxin F LC fusion (SEQ ID NO: 69), Toxin G LC fusion (SEQ ID NO: 70), Toxin H LC fusion (SEQ ID NO: 71), Toxm I LC fusion (SEQ ID NO: 72), Toxm J LC fusion (SEQ ID NO: 73), Toxin K LC fusion (SEQ ID NO: 74), Toxin L LC fusion (SEQ ID NO: 75), Toxin M LC fusion (SEQ ID NO: 76), Toxin N LC fusion (SEQ ID NO: 77), Toxm O LC fusion (SEQ ID NO: 78), Toxin P LC fusion (SEQ ID NO: 79), Toxm Q LC fusion (SEQ ID NO: 80), Toxin R LC fusion (SEQ ID NO: 81), Toxin S LC fusion (SEQ ID NO: 82), Toxin T LC fusion (SEQ ID NO: 83), Toxm U LC fusion (SEQ ID NO: 84), Toxm V LC fusion (SEQ ID NO: 85), Toxm W LC fusion (SEQ ID NO: 86), Toxin X LC fusion (SEQ ID NO: 87), Toxm Y LC fusion (SEQ ID NO: 88), Toxm Z LC fusion (SEQ ID NO: 89), Toxin AA LC fusion (SEQ ID NO: 90), Toxin BB LC fusion (SEQ ID NO: 91), and Toxin CC LC fusion (SEQ ID NO: 92).

[00171] Heavy chain fusion antibodies comprise the human IgGl heavy chain constant region with mutations (E233P, L234V, L235A, AG236, A327G, A330S, P331S) to reduce complement-dependent and antibody- dependent cell -mediated cytotoxicities.

[00172] Expression and purification of Kyl .3 inhibitor antibody fusions: The genes containing the heavy and light chains of the antibody fusions were co-expressed according to Table 1 by transient transfection in HEK 293F cells (Life Technologies, CA). HEK293F cells were cultured in shaker flasks containing FreeStyle medium (Life Technologies, CA), and were shaken at 125 rpm, 37 °C, with 5% C02. For transfection, 293F cells were grown up to a density of one million cells per mL, and were transfected with the light chain, the heavy chain plasmid, and 293fectin at a ratio of 1:2:6 following the manufacturer's instructions. The expression media were harvested and sterile-filtered every 48h for twice after transfection to collect the secreted proteins. The fusion antibodies were purified by Protein A chromatography (Thermo Fisher, IL) and analyzed by SDS-PAGE and mass spectrometry analysis.

Table 1. Kvl.3 Inhibitor Antibody Fusion Proteins

Antibody Antibody region 1 Antibody region 2 Yield Activity (IC50) in Number FluxOR™ assay

14 Toxin J LC fusion (SEQ palivizumab H5 (SEQ

2.4

ID NO: 73) ID NO: 100)

15 Toxin K LC fusion palivizumab H5 (SEQ

4

(SEQ ID NO: 74) ID NO: 100)

16 Toxin L LC fusion palivizumab H5 (SEQ

2.3

(SEQ ID NO: 75) ID NO: 100)

17 Toxin M LC fusion palivizumab H5 (SEQ

5.4

(SEQ ID NO: 76) ID NO: 100)

18 Toxin N LC fusion palivizumab H5 (SEQ

4

(SEQ ID NO: 77) ID NO: 100)

19 Toxin 0 LC fusion palivizumab H5 (SEQ

6

(SEQ ID NO: 78) ID NO: 100)

20 Toxin P LC fusion palivizumab H5 (SEQ

3.6

(SEQ ID NO: 79) ID NO: 100)

21 Toxin Q LC fusion palivizumab H5 (SEQ

5

(SEQ ID NO: 80) ID NO: 100)

22 Toxin LC fusion palivizumab H5 (SEQ

7

(SEQ ID NO: 81) ID NO: 100)

23 Toxin S LC fusion palivizumab H5 (SEQ

1 1 1.01

(SEQ ID NO: 82) ID NO: 100)

24 Toxin T LC fusion palivizumab H5 (SEQ

3 0.9

(SEQ ID NO: 83) ID NO: 100)

25 Toxin U LC fusion palivizumab H5 (SEQ

4 0.56

(SEQ ID NO: 84) ID NO: 100)

26 Toxin V LC fusion palivizumab H5 (SEQ

4

(SEQ ID NO: 85) ID NO: 100)

27 Toxin W LC fusion palivizumab H5 (SEQ

4

(SEQ ID NO: 86) ID NO: 100)

28 Toxin X LC fusion palivizumab H5 (SEQ

6 10.31

(SEQ ID NO: 87) ID NO: 100)

29 Toxin Y LC fusion palivizumab H5 (SEQ

5.9 1.44

(SEQ ID NO: 88) ID NO: 100)

30 Toxin Z LC fusion palivizumab H5 (SEQ

2 3.22

(SEQ ID NO: 89) ID NO: 100)

31 Toxin AA LC fusion palivizumab H5 (SEQ 5.7 9.65 Antibody Antibody region 1 Antibody region 2 Yield Activity (IC50) in Number FluxOR™ assay

(SEQ ID NO: 90) ID NO: 100)

32 Toxin BB LC fusion palivizumab H5 (SEQ

5

(SEQ ID NO: 91) ID NO: 100)

33 Toxin CC LC fusion palivizumab H5 (SEQ

(SEQ ID NO: 92) ID NO: 100)

[00173] To generate BVK-Toxin B-CDR3H (beta), Toxin B was grafted into BVK scaffold to replace Ala93- Tyrl02 in CDR3H using a beta strand stalk.

[00174] To generate Syn-Toxin B-CDR3H (beta), Toxin B was grafted into the CDR3H of palivizumab. Unfortunately, the CDR3H fusion antibody 5 expressed poorly (<0.5 mg/L), suggesting the folding is unstable. Compared to the BVK scaffold, CDR3H of Synagis scaffold is less solvent-exposed and may not sterically accommodate insertions as readily. Examination of the X-ray crystal structure (FIG. 1) suggested that CDR3L and CDR2H exhibit similar β-strand conformations with multiple intra-loop hydrogen bonds but are more solvent exposed, and may be better sites for the fusion of peptides. However, fusion of Toxin B to these CDRs with an anti-parallel β-strand stalk also resulted in unsatisfactory yields of protein, suggesting that either inter-loop interactions or interactions with surrounding CDRs may not favor the β-strand stalk.

[00175] To generate Toxin B fusions with a coiled coil linker, a Syn-Toxin B fusion protein was created by replacing either Gly92-Tyr93 in CDR3L or Asp56-Asp57 in CDR2H of Synagis with the Toxin B sequence connected by a coiled-coil stalk to afford Syn-Toxin B-CDR3L (SEQ ID NO: 10) or Syn-Toxin B-CDR2H (SEQ ID NO: 11), respectively (FIG. 1). These Synagis-Toxin B fusion antibodies (4, 5) were expressed in HEK293F cells, with a yield of 15.0 mg/L for Syn-Toxin B-CDR3L (4), and a yield of 2.5 mg/L for Syn- Toxin B-CDR2H (5). SDS-PAGE analysis revealed > 90% purity. After reduction by DTT, the light chains migrated at 25-35 kDa, while the heavy chains migrated at 50-65 kDa, matching to the calculated molecular weights of peptide fused and non-fused heavy and light chains. Their identities were further confirmed by ESI-MS. The increased yields of the coiled-coil fusion proteins suggest that the linker design plays a critical role in the creation of viable CDR fusions. In addition, it also appears different CDRs are able to

accommodate insertions to different degrees.

[00176] To generate Toxin A fusions with a coiled coil, CDR3L of palivizumab was selected as a fusion site, and CDR3H of BVK was selected as a fusion site. Both antibodies were expressed in HEK293F cells with good yields (18.3 mg/L for Syn-Toxin A-CDR3L (1) and 10.7 mg/L for BVK-Toxm A-CDR3H (2)), and were characterized by SDS-PAGE and ESI-MS analysis to confirm their identities and purities.

[00177] Antibody fusion labeling with Alexa Fluor 488 dye: To a solution of BVK-Toxin B-CDR3H (Fc null mutant, antibody 3 or Fc wild type) (0.5 mg, 3.3 nmol) in PBS buffer (500 μί, pH 7.4), AF488-NHS ester (50 nmol in 5 uL DMSO, Life technology, CA) was added. The mixture was stirred at 25 °C for 2 h with shaking (50 rpm), and was purified by FPLC with a size exclusion column (Superdex 200 10/300 GL, GE Healthcare, PA). Alternatively, the mixture can be quickly purified by excess buffer exchange with an Amicon filter (30 kDa MWCO, EMD Millipore, Ireland), or Zeba spin desalting columns (7kDa MWCO, Thermo Scientific, IL). The labelling extent - drug-to-antibody ratio (DAR) was characterized by ESI-Q-TOF protein mass spectrometry. The overall drug -antibody ratio for both antibody fusions is about 3.5.

[00178] Confirmation of Fc null caused by seven-point mutations: To confirm that the seven point mutations in Fc of the antibody fusions can significantly reduce the undesired ADCC and CDC effects mediated by Fey receptor interactions, BVK-Toxin B-CDR3H with mutated Fc (antibody 3) and wildtype Fc labeled with Alexa Fluor 488 were incubated with THP-1, a human monocytic cell line with high expression of Fey receptor. The BVK-Toxin B-CDR3H (Fc-null) did not bind to THP-1 at concentrations up to 100 nM, while BVK-Toxin B-CDR3H with regular Fc bound significantly to THP-1 at concentrations as low as 1 nM. Example 2: In vitro activities of Kvl.3 inhibitor antibody fusion proteins

[00179] The biological activity of antibodies generated in Example 1 on human T cells was assessed.

Inhibition of T cells activated by anti-CD3 is widely used to evaluate the effect of Kvl .3 blockade by peptide inhibitors. Effector memory T cells can be selectively activated by aCD3 -mediated T cell receptor (TCR) signaling independent of co-stimulation, while the full activation of naive and central memory T cells requires costimulatory signals provided by CD28 and/or other protein members. Thus, inhibition of the activation of T cells stimulated only by aCD3 serves as a straightforward method to assess the effect of Kvl.3 inhibitors on effector memory T cells. T cells express CD69 during early stimulation, and gradually express CD25 as activation continues into middle and late stage. Inflammatory cytokines including TNFa are also secreted to promote T cell proliferation and activate other immune cells.

[00180] Flow cytometry analysis and ELISA assays showed that the fusion antibodies can potently suppress T cell activation. Toxin B antibody fusions were first tested (Table 2, part A), followed by Toxin A antibody fusions (Table 2, part B). The most potent fusions are Syn-Toxin B-CDR3L (1) (EC₅₀ = 20.0 ± 9.8 nM for CD69, 8.4 ± 3.4 nM for CD25, 42.6 ± 10.6 nM for TNFa, and 12.8 ± 6.5 nM for cell proliferation) and BVK- Toxin B-CDR3H (2) (EC₅₀ = 8.8 ± 2.4 nM for CD69, 10.9 ± 5.0 nM for CD25, 37.4 ± 10.6 nM for TNFa, and 10.4 ± 4.5 nM for cell proliferation) (Table 2). Similar to the parent peptides, the Toxin A fusion antibodies are more potent than Toxin B-fusions in inhibiting human T cell activation (Table 2, part B). The Syn-Toxin A-CDR3L fusion (1) (EC₅₀ = 0.4 ± 0.3 nM for CD25 expression, and 0.05 ± 0.03 nM for TNFa secretion) has higher activity than the BVK fusion (2) (EC₅₀ = 2.7 ± 1.6 nM for CD25, and 0.2 ± 0.09 nM for TNFa), suggesting that the CDRs surrounding the fusion site or the stalk linkers have an impact on the interaction between the toxin and Kvl.3 channel. Viability assays confirmed that the suppression of T cell activation by Toxin A fusion antibodies was not due to cytotoxicity. Taken together, these results demonstrate excellent tolerance of selected CDRs to substitution by disulfide-bond rich peptides.

[00181] Flow cytometry analysis: For surface antigen-expression analysis, the following fluorophore- conjugated anti-human antibodies were used: aCD3-PB (UCHT1, BioLegend, CA), aCD69-PE (FN50, BioLegend, CA), aCD25-APC/Cy7 (M-A251, BioLegend, CA), aCD45RA-PB (HI100, BioLegend, CA), aCCR7-Alexa Fluor 647 (3D12, BD Pharmingen, CA). Human T cells or T_EMcells were stained with these antibodies in Hanks' balanced salt solution (Mediatech, VA)/2% FBS for 60 min at 4 °C, after which they were washed twice with the same medium and analyzed on LSR II flow cytometer equipped with a high throughput sampler (BD Bioscience, CA). For Fc blocking, human TruStain FcX (BioLegend, CA) was added and incubated with cells for 20 minutes prior to staining with other antibodies of interest. All the results were processed with FlowJo software (FlowJo, OR).

[00182] Human T cell activation: Human T cell activation was performed based on published procedures. Briefly, T cells were isolated from freshly purified peripheral blood mononuclear cells (PBMCs) using a T cell negative enrichment kit (Stem cell technologies, Canada). The purity was > 95% based on CD3 -positive signals monitored by flow cytometry. The freshly isolated T cells were suspended in RPMI media (with 10% FBS, 100 IU/mL penicillin, and 100 μg/mL streptomycin) and plated at 1.5 x 10⁵ cells per well in flat- bottomed, 96-well plates. Proteins and peptides were serially diluted in PBS as 10X stock, and added in triplicate to T cells, respectively. After 1 h pre -incubation, the samples were transferred to a new plate coated with 1 μg/mL OKT3 (eBioscience, CA) and incubated at 37 °C, 5% C0₂ for 72 hours, after which the secreted supernatants were collected for TNF analysis. The cytokine level was measured by ELISA using DuoSet development kits (R&D systems, MN) and the results were processed by GraphPad Prism (GraphPad Software, CA). T cell antigen marker CD25 was analyzed by flow cytometry using the procedure described above. With another separate set of samples, T cell antigen marker CD69 was analyzed approximately 24 h after stimulation. For proliferation assay, purified T cells were labelled with 2 μΜ CFSE (Thermo Fisher, IL) based on manufacturer's instructions, before incubation with peptide/protein samples and activation by aCD3. The mixtures were incubated for six days, followed by washing with HBSS/2% FBS and flow cytometry analysis on FITC channel.

[00183] Cell cytotoxicity: Cell viabilities were measured by quantifying ATP content with CellTiter Glo (Promega, WI) for which the luminescence was detected on a Gemini EM microplate reader (Molecular Devices, CA). Viability of unstimulated T cells was used as a control and defined as 100%.

Table 2. In vitro activities of Kvl.3 inhibitor antibody fusion proteins

Antibody Kvl.3 inhibitor CD69 ECso CD25 ECso TNFa ECso Proliferation

(nM) (nM) (nM)

Number

Part B

- Toxin B - 52.8 ± 28.3 19.7 ± 9.8 -

- Toxin A - 1.5 ± 0.8 0.02 ± 0.01 -

1 Syn-Toxin A-CDR3L (coiled

coil), SEQ ID NO: 7; Syn 0.4 ± 0.3 0.05 ± 0.03

HC, Fc null (SEQ ID NO: 3)

2 BVK-Toxin A-CDR3H (β- strand), SEQ ID NO: 8; BVK 2.7 ± 1.6 0.2 ± 0.09

LC (SEQ ID NO 4)

The experiments of Example 2 are repeated using antibody fusion proteins selected from antibody numbers: 6- 33 (Table 1).

Example 3: Selective suppression of T_EM ell activation

[00184] To further assess the activity and selectivity of the select CDR fusions (Toxin A/Toxin B fusion in Syn-CDR3L or BVK-CDR3H), an assay was performed to determine if the CDR fusions could suppress the activation of T_RM cells. CCR7 T_EM cells were isolated from human peripheral blood T cells by removing the CCR7⁺ naive and central memory T cells with biotinylated anti-CCR7 antibody using anti-biotin magnetic beads. The T_EM cell fraction was confirmed by flow cytometry to be 97.5% CCR7-and 99.7% CD3+. After stimulation by aCD3 antibody, treatment with increasing concentrations of fusion antibodies dose- responsively inhibited the activation of human T_EM cells, with Syn-Toxin A-CDR3L (1) being the most potent fusion construct (EC₅₀ = 0.91 ± 0.48 nM for CD25 expression, and <0.048 nM for TNF secretion) (Table 3). Consistent with the results in the human T cell assay, Syn-Toxin A-CDR3L (1) was more potent than its counterpart BVK-Toxin A-CDR3H (2) (EC₅₀ = 2.40 ± 2.0 nM for CD25, 0.27 ± 0.16 nM for TNFa). Neither Synagis nor BVK parent antibodies showed any efficacy, indicating that the observed immunosuppressive effects are due to the fused peptides. For comparison, PBMCs were stimulated with aCD3 to assess the activation mediated largely by naive and central memory T cells. FK506, a nonspecific immunosuppressant, was used as a control. FK506 effectively suppressed activation of PBMCs (EC₅₀ = 0.58 ± 0.33 nM for CD25, 0.14 ± 0.09 nM for TNFa) and showed no selectivity between T_EM and T_CM/naive T cells. In contrast, Toxin A peptide and Toxin A antibody fusions, especially Syn-Toxin A-CDR3L (1) are highly selective against T_EM cells, which is likely due to high selectivity for Kvl.3 over KCa3.1 (>1500 fold for Toxin A) (Table 3). In contrast, Toxin B peptide and Toxin B antibody fusions lacked potency and selectivity against T_EM.

[00185] Human T_FM cell activation assay: Human T_EM cells were isolated following general published procedures. Briefly, purified T cells were suspended at a concentration of 10⁷ cells per

RoboSep buffer (Stem cell technologies, Canada) and incubated with a biotinylated anti-CCR7 antibody (3D 12, BD PharMingen, CA) at a ratio of 20 μΐ. antibody per one million cells. The mixture was incubated at room temperature for 15 minutes, followed by washing with at least 2 mL buffer per 10⁷ cells. The labelled cells were re-suspended in RoboSep buffer, and mixed with anti-biotin MicroBeads (Miltenyi Biotec, CA) at a ratio of 20 uL antibody per ten million cells. The mixture was incubated at room temperature for 10 min, washed once, re-suspended in 500 buffer and loaded onto the LD column (Miltenyi Biotec, CA) for a negative selection aided by Magnet. The eluted cells were pure CCR7 TEM, which were then seeded at 50k cells per well, treated, activated and characterized using the aforementioned procedures described for human T cell activation.

Table 3. Selective in vitro activities of Kvl.3 inhibitor antibody fusion proteins

The experiments of Example 3 are repeated using antibody fusion proteins selected from antibody numbers: 6- 33 (Table 1).

Example 4: Kvl.3 inhibitor antibody fusion protein serum stability in rats

[00186] The stability of Syn-Toxin A-CDR3L (1) fusion was examined in freshly-collected rat serum for up to 72 h. The amount of Syn-Toxin A-CDR3L was determined by ELISA based on quantitation of Toxin A fusion that is able to bind Kvl .3. 52% of the Toxin A peptide remained after 72 hours of incubation, while 84% of Syn-Toxin A-CDR3L (1) remained at 72 hours. Next, a pharmacokinetic (PK) analysis of Syn-Toxin A-CDR3L (1) was performed in rats. Plasma samples were analyzed using the same ELISA method described above. Syn-Toxin A-CDR3L (1) had a long half-life, with estimated terminal half -lives of 54.0 h for intravenous injection (FIG. 2B) and 38.4 h for subcutaneous injection (FIG. 2A), which is much longer than shk-186 (less than 10 min in rats), the most advanced Kvl.3 inhibitor in development.

[00187] Rat serum. Eppendorf tubes containing 0.15 mg/mL antibody fusion per tube was each added 100 μΐ_^ fresh rat serum. The tubes were incubated at 37 °C for different time (Oh, 6h, 24h, 48h, and 72h), immediately frozen in liquid nitrogen, and stored at -80 °C until further processing. After thawing on ice, all the samples were purified by Protein A chromatography to extract IgGs. The amount of the antibody fusion in each sample extract was determined by cell -based Kvl .3 binding sandwich ELISA. Briefly, Kvl .3-overexpressing CHO cells (Charles River, MA) were cultured on a flat-bottom 96-well plate (black) over night to allow for attachment (20k/well). After washing with PBS buffer, cells were fixed onto the bottom of wells by spinning down and incubating in 8% paraformaldehyde for 15 minutes. The rest of ELISA procedures were the same as those published by Abeam (ICE, abl 11542). For the final steps, HRP -labeled anti-human IgG(Fc) antibody (ELITechGroup, Netherlands) was diluted 1/1000 in blocking buffer (PBS/ 5%BSA/ 0.1% Tween), and applied for 1 h followed by extensive washing. QuantaBlu fluorogenic ELISA substrate (Thermo Fisher, IL) was then added and fluorescence signals were obtained by reading through a Spectramax plate reader. The amount of the anti-Kvl .3 fusion antibody was quantified by extrapolating the signal into the linear range of a standard curve (signal vs concentration). For peptide, each eppendorf tube contains 1 nmole peptide mixed with 100 fresh rat serum, and was processed the same way as described above for antibody samples. Fifty microliters of the samples after incubating with serum was mixed with 200 of 0.01% TFA in 50% water/50% acetonitrile with 5 ng/mL benztropine as an internal standard. The mixture was vortexed for 15 sec and placed at 4°C for 10 min. The sample mixture was centrifuged at 13,300 rpm for 15 min to pellet the precipitated proteins. 150 of the supernatant was diluted with 100 μΐ_^ of 0.01% TFA in water. Samples were then analyzed by LC/MS using an Agilent Technologies (Santa Clara, CA) 1100 HPLC system mated to an AB Sciex (Redwood City, CA) 4000 Q Trap. A Phenomenex (Torrence, CA) Kinetix Evo C18, 5.0 μιη, 100-A, 2.1 x 50-mm column was used for separation. Mobile phase A consisted of 0.01% TFA in water, while mobile phase B was composed of 0.01% ACN. Mobile phase B increased from 5% to 80% over 1.5 mins and was maintained for 2 min to elute peptide. Then mobile phase B was reduced to 5% over 1 min, to allow the system to re -equilibrate. The flow rate was 0.6 mL/min. Mass detection was performed using ion- spray and multiple reaction monitoring in the positive mode (Toxin A, m/z = 421.296→ 376.3; internal standard, m/z = 308.2→ 167.2).

[00188] PK in rats. Samples of antibody fusion or peptide were injected intravenously or subcutaneously into Sprague-Dawley rats (n=3, female, 12 weeks old) at a single dose of 2 mg/kg, respectively. Blood samples were withdrawn at the following time points: 45 min, 6 h, 24 h, 2 day, 3 day, 4 day, 5 day, 7 day, 9 day, and 14 day for subcutaneous injection; 20 min, 3 h, 6 h, 24 h, 2 day, 3 day, 4 day, 5 day, 7 day, 9 day, and 14 day for intravenous injection. The samples were stored in heparinized collection tubes, spun down and stored at - 80 oC until further processing. After thawing and proper dilution of plasma sample, the amount of antibody in each blood sample was quantified by the aforementioned anti-Kvl.3 sandwich ELISA. Data was analyzed by the PK modeling program (WinNonlin, Certara, NJ) to determine the pharmacokinetic parameters. [00189] The experiments of Example 4 are repeated using antibody fusion proteins selected from antibody numbers: 6-33 (Table 1).

Example 5: Delayed type hypersensitivity in rats

[00190] Syn-Toxin A-CDR3L (1) was evaluated in vivo for its effectiveness in suppressing delayed type hypersensitivity (DTH) in rats, a response that is regulated mainly by the homing of CD4+ effector memory T cells. Lewis rats were immunized with ovalbumin on the first day, and then challenged again with ovalbumin injection into the left ear after a week of sensitization. The challenged ear was swollen, and ear thickness was measured after 24 h as an indication of the immune response against ovalbumin. Since Syn-Toxin A-CDR3L reached Cmax at ~24hrs, it was s.c. administered one day ahead of the ovalbumin challenge as a single dose, or two days ahead of the challenge as two consecutive daily injections at 5 mg/kg/dose (equal to 28 nmol/kg/dose) Due to their short half -lives, peptides (shk, Toxin A) were s c. administered one day later than the antibody at 100 μ¾/Τ¾ΛΪ05ε5 (equal to 25 nmol/kg/dose). As shown in FIG. 3, all peptides and antibody fusions showed dose-responsive inhibition of DTH. Syn-Toxin A-CDR3L effectively reduced Δ ear thickness (~ 0.3 mm) by 28% after one injection and by 38% after two doses. Toxin A peptide also showed activity in this experiment, although to a lesser extent (15% reduction of Δ ear thickness with one dose, 27% reduction with two doses). Notably, in this dosing paradigm, the in vivo activity of Syn-Toxin A-CDR3L is close to that of the parent shk peptide (34% reduction of Δ ear thickness with one dose and 43% reduction with two doses). Future in vivo studies using different dosing frequencies and dosages may be performed to further elucidate the PK/PD relationship of Syn-Toxin A-CDR3L.

[00191] The animal experiment was in accordance with National Institutes of Health guidelines and was approved by the Institutional Animal Care and Use Committee (California Institute of Biomedical Research). Nine-week-old female Lewis rats were acclimated for ten days before sorting and randomizing for study. Rats that gained more than 10% or lost more than 5% of body weight were excluded from the study. On day 1, rats were sorted into control groups and treatment groups, and all were immunized by subcutaneous injection of 1 mg/mL ovalbumin/complete Freund's adjuvant at two sites in the lower back. 100 i was administered over each hip, making a total of 200 ih per rat. From day 5 to day 6, antibody Syn-Toxin A-CDR3L was injected s.c. at a single dosage of 5 mg/kg/day. In a separate treatment group, Syn-Toxin A-CDR3L was only dosed once on day 6 at 5 mg/kg. From day 6 to day 7, peptide SHK or Toxin A was injected s.c. at a single dosage of 100 μg/kg/day, respectively. Independent form these treatment groups, SHK or Toxin A was also dosed only once on day 7 at 100 ug/kg. PBS was used as vehicle control for all the treatment groups. On day 7, all groups were challenged by injection of 20

(1 mg/mL) ovalbumin into the pinna of left ear and PBS into the other ear. The only exception was "sham" group, with both ears injected with PBS. Ear swelling was measured Oh, 24 h, and 48 h after the challenge with Mitutoyo QUICK Mini caliper. Values given in the Figure are the difference in the thickness (mm) between the ovalbumin -challenged left ear and the PBS- injected right ear at the time 24h after challenge.

[00192] The experiments of Example 5 are repeated using antibody fusion proteins selected from antibody numbers: 6-33 (Table 1). [00193] The experiments described in Examples 1-5 indicate the versatility of the antibody-CDR loop fusion strategy by generating a specific antibody inhibitor of the human Kvl .3 channel. Fusion of toxins into CDR3L of Synagis via a coiled -coil linker exhibited superior activity to other fusions. The antibody-toxin fusion showed excellent in vitro potency and selectivity in assays with human T_EM cells. Syn-Toxin A- CDR3L also significantly suppressed DTH reactions in vivo in rats. Future studies include evaluating the antibody toxin fusion in disease models for the prevention and treatment of autoimmune diseases such as multiple sclerosis, Type 1 diabetes and psoriasis.

Example 6: In vitro potassium ion channel assay

[00194] The activity of antibodies generated in Example 1 were assayed for potassium ion channel activity using an FluxOR™ assay. The resulting IC50 data is shown in Table 1.

Example 7: Channel profile study

[00195] Kvl.3 inhibitor peptides and Kvl.3 inhibitor antibodies comprising toxins A-Z, XX, AA-CC are tested for binding to different channels. Briefly, the Kvl.3 inhibitor molecules will be tested with CHO cell lines selectively expressing channels, such as Kvl l. l (hERG), Kvl . l/ Kvl .2, Kvl .5, KCa3.1, Kvl .3, Navl .5, and Cavl .2, in a patch clamp assay. Kvl .3 inhibitor molecules identified that bind to the channels are tested in an in vitro assay, such as generally described in Examples 2 and 3.

[00196] The preceding merely illustrates the principles of this disclosure. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope.

Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of this disclosure and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present disclosure, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of the present disclosure is embodied by the appended claims.

[00197] While preferred embodiments of the present disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the disclosure. It should be understood that various alternatives to the embodiments of the disclosure described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the disclosure and that methods and structures within the scope of these claims and their equivalents be covered thereby. [00198] All references cited herein are incorporated by reference in their entirety and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.

palivizumab H5 100 SCSVMHEALHNHYTQKSLSLSPGK

hihlc b. l usioti protein sequences

Name SKQ I D NO Sequence

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPD

DFATYYCFQGSGGSGAKLAALKAKLAALKGGGGSAAAISCVGSP

ECPPKCRAQGCKNGKCMNRKCKCYYCGGGGSELAAL

EAELAALEAGGSGPFTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKS

Syn-Toxin A- GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE

CDR3L (coiled- SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT coil) 7 KSFNRGEC

QVQLQESGPGLVRPSQTLSLTCTVSGFSLTGYGVNWVRQPPGRG

LEWIGMr GDGNTDYNSALKSRVTMLKDTSKNQFSL

RLSSVTAADTAVYYCTSVHQETKKYQSGGGGSAAAISCVGSPEC

PPKCRAQGCKNGKCMNRKCKCYYCGGGGS SYTY YE

WHVDVWGQGLLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL

VKDYFPEPVTVSW SGALTSGVHTFPAVLQSSGLYS

LSSVVTVPSSSLGTQTYICNV HKPSNTKVDKKVEPKSCDKTHTC

PPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCV

VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV

LTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ

BVK-Toxin A- PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQP CDR3H (P- ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV

strand) 8 FSCSVMHEALHNHYTQKSLSLSPGK

coil) 11 PGK l iihk- 6. l usioti protein se uences

Yiinc SKQ I I) V) Sequence

Q VTLRESGP ALVKPTQTLTLTCTF SGF SL STSGMS VGWIRQPPGK

ALEWLADIWWDDKKDYNPSLKSRLTISKDTSKNQVVLKVTNMD

PADTATYYCARTSVHQETKKYQSGGGGSINVKCSLPQQCIKPCK

DAGMRFGKCMNKKCRCYSGGGGSSYTYNYEWHVDVWGAGTT

VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS

WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV

NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPPVAGPSVFLFPPKPK

DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP

REEQY STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTI

Syn -Toxin B- SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEW CDR3H (Beta - ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS Beta) 33 VMHEALHNHYTQKSLSLSPGK

QVQLQESGPGLVRPSQTLSLTCTVSGFSLTGYGVNWVRQPPGRG

LEWIGMIWGTSVHQETKKYQSGGGGSINVKCSLPQQCIKPCKDA

GMRFGKCMNKKCRCYSGGGGSSYTYNYEWUVDVNTDYNSALK

SRVTMLKDTSKNQF SLRLS S VTAADTAVYYCARERDYRLDYWG

QGLLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV

TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC

NWHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP

KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK

TKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI

BVK-Toxin B- EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA CDR2H (Beta - VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV Beta) 34 FSCSVMHEALHNHYTQKSLSLSPGK

DIQMTQSPSSLSASVGDRVTITCRASGNIHNYLAWYQQKPGKAPK

LLr YTTTLADGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQHF

WTSVHQETKKYQSGGGGSINVKCSLPQQCIKPCKDAGMRFGKC

MNKKCRCYSGGGGSSYTYNYEWHVDVRTFGQGTKVEIKRTVAA

BVK-Toxin B- PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG CDR3L (Beta - NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS Beta) 35 SPVTKSFNRGET

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrVDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

Toxin XX^a LC NGGSGAKLAALKAKLAALK

fusion 64 GGGGSI(X1)(Z1)VG(X2)(X3)E(Z2)(X4)P(X5)(Z3)(X6)AQ(X7)G(Z4)( l iihk- 6. l usioti protein se uences

Yiinc SKQ I I) V) Sequence

X8)(X9)GK(Z5)MNRK(Z6)K(Z7)(X 10)(X11)(Z8)GGGGSELAALEAE LAALEAGGSGPFTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQGS

GGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQGC

KNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTFG

GGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN FYPREAK

Toxin A LC VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH fusion 65 KVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAGAISCVGSPECPPKCRAQG

CKNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin C LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 66 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

CKNGKCMNRKCKCYGCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin D LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 67 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

CKNGKCMNRKCKCYFCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin E LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 68 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

Toxin F LC LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG fusion 69 NGGSGAKLAALKAKLAALKGGGGSAGAISCVGSPECPPKCRAQG l iihk- 6. l usioti protein se uences

Yiinc SKQ I I) V) Sequence

CKNGKCMNRKCKCYGCGGGGSELAALEAELAALEAGGSGPFTF GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQGS

GGSGAKLAALKAKLAALKGGGGSAGAISCVGSPECPPKCRAQGC

KNGKCMNRKCKCYFCGGGGSELAALEAELAALEAGGSGPFTFG

GGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN FYPREAK

Toxin G LC VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH fusion 70 KVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCGAQG

CKNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin H LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 71 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKGRAQG

CKNGKCMNRKCKIYYCGGGGSELAALEAELAALEAGGSGPFTFG

GGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYPREAK

Toxin I LC VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH fusion 72 KVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPEGPPKCRAQG

CKNGKCMNRKAKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin J LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 73 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

Toxin K LC LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG fusion 74 NGGSGAKLAALKAKLAALKGGGGSAAAISAVGSPECPPKCRAQG l iihk- 6. l usioti protein se uences

Yiinc SKQ I I) V) Sequence

CKNGKAMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTF GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPEAPPKCRAQG

CKNGKCMNRKAKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin L LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 75 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKGRAQG

CKNGKCMNRKCKAYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin M LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 76 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKGRAQG

CKNGKCMNRKCKLYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin N LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 77 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKARAQG

CKNGKCMNRKCKAYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin 0 LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 78 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

Toxin P LC LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG fusion 79 NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKARAQG l iihk- 6. l usioti protein sequences

Yinic SKQ I I) V) Sequence

CKNGKCMNRKCKSYYCGGGGSELAALEAELAALEAGGSGPFTF GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPESPPKCRAQG

CKNGKCMNRKAKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin Q LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 80 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

AKNGKCMNRKCKCYYAGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin R LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 81 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSISCVGSPECPPKCRAQGCKN

GKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTFGGG

TKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ

Toxin S LC WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV fusion 82 YACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSIKCVGSPECPPKCRAQGCKN

GKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTFGGG

TKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ

Toxin T LC WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV fusion 83 YACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

Toxin U LC LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG fusion 84 NGGSGAKLAALKAKLAALKGGGGSAAAISCVGPKECPPKCRAQ l iihk- 6. l usioti protein se uences

Yiinc SKQ I I) V) Sequence

GCKNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFT FGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN FYPRE AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGL S SPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECLPPCRAQG

CKNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin V LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 85 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQT

GCKNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFT

FGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN FYPRE

Toxin W LC AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE fusion 86 KHKVYACEVTHQGL S SPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

CPNGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin X LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 87 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

CKYGKCMNRKCKCYYCGGGGSELAALEAELAALEAGGSGPFTF

GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA

Toxin Y LC KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK fusion 88 HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

Toxin Z LC LLrYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG fusion 89 NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG l iihk- 6. l usioti protein se uences

Yiinc SKQ I I) V) Sequence

CKNGKCMNRKCKCNYCGGGGSELAALEAELAALEAGGSGPFTF GGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

CPNGKCMNRKCKCYRCGGGGSELAALEAELAALEAGGSGPFTFG

GGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN FYPREAK

Toxin AA LC VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH fusion 90 KVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSAAAISCVGSPECPPKCRAQG

CKNGKCMNRKCKCYCGGGGSELAALEAELAALEAGGSGPFTFG

GGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN FYPREAK

Toxin BB LC VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH fusion 91 KVYACEVTHQGLSSPVTKSFNRGEC

DIQMTQSPSTLSASVGDRVTITCKCQLSVGYMHWYQQKPGKAPK

LLIYDTSKLASGVPSRFSGSGSGTAFTLTISSLQPDDFATYYCFQG

NGGSGAKLAALKAKLAALKGGGGSTIINVKCTSPKQCLPPCKAQ

TGCPYGKCMNRKCKCNRCGGGGSELAALEAELAALEAGGSGPF

TFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR

Toxin CC LC EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY fusion 92 EKHKVYACEVTHQGLSSPVTKSFNRGEC

Each of XI -XI 1 and Z1-Z8 may be any natural or unnatural amino acid, or may indicate absence of an amino acid. As a non -limiting example, XI is S or K; X2 is S or P; X3 is P or K; X4 is P or L; X5 is K or P; X6 is Pv or G; X7 is T or indicates no amino acid present at this position; X8 is K or P; X9 is N or Y; X10 is Y or N; X I 1 is Y, R, F or G; Zl is C, A, G, S, I, or L; Z2 is C, A, G, S, I, or L; Z3 is C, A, G, S, I, or L; Z4 is C, A, G, S, I, or L; Z5 is C, A, G, S, I, or L; Z6 is C, A, G, S, I, or L; Z7 is C, A, G, S, I, or L; and Z8 is C, A, G, S, I, or L.

Toxin Z 60 AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCNYC

and Z8 is C, A, G, S, I, or L.

LC var TYYCFQGNGYPFTFGGGTKLEI

FURTHER EMBODIMENTS

A composition comprising a peptide inhibitor of a voltage-gated channel positioned within, or replacing one or more amino acids of, a first CDR of an antibody variable domain; wherein the first CDR, a second CDR, and a third CDR of the antibody variable domain do not form a binding site specific for a human antigen.

The composition of embodiment 1, wherein the first CDR is a CDR3 of a palivizumab light chain. The composition of embodiment 1, wherein the first CDR comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 26 and 117-123. The composition of any of embodiments 1-3, wherein the second CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 24 or 115.

The composition of any of embodiments 1-4, wherein the third CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 25 or 116.

The composition of embodiment 1, wherein the first CDR is a CDR2 of a palivizumab light chain. The composition of embodiment 1, wherein the first CDR is a CDR1 of a palivizumab light chain. The composition of embodiment 1, wherein the first CDR is a CDR3 of a palivizumab heavy chain. The composition of embodiment 1, wherein the first CDR is a CDR2 of a palivizumab heavy chain. The composition of embodiment 1, wherein the first CDR is a CDR1 of a palivizumab heavy chain. The composition of any of embodiments 1-10, further comprising an antibody Fc region.

The composition of embodiment 11, wherein the antibody Fc region comprises one or more mutations to reduce antibody-dependent cellular cytotoxicity (ADCC).

The composition of embodiment 11, wherein the antibody Fc region comprises an amino acid sequence at least about 90% identical to the Fc region of SEQ ID NO: 3 or 124.

The composition of any of embodiments 1-13, wherein the peptide inhibitor of the voltage-gated channel replaces 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids of the first CDR of the antibody variable domain.

The composition of any of embodiments 1-14, wherein an insert portion comprising a first extension peptide, the peptide inhibitor of the voltage-gated channel, and a second extension peptide, replaces the one or more amino acids of the first CDR of the antibody variable domain.

The composition of any of embodiments 1-13, wherein an insert portion comprising a first extension peptide, the peptide inhibitor of the voltage-gated channel, and a second extension peptide, is positioned within the first CDR of the antibody variable domain.

The composition of embodiment 15 or embodiment 16, wherein the first extension peptide and the second extension peptide form a coiled-coil.

The composition of any of embodiments 15-17, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 16.

The composition of any of embodiments 15-18, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 17.

The composition of any of embodiments 15-19, wherein the insert portion further comprises a peptide linker.

The composition of embodiment 20, wherein the peptide linker comprises no regular secondary structure.

The composition of embodiment 20 or embodiment 21, wherein at least about 50% of the amino acids of the peptide linker are glycine and/or serine.

The composition of any of embodiments 20-22, wherein the peptide linker comprises SEQ ID NO: 20. The composition of any of embodiments 1-23, wherein the voltage-gated channel is a cation channel selected from a potassium, sodium and calcium channel. The composition of embodiment 24, wherein the cation channel is a potassium channel.

The composition of any of embodiments 1-23, wherein the peptide inhibitor of the voltage -gated channel is a peptide inhibitor of Kv 1.1, Kvl .2, Kvl .3, Kvl .4, Kvl .5, Kvl.6, Kvl.7, Kv2.1 , Kv3.1 , Kv3.2, Kvl l. l , Kcl. l , Kc2.1 , Kc3.1 , Navl .2, Navl.4, and Cavl.2, or any combination thereof . The composition of embodiment 26, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kvl .3.

The composition of any of embodiments 1-27, wherein the peptide inhibitor of the voltage-gated channel comprises four or more cysteine amino acids.

The composition of any of embodiments 1-27, wherein the peptide inhibitor of the voltage-gated channel comprises Toxin A.

The composition of any of embodiments 1-27, wherein the peptide inhibitor of the voltage-gated channel comprises the amino acid sequence of SEQ ID NO: 36.

The composition of any of embodiments 1-27, wherein the peptide inhibitor of the voltage-gated channel comprises Toxin B.

The composition of any of embodiments 1-27, wherein the peptide inhibitor of the voltage-gated channel comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 13, 15, and 37-63.

A method of treating an individual for an autoimmune disease or condition thereof, the method comprising administering to the individual an effective amount of the composition of any of embodiments 1-32.

The method of embodiment 33, wherein the autoimmune disease is multiple sclerosis.

The method of embodiment 33, wherein the autoimmune disease is psoriasis.

A composition comprising a peptide inhibitor of a voltage-gated channel positioned within, or replacing one or more ammo acids of, a first CDR of an antibody variable domain; wherein the antibody variable domain further comprises a second CDR and a third CDR of an anti-lysozyme antibody.

The composition of embodiment 36, wherein the first CDR is a CDR3 of a heavy chain of the anti- lysozyme antibody.

The composition of embodiment 36, wherein the first CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 29.

The composition of any of embodiments 36-38, wherein the second CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 27.

The composition of any of embodiments 36-39, wherein the third CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 28.

The composition of embodiment 36, wherein the first CDR is a CDR2 of a heavy chain of the anti- lysozyme antibody.

The composition of embodiment 36, wherein the first CDR is a CDR1 of a heavy chain of the anti- lysozyme antibody. The composition of embodiment 36, wherein the first CDR is a CDR3 of a light chain of the anti- lysozyme antibody.

The composition of embodiment 36, wherein the first CDR is a CDR2 of a light chain of the anti- lysozyme antibody.

The composition of embodiment 36, wherein the first CDR is a CDR1 of a light chain of the anti- lysozyme antibody.

The composition of any of embodiments 36-45, further comprising an antibody Fc region.

The composition of embodiment 46, wherein the antibody Fc region comprises one or more mutations to reduce antibody-dependent cellular cytotoxicity (ADCC).

The composition of embodiment 46, wherein the antibody Fc region comprises an amino acid sequence at least about 90% identical to the Fc region of SEQ ID NO: 3.

The composition of any of embodiments 36-48, wherein the peptide inhibitor of the voltage-gated channel replaces 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids of the first CDR of the antibody variable domain.

The composition of any of embodiments 36-49, wherein an insert portion comprising a first extension peptide, the peptide inhibitor of the voltage-gated channel, and a second extension peptide, replaces the one or more amino acids of the first CDR of the antibody variable domain.

The composition of any of embodiments 36-48, wherein an insert portion comprising a first extension peptide, the peptide inhibitor of the voltage-gated channel, and a second extension peptide, is positioned within the first CDR of the antibody variable domain.

The composition of embodiment 50 or embodiment 51, wherein the first extension peptide and the second extension peptide form a β-sheet.

The composition of any of embodiments 50-52, wherein the first extension peptide comprises an ammo acid sequence at least about 90% identical to SEQ ID NO: 18.

The composition of any of embodiments 50-53, wherein the second extension peptide compnses an ammo acid sequence at least about 90% identical to SEQ ID NO: 19.

The composition of any of embodiments 50-54, wherein the insert portion further comprises a peptide linker.

The composition of embodiment 55, wherein the peptide linker comprises no regular secondary structure.

The composition of embodiment 55 or embodiment 56, wherein at least about 50% of the amino acids of the peptide linker are glycine and/or serine.

The composition of any of embodiments 55-57, wherein the peptide linker comprises SEQ ID NO: 20. The composition of any of embodiments 36-58, wherein the voltage-gated channel is a cation channel selected from a potassium, sodium and calcium channel.

The composition of embodiment 59, wherein the cation channel is a potassium channel. The composition of any of embodiments 36-58, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kv 1.1 , Kvl.2, Kvl.3, Kvl.4, Kvl.5, Kvl .6, Kvl .7, Kv2.1 , Kv3.1 , Kv3.2, Kvl l. l , Kcl. l , Kc2.1 , Kc3.1 , Navl .2, Navl.4, and Cavl.2, or any combination thereof . The composition of embodiment 61, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kvl .3.

The composition of any of embodiments 36-62, wherein the peptide inhibitor of the voltage-gated channel comprises four or more cysteine amino acids.

The composition of any of embodiments 36-62, wherein the peptide inhibitor of the voltage-gated channel comprises Toxin A.

The composition of any of embodiments 36-62, wherein the peptide inhibitor of the voltage-gated channel comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 13.

The composition of any of embodiments 36-62, wherein the peptide inhibitor of the voltage-gated channel comprises Toxin B.

The composition of any of embodiments 36-62, wherein the peptide inhibitor of the voltage-gated channel comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 15.

A method of treating an individual for an autoimmune disease or condition thereof, the method comprising administering to the individual an effective amount of the composition of any of embodiments 36-67.

The method of embodiment 68, wherein the autoimmune disease is multiple sclerosis.

The method of embodiment 68, wherein the autoimmune disease is psoriasis.

A method of treating an autoimmune disease in an individual in need thereof, the method comprising administering to the individual an effective amount of a peptide inhibitor of a voltage-gated channel; wherein the peptide inhibitor of the voltage-gated channel is present in an insert portion of a modified variable domain of an antibody, the insert portion positioned within or replacing one or more amino acids of a first CDR of the variable domain.

The method of embodiment 71, wherein the voltage-gated channel is a cation channel selected from a potassium, sodium and calcium channel.

The method of embodiment 72, wherein the cation channel is a potassium channel.

The method of embodiment 71, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kvl.1 , Kvl .2, Kvl.3, Kvl.4, Kvl.5, Kvl.6, Kvl .7, Kv2.1 , Kv3.1 , Kv3.2, Kvl l . l , Kcl . l , Kc2.1 , Kc3.1 , Navl.2, Navl .4, and Cavl .2, or any combination thereof.

The method of embodiment 74, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kvl .3.

The method of any of embodiments 71-75, wherein the peptide inhibitor of the voltage-gated channel comprises four or more cysteine amino acids.

The method of embodiment 71, wherein the peptide inhibitor of the voltage-gated channel is Toxin A. The method of embodiment 71, wherein the peptide inhibitor of the voltage-gated channel comprises the amino acid sequence of SEQ ID NO: 36. 79. The method of embodiment 71, wherein the peptide inhibitor of the voltage-gated channel is Toxin B.

80. The method of embodiment 71, wherein the peptide inhibitor of the voltage-gated channel comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 13, 15, and 37-63.

81. The method of any of embodiments 71-80, wherein one or more amino acids of the first CDR of the variable domain are replaced with the insert portion.

82. The method of any of embodiments 71-81, wherein the insert portion further comprises a first

extension peptide and second extension peptide.

83 The method of embodiment 82, wherein the insert portion comprises: the first extension peptide, the peptide inhibitor of the voltage-gated channel, and the second extension peptide

84. The method of embodiment 82 or embodiment 83, wherein the first extension peptide and the second extension peptide form a coiled-coil.

85. The method of any of embodiments 82-84, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 16.

86. The method of any of embodiments 82-85, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 17.

87. The method of embodiment 82 or embodiment 83, wherein the first extension peptide and the second extension peptide form beta strands.

88. The method of embodiment 82 or embodiment 83, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 18.

89. The method of any of embodiments 82, 83 or 88, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 19.

90. The method of any of embodiments 82-89, wherein the insert portion comprises: the first extension peptide, a first linker, the peptide inhibitor of the voltage-gated channel, a second linker, and the second extension peptide.

91. The method of embodiment 90, wherein the first linker, the second linker, or both the first and the second linkers comprise no regular secondary structure.

92. The method of embodiment 90 or embodiment 91, wherein at least about 50% of the amino acids of the first linker, the second linker, or both the first and the second linkers are glycine and/or serine.

93. The method of any of embodiments 90-92, wherein the first linker, the second linker, or both the first and the second linkers comprise the amino acid sequence of SEQ ID NO: 20.

94. The method of any of embodiments 71-93, wherein the first CDR is a CDR3 of a palivizumab light chain.

95. The method of any of embodiments 71-93, wherein the first CDR comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 26 and 117-123.

96 The method of any of embodiments 71-93, wherein the modified variable domain further comprises a second CDR and a third CDR. 97. The method of embodiment 96, wherein the second CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 24 or 1 15.

98. The method of embodiment 96 or embodiment 97, wherein the third CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 25 or 116.

99. The method of any of embodiments 71-93, wherein the first CDR is a CDR2 of a palivizumab light chain.

100. The method of any of embodiments 71-93, wherein the first CDR is a CDRl of a palivizumab light chain.

101. The method of any of embodiments 71-93, wherein the first CDR is a CDR3 of a palivizumab heavy chain.

102. The method of any of embodiments 71-93, wherein the first CDR is a CDR2 of a palivizumab heavy chain.

103. The method of any of embodiments 71-93, wherein the first CDR is a CDRl of a palivizumab heavy chain.

104. The method of any of embodiments 71-93, wherein the first CDR is a CDR3 of an anti-lysozyme heavy chain.

105. The method of any of embodiments 71-93, wherein the first CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 29.

106. The method of embodiment 104 or embodiment 105, wherein the modified variable domain further comprises a second CDR and a third CDR.

107. The method of embodiment 106, wherein the second CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 27.

108. The method of embodiment 106 or embodiment 107, wherein the third CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 28.

109. The method of any of embodiments 71-93, wherein the first CDR is a CDR2 of an anti-lysozyme heavy chain.

1 10. The method of any of embodiments 71-93, wherein the first CDR is a CDRl of an anti-lysozyme heavy chain.

1 1 1. The method of any of embodiments 71-93, wherein the first CDR is a CDR3 of an anti-lysozyme light chain.

1 12. The method of any of embodiments 71-93, wherein the first CDR is a CDR2 of an anti-lysozyme light chain.

1 13. The method of any of embodiments 71-93, wherein the first CDR is a CDRl of an anti-lysozyme light chain.

1 14. The method of any of embodiments 71-113, wherein the antibody further comprises an antibody Fc region.

1 15. The method of embodiment 1 14, wherein the antibody Fc region comprises one or more mutations to reduce antibody -dependent cellular cytotoxicity (ADCC). The method of any of embodiments 71-115, wherein the autoimmune disease is multiple sclerosis. The method of any of embodiments 71-115, wherein the autoimmune disease is psoriasis.

A method of inhibiting the function or activation of an effector memory T (T_EM) cell, the method comprising contacting the T_EM cell with a therapeutic peptide having an amino acid sequence at least about 90% identical to SEQ ID NO: 13, 36 or 15; wherein the therapeutic peptide is present in a variable domain of an antibody modified with an insert portion positioned within, or replacing one or more amino acids of, a first CDR of the variable domain; wherein the insert portion comprises the therapeutic peptide.

The method of embodiment 1 18, wherein the therapeutic peptide comprises the amino acid sequence of SEQ ID NO: 36

The method of embodiment 1 18, wherein the therapeutic peptide comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 37-63.

The method of embodiment 1 18, wherein the therapeutic peptide is Toxin A or a mutant thereof. The method of embodiment 1 18, wherein the therapeutic peptide is Toxin B or a mutant thereof. The method of any of embodiments 118-122, wherein contacting the T_EM cell with the therapeutic peptide comprises administering to an individual an effective amount of the therapeutic peptide. The method of embodiment 123, wherein the individual is a recipient of an organ transplant.

The method of embodiment 123, wherein the individual has an autoimmune disease.

The method of embodiment 125, wherein the autoimmune disease is multiple sclerosis.

The method of embodiment 125, wherein the autoimmune disease is psoriasis.

The method of any of embodiments 118-127, wherein a function of the T_EM cell is secretion of TNFa. The method of any of embodiments 118-128, wherein the therapeutic peptide comprises an inhibitor of Kvl .3.

The method of any of embodiments 118-129, wherein the one or more amino acids of the first CDR of the variable domain are replaced with the insert portion.

The method of any of embodiments 118-130, wherein the insert portion further comprises a first extension peptide and second extension peptide.

The method of embodiment 131, wherein the insert portion comprises: the first extension peptide, the therapeutic peptide, and the second extension peptide.

The method of embodiment 131 or embodiment 132, wherein the first extension peptide and the second extension peptide form a coiled-coil.

The method of any of embodiments 131-133, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 16.

The method of any of embodiments 131-133, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 17.

The method of embodiment 131 or embodiment 132, wherein the first extension peptide and the second extension peptide form beta strands. 137. The method of any of embodiments 131, 132 or 136, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 18.

138. The method of any of embodiments 131, 132, 136 or 137, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 19.

139. The method of any of embodiments 131-138, wherein the insert portion comprises: the first extension peptide, a first linker, the therapeutic peptide, a second linker, and the second extension peptide.

140. The method of embodiment 139, wherein at least about 50% of the amino acids of the first linker, the second linker, or both the first and the second linkers are glycine and/or serine.

141. The method of embodiment 139 or embodiment 140, wherein the first linker, the second linker, or both the first and the second linkers comprise the amino acid sequence of SEQ ID NO: 20.

142. The method of any of embodiments 118-141, wherein the first CDR, a second CDR, and a third CDR of the variable domain do not form a binding site specific for a human antigen.

143. The method of embodiment 142, wherein the second CDR, the third CDR, or both the second and third CDRs comprise one or more amino acid mutations, additions, substitutions, or combinations thereof, from the palivizumab variable domain sequence.

144. The method of any of embodiments 118-143, wherein the variable domain is a variable domain of palivizumab.

145. The method of any of embodiments 118-144, wherein the first CDR is CDR3 of the antibody light chain.

146. The method of any of embodiments 118-145, wherein the first CDR comprises an amino acid

sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 26 and 117-123.

147. The method of any of embodiments 118-144, wherein the first CDR is CDR1 of the antibody light chain.

148. The method of any of embodiments 118-144, wherein the first CDR is CDR2 of the antibody light chain.

149. The method of any of embodiments 118-144, wherein the first CDR is CDR3 of the antibody heavy chain.

150. The method of any of embodiments 118-144, wherein the first CDR is CDR1 of the antibody heavy chain.

151. The method of any of embodiments 118-144, wherein the first CDR is CDR2 of the antibody heavy chain.

152. The method of any of embodiments 118-141, wherein the variable domain is a variable domain of an anti-lysozyme antibody.

153. The method of embodiment 152, wherein the first CDR is CDR3 of the antibody heavy chain.

154. The method of embodiment 152, wherein the first CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 29.

155. The method of any of embodiments 118-154, wherein the modified variable domain is present in a polypeptide further comprising an antibody Fc region. 156. The method of embodiment 155, wherein the Fc region comprises one or more mutations to reduce antibody-dependent cellular cytotoxicity (ADCC).

157. A method of manufacturing an inhibitor of a voltage -gated channel having improved half-life in a biological sample, the method comprising: (a) providing an expression vector comprising a nucleic acid sequence encoding for a polypeptide comprising a therapeutic peptide having inhibitory activity against the voltage gated-channel, wherein the therapeutic peptide is present in a variable domain of an antibody modified to comprise an insert portion, the insert portion positioned within or replacing one or more amino acids of a first CDR of the variable domain; wherein the insert portion comprises the therapeutic peptide; (b) expressing the polypeptide from a cell culture; and (c) purifying the polypeptide to obtain the inhibitor of the voltage gated-channel, the inhibitor of the voltage gated- channel having a greater half-life in the biological sample than the therapeutic peptide.

158. The method of embodiment 157, wherein the biological sample comprises human serum.

159. The method of embodiment 157 or embodiment 158, wherein the half-life of the inhibitor of Kvl.3 is at least 50% longer than the half -life of the therapeutic peptide.

160. The method of any of embodiments 157-159, wherein the cell culture is a mammalian cell culture.

161. The method of any of embodiments 157-160, wherein the voltage-gated channel is a cation channel selected from a potassium, sodium and calcium channel.

162. The method of embodiment 161, wherein the cation channel is a potassium channel.

163. The method of any of embodiments 157-160, wherein the inhibitor of the voltage-gated channel is a peptide inhibitor of Kv 1.1 , Kvl .2, Kvl .3, Kvl .4, Kvl .5, Kvl.6, Kvl.7, Kv2.1 , Kv3.1 , Kv3.2, Kvl l. l , Kcl . l , Kc2.1 , Kc3.1 , Navl .2, Navl .4, and Cavl.2, or any combination thereof .

164. The method of embodiment 163, wherein the inhibitor of the voltage-gated channel is a peptide

inhibitor of Kvl .3.

165. The method of any of embodiments 157-164, wherein the therapeutic peptide comprises the amino acid sequence of SEQ ID NO: 36.

166. The method of any of embodiments 157-164, wherein the therapeutic peptide comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 13, 15, and 37- 63.

167. The method of any of embodiments 157-164, wherein the therapeutic peptide is Toxin A.

168. The method of any of embodiments 157-164, wherein the therapeutic peptide is Toxin B.

169. The method of any of embodiments 157-164, wherein one or more amino acids of the first CDR of the variable domain are replaced with the insert portion.

170. The method of any of embodiments 157-169, wherein the insert portion further comprises a first extension peptide and second extension peptide.

171. The method of embodiment 170, wherein the insert portion comprises: the first extension peptide, the therapeutic peptide, and the second extension peptide.

172. The method of embodiment 170 or embodiment 171, wherein the first extension peptide and the second extension peptide form a coiled-coil. 173. The method of any of embodiments 170-172, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 16.

174. The method of any of embodiments 170-173, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 17.

175. The method of embodiment 170 or embodiment 171, wherein the first extension peptide and the second extension peptide form beta strands.

176. The method of any of embodiments 170, 171, or 175, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 18.

177. The method of any of embodiments 170, 171, 175 or 176, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 19

178. The method of any of embodiments 170-177, wherein the insert portion comprises: the first extension peptide, a first linker, the therapeutic peptide, a second linker, and the second extension peptide.

179. The method of embodiment 178, wherein the first linker, the second linker, or both the first and the second linkers comprise no regular secondary structure.

180. The method of embodiment 178 or embodiment 179, wherein at least about 50% of the amino acids of the first linker, the second linker, or both the first and the second linkers are glycine and/or serine.

181. The method of any of embodiments 178-180, wherein the first linker, the second linker, or both the first and the second linkers comprise the amino acid sequence of SEQ ID NO: 20.

182. The method of any of embodiments 157-180, wherein the first CDR, a second CDR, and a third CDR of the variable domain do not form a binding site specific for a human antigen.

183. The method of embodiment 182, wherein the second CDR, the third CDR, or both the second and third CDRs comprise one or more amino acid mutations, additions, substitutions, or combinations thereof, from the palivizumab variable domain sequence.

184. The method of any of embodiments 157-183, wherein the variable domain is a variable domain of palivizumab.

185. The method of any of embodiments 157-184, wherein the first CDR is CDR3 of the antibody light chain.

186. The method of any of embodiments 157-185, wherein the first CDR comprises an amino acid

187. The method of any of embodiments 157-184, wherein the first CDR is CDR1 of the antibody light chain.

188. The method of any of embodiments 157-184, wherein the first CDR is CDR2 of the antibody light chain.

189. The method of any of embodiments 157-184, wherein the first CDR is CDR3 of the antibody heavy chain.

190. The method of any of embodiments 157-184, wherein the first CDR is CDR1 of the antibody heavy chain. 191. The method of any of embodiments 157-184, wherein the first CDR is CDR2 of the antibody heavy chain.

192. The method of any of embodiments 157-181, wherein the variable domain is a variable domain of an anti-lysozyme antibody.

193. The method of embodiment 192, wherein the first CDR is CDR3 of the antibody heavy chain.

194. The method of embodiment 192, wherein the first CDR comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 29.

195. The method of any of embodiments 157-194, wherein the polypeptide further comprises an antibody Fc region

196. The method of embodiment 195, wherein the Fc region comprises one or more mutations to reduce antibody-dependent cellular cytotoxicity (ADCC).

197. A composition comprising a peptide inhibitor of a voltage-gated channel positioned within, or replacing one or more amino acids of, a first CDR of an antibody light chain variable domain.

198. The composition of embodiment 197, wherein the antibody light chain variable domain is a

palivizumab light chain variable domain.

199. The composition of embodiment 197 or embodiment 198, wherein the first CDR is a CDR3 of the antibody light chain variable domain.

200. The composition of any of embodiments 197-200, wherein the first CDR comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 26 and 117-123.

201. The composition of any of embodiments 197-200, wherein the antibody light chain variable domain comprises a second CDR comprising an amino acid sequence at least about 90% identical to SEQ ID NO: 24 or 115.

202. The composition of any of embodiments 197-201, wherein the antibody light chain variable domain comprises a third CDR comprising an amino acid sequence at least about 90% identical to SEQ ID NO: 25 or 116.

203. The composition of embodiment 1 7 or embodiment 198, wherein the first CDR is a CDR2 of a palivizumab light chain variable domain.

204. The composition of embodiment 197 or embodiment 198, wherein the first CDR is a CDR1 of a palivizumab light chain variable domain.

205. The composition of embodiment 197 or embodiment 198, wherein the first CDR is a CDR3 of a palivizumab heavy chain variable domain.

206. The composition of embodiment 197 or embodiment 198, wherein the first CDR is a CDR2 of a palivizumab heavy chain variable domain.

207. The composition of embodiment 197 or embodiment 198, wherein the first CDR is a CDR1 of a palivizumab heavy chain variable domain.

208. The composition of any of embodiments 197-207, further comprising an antibody Fc region.

209. The composition of embodiment 208, wherein the antibody Fc region comprises one or more

mutations to reduce antibody -dependent cellular cytotoxicity (ADCC) The composition of embodiment 209, wherein the antibody Fc region comprises an amino acid sequence at least about 90% identical to the Fc region of SEQ ID NO: 3 or 124.

The composition of any of embodiments 197-210, wherein the peptide inhibitor of the voltage-gated channel replaces 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids of the first CDR of the antibody variable domain.

The composition of any of embodiments 197-21 1, wherein an insert portion comprising a first extension peptide, the peptide inhibitor of the voltage-gated channel, and a second extension peptide, replaces the one or more amino acids of the first CDR of the antibody variable domain.

The composition of any of embodiments 197-212, wherein an insert portion comprising a first extension peptide, the peptide inhibitor of the voltage-gated channel, and a second extension peptide, is positioned within the first CDR of the antibody variable domain.

The composition of embodiment 212 or embodiment 213, wherein the first extension peptide and the second extension peptide form a coiled-coil.

The composition of any of embodiments 212-214, wherein the first extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 16.

The composition of any of embodiments 212-215, wherein the second extension peptide comprises an amino acid sequence at least about 90% identical to SEQ ID NO: 17.

The composition of any of embodiments 212-216, wherein the insert portion further comprises a peptide linker.

The composition of embodiment 217, wherein the peptide linker comprises no regular secondary structure.

The composition of embodiment 217 or embodiment 218, wherein at least about 50% of the amino acids of the peptide linker are glycine and/or serine.

The composition of any of embodiments 217-219, wherein the peptide linker comprises SEQ ID NO: 20.

The composition of any of embodiments 197-220, wherein the voltage-gated channel is a cation channel selected from a potassium, sodium and calcium channel.

The composition of embodiment 221, wherein the cation channel is a potassium channel.

The composition of any of embodiments 197-220, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kv 1.1 , Kvl .2, Kvl .3, Kvl .4, Kvl .5, Kvl .6, Kvl .7, Kv2.1 , Kv3.1 , Kv3.2, Kvl l . l , Kcl . l , Kc2.1 , Kc3.1 , Navl .2, Navl .4, and Cavl .2, or any combination thereof . The composition of embodiment 223, wherein the peptide inhibitor of the voltage-gated channel is a peptide inhibitor of Kvl .3.

The composition of any of embodiments 197-224, wherein the peptide inhibitor of the voltage-gated channel comprises four or more cysteine amino acids.

The composition of any of embodiments 197-224, wherein the peptide inhibitor of the voltage-gated channel comprises Toxin A. 227. The composition of any of embodiments 197-224, wherein the peptide inhibitor of the voltage-gated channel comprises the amino acid sequence of SEQ ID NO: 36.

228. The composition of any of embodiments 197-224, wherein the peptide inhibitor of the voltage-gated channel comprises Toxin B.

229. The composition of any of embodiments 197-224, wherein the peptide inhibitor of the voltage-gated channel comprises an amino acid sequence at least about 90% identical to a sequence selected from SEQ ID NOS: 13, 15, and 37-63.

230. A method of treating an individual for an autoimmune disease or condition thereof, the method comprising administering to the individual an effective amount of the composition of any of embodiments 197-229.

231. The method of embodiment 230, wherein the autoimmune disease is multiple sclerosis.

232. The method of embodiment 230, wherein the autoimmune disease is psoriasis.

233. A composition comprising a polypeptide having SEQ ID NO: 36:

I(X1)(Z1)VG(X2)(X3)E(Z2)(X4)P(X5)(Z3)(X6)AQ(X7)G(Z4)(X8)(X9)GK(Z5)MNRK(Z6)K(Z7) (X10)(X11)(Z8);

wherein:

X I is selected from S and K;

X2 is selected from S and P;

X3 is selected from P and K;

X4 is selected from P and L;

X5 is selected from K and P;

X6 is selected from R and G;

X7 is no amino acid or T;

X8 is selected from K and P;

X9 is selected from N and Y;

X10 is selected from Y and N; and

X I I is selected from Y, R, F, and G.

234. The composition of embodiment 233, wherein Zl is selected from A, G, S, I, and L.

235. The composition of embodiment 233 or embodiment 234, wherein Z2 is selected from A, G, S, I.

L·.

236. The composition of any of embodiments 233-235, wherein Z3 is selected from A, G, S, I, and L.

237. The composition of any of embodiments 233-236, wherein Z4 is selected from A, G, S, I, and L.

238. The composition of any of embodiments 233-237, wherein Z5 is selected from A, G, S, I, and L.

239. The composition of any of embodiments 233-238, wherein Z6 is selected from A, G, S, I, and L.

240. The composition of any of embodiments 233-239, wherein Z7 is selected from A, G, S, I, and L.

241. The composition of any of embodiments 233-240, wherein Z8 is selected from A, G, S, I, and L.

242. The composition of any of embodiments 233-241, wherein XI is K. 243. The composition of any of embodiments 233-242, wherein X2 is P.

244. The composition of any of embodiments 233-243, wherein X3 is K.

245. The composition of any of embodiments 233-244, wherein X4 is L.

246. The composition of any of embodiments 233-245, wherein X5 is P.

247. The composition of any of embodiments 233-246, wherein X6 is G.

248. The composition of any of embodiments 233-247, wherein X7 is T.

249. The composition of any of embodiments 233-248, wherein X8 is P.

250. The composition of any of embodiments 233-249, wherein X9 is Y.

251. The composition of any of embodiments 233-250, wherein X10 is N.

252. The composition of any of embodiments 233-251, wherein XI 1 is selected from R, F, and G.

253. The composition of embodiment 233, wherein the polypeptide comprises a sequence selected from SEQ ID NOS: 13, 15, and 37-63.

254. The composition of any of embodiments 233-253, wherein the composition comprises a first

extension peptide that forms a helical secondary structure.

255. The composition of embodiment 254, wherein the composition comprises a second extension peptide that forms a helical secondary structure.

256. The composition of embodiment 255, wherein the polypeptide is positioned between the first

extension peptide and the second extension peptide in the composition.

257. The composition of any of embodiments 254-256, comprising a first peptide linker positioned

between the polypeptide and the first extension peptide.

258. The composition of embodiment 254 or embodiment 255, comprising a second peptide linker

positioned between the polypeptide and the second extension peptide.

259. The composition of any of embodiments 233-258, wherein the composition comprises a first peptide linker.

260. The composition of embodiment 259, wherein the first peptide linker does not form a regular

secondary structure.

261. The composition of embodiment 259 or embodiment 260, wherein the composition comprises a second peptide linker.

262. The composition of embodiment 261, wherein the second peptide linker does not form a regular secondary structure.

263. The composition of embodiment 261 or embodiment 262, wherein the polypeptide is positioned between the first peptide linker and the second peptide linker.

264. The composition of any of embodiments 233-263, wherein the composition comprises an amino acid sequence having Formula V: A-B-C, wherein A comprises a first amino acid sequence having a length of at least about 10, 20, 30, 40, or 50 amino acids, B comprises the polypeptide having SEQ ID NO: 36, and C comprises a second amino acid sequence having a length of at least about 10, 20, 30, 40, or 50 amino acids. 265. The composition of embodiment 264, wherein the first amino acid sequence is a first portion of an antibody, and the second amino acid sequence is a second portion of the antibody.

266. The composition of embodiment 265, wherein the first portion of the antibody comprises at least about 10 contiguous amino acids of a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

267. The composition of embodiment 265, wherein the first portion of the antibody comprises a sequence at least 90% identical to a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

268. The composition of any of embodiments 265-267, wherein the second portion of the antibody

comprises at least about 10 contiguous amino acids of a sequence selected from SEQ ID NOS: 1 -6, 93-100, 21-32, and 101-124.

269. The composition of any of embodiments 265-267, wherein the second portion of the antibody

comprises a sequence at least 90% identical to a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

270. The composition of any of embodiments 233-269, comprising an antibody having one or more

modified CDRs to reduce antigen binding.

271. The composition of any of embodiments 233-269, comprising an antibody having a CDR selected from SEQ ID NOS: 21-33 and 101-123.

272. The composition of any of embodiments 233-269, comprising an antibody having a CDR with the sequence "FGG."

273. The composition of any of embodiments 233-272, comprising an antibody region modified from a heavy chain variable domain of a palivizumab antibody having SEQ ID NO: 2, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 2.

274. The composition of any of embodiments 233-272, comprising an antibody region modified from a light chain variable domain of a palivizumab antibody having SEQ ID NO: 1, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 1.

275. The composition of any of embodiments 233-274, comprising a first antibody region comprising SEQ ID NO: 101: SMITX(i)X(ii)X(hi)FDV, wherein X(i) is selected from F, A, G, and P; X(h) is selected from G, A, S, T, and P; and X(iii) is selected from G, A, V, L, and P.

276. The composition of embodiment 275, wherein X(i) is F.

277. The composition of embodiment 275 or embodiment 276, wherein X(ii) is G.

278. The composition of any of embodiments 275-277, wherein X(ii) is A.

279. The composition of any of embodiments 275-278, wherein X(iii) is G.

280. The composition of any of embodiments 275-279, wherein the first antibody region further comprises one or more of SEQ ID NOS: 21 and 22.

281. The composition of any of embodiments 233-280, further comprising an second antibody sequence comprising one or more of SEQ ID NOS: 115 or 116. 282. The composition of any of embodiments 223-281, further comprising an antibody sequence comprising SEQ ID NO: 118: FQX(iv)X(v)GYPFT, wherein X(iv) is selected from G, Y, F, W, P, L, V, and A; and X(v) is selected from S, N, G, A, V, L, and P.

283. The composition of embodiment 282, wherein X(iv) is Y and X(v) is S.

284. The composition of embodiment 282, wherein X(iv) is G and X(v) is N.

285. A composition comprising a polypeptide having SEQ ID NO: 36:

I(X1)(Z1)VG(X2)(X3)E(Z2)(X4)P(X5)(Z3)(X6)AQ(X7)G(Z4)(X8)(X9)GK(Z5)MNRK(Z6)K(Z7)(X10)(X11 )(Z8);

wherein:

Zl, Z2, Z3, Z4, Z5, Z6, Z7, and Z8 are independently selected from any natural or unnatural amino acid;

X I is selected from S and K;

X2 is selected from S and P;

X3 is selected from P and K;

X4 is selected from P and L;

X5 is selected from K and P;

X6 is selected from R and G;

X7 is no amino acid or T;

X8 is selected from K and P;

X9 is selected from N and Y;

X10 is selected from Y and N; and

X I I is selected from Y, R, F, and G; and

wherein the polypeptide does not form a structure having more than 3 disulfide bonds.

286. The composition of embodiment 285, wherein the polypeptide does not form a structure having more than 2 disulfide bonds.

287. The composition of embodiment 285, wherein the polypeptide does not form a structure having more than 1 disulfide bond.

288. The composition of embodiment 285, wherein the polypeptide does not form a structure having a disulfide bond.

289. The composition of any of embodiments 285-288, wherein at least one of Zl, Z2, Z3, Z4, Z5, Z6, Z7, and Z8 is not a cysteine amino acid.

290. The composition of any of embodiments 285-289, wherein Zl is selected from A, G, S, I, and L.

291. The composition of any of embodiments 285-290, wherein Z2 is selected from A, G, S, I, and L.

292. The composition of any of embodiments 285-291, wherein Z3 is selected from A, G, S, I, and L.

293. The composition of any of embodiments 285-292, wherein Z4 is selected from A, G, S, I, and L.

294. The composition of any of embodiments 285-293, wherein Z5 is selected from A, G, S, I, and L.

295. The composition of any of embodiments 285-294, wherein Z6 is selected from A, G, S, I, and L.

296. The composition of any of embodiments 285-295, wherein Z7 is selected from A, G, S, I, and L. 297. The composition of any of embodiments 285· -296, wherein Z8 is selected from A, G, S, I, and L

298. The composition of any of embodiments 285· -297, wherein XI is K.

299. The composition of any of embodiments 285· -298, wherein X2 is P.

300. The composition of any of embodiments 285· -299, wherein X3 is K.

301. The composition of any of embodiments 285· -300, wherein X4 is L.

302. The composition of any of embodiments 285· -301, wherein X5 is P.

303. The composition of any of embodiments 285· -302, wherein X6 is G.

304. The composition of any of embodiments 285· -303, wherein X7 is T.

305. The composition of any of embodiments 285· -304, wherein X8 is P

306. The composition of any of embodiments 285· -305, wherein X9 is Y.

307. The composition of any of embodiments 285· -306, wherein XlO is N.

308. The composition of any of embodiments 285· -307, wherein XI 1 is selected from R, F, and G.

309. The composition of embodiment 285, wherein the polypeptide comprises a sequence selected from SEQ ID NOS: 13, 15, and 37-63.

310. The composition of any of embodiments 285-309, wherein the composition comprises a first

extension peptide that forms a helical secondary structure.

311. The composition of embodiment 310, wherein the composition comprises a second extension peptide that forms a helical secondary structure.

312. The composition of embodiment 311, wherein the polypeptide is positioned between the first

extension peptide and the second extension peptide in the composition.

313. The composition of any of embodiments 310-312, comprising a first peptide linker positioned

between the polypeptide and the first extension peptide.

314. The composition of embodiment 311 or embodiment 312, comprising a second peptide linker

positioned between the polypeptide and the second extension peptide.

315. The composition of any of embodiments 285-314, wherein the composition comprises a first peptide linker.

316. The composition of embodiment 315, wherein the first peptide linker does not form a regular

secondary structure.

317. The composition of embodiment 315 or embodiment 316, wherein the composition comprises a second peptide linker.

318. The composition of embodiment 317, wherein the second peptide linker does not form a regular secondary structure.

319. The composition of embodiment 317 or embodiment 318, wherein the polypeptide is positioned between the first peptide linker and the second peptide linker.

320. The composition of any of embodiments 285-319, wherein the composition comprises an amino acid sequence having Formula V: A-B-C, wherein A comprises a first amino acid sequence having a length of at least about 10, 20, 30, 40, or 50 amino acids, B comprises the polypeptide having SEQ ID NO: 36, and C comprises a second amino acid sequence having a length of at least about 10, 20, 30, 40, or 50 amino acids.

321. The composition of embodiment 320, wherein the first amino acid sequence is a first portion of an antibody, and the second amino acid sequence is a second portion of the antibody.

322. The composition of embodiment 321, wherein the first portion of the antibody comprises at least about 10 contiguous amino acids of a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

323. The composition of embodiment 321, wherein the first portion of the antibody comprises a sequence at least 90% identical to a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

324. The composition of any of embodiments 321-323, wherein the second portion of the antibody

325. The composition of any of embodiments 321-324, wherein the second portion of the antibody

326. The composition of any of embodiments 285-325, comprising an antibody having one or more

modified CDRs to reduce antigen binding.

327. The composition of any of embodiments 285-326, comprising an antibody having a CDR selected from SEQ ID NOS: 21-33 and 101-123.

328. The composition of any of embodiments 285-327, comprising an antibody having a CDR with the sequence "FGG."

329. The composition of any of embodiments 285-328, comprising an antibody region modified from a heavy chain variable domain of a palivizumab antibody having SEQ ID NO: 2, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 2.

330. The composition of any of embodiments 285-329, comprising an antibody region modified from a light chain variable domain of a palivizumab antibody having SEQ ID NO: 1, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 1.

331. The composition of any of embodiments 285-330, comprising a first antibody region comprising SEQ ID NO: 101: SMITX(i)X(ii)X(iii)FDV, wherein X(i) is selected from F, A, G, and P; X(ii) is selected from G, A, S, T, and P; and X(iii) is selected from G, A, V, L, and P.

332. The composition of embodiment 331, wherein X(i) is F.

333. The composition of embodiment 331 or embodiment 332, wherein X(ii) is G.

334. The composition of any of embodiments 331 or 332, wherein X(ii) is A.

335. The composition of any of embodiments 331-334, wherein X(iii) is G.

336. The composition of any of embodiments 331-335, wherein the first antibody region further comprises one or more of SEQ ID NOS: 21 and 22.

337. The composition of any of embodiments 285-336, further comprising an second antibody sequence comprising one or more of SEQ ID NOS: 115 or 116. 338. The composition of any of embodiments 285-337, further comprising an antibody sequence comprising SEQ ID NO: 1 18: FQX(iv)X(v)GYPFT, wherein X(iv) is selected from G, Y, F, W, P, L, V, and A; and X(v) is selected from S, N, G, A, V, L, and P.

339. The composition of embodiment 338, wherein X(iv) is Y and X(v) is S.

340. The composition of embodiment 338, wherein X(iv) is G and X(v) is N.

341. A composition comprising a first polypeptide that differs in sequence from a parent polypeptide at one or more cysteine residues of the parent polypeptide, wherein: the parent polypeptide forms a secondary structure having at least 3 disulfide bonds; the parent polypeptide is not greater than 40 amino acids in length; and the first polypeptide forms no disulfide bonds, or fewer disulfide bonds than the parent polypeptide.

342. The composition of embodiment 342, wherein the parent polypeptide is a peptide inhibitor of a

voltage-gated channel.

343. The composition of embodiment 341 or 342, wherein the one or more cysteine residues of the parent polypeptide is 1, 2, 3, 4, 5, 6, 7, or 8 cysteine residues of the parent polypeptide.

344. The composition of any of embodiments 341-343, wherein each of the one or more cysteine residues of the parent polypeptide is independently replaced with an A, G, S, I, or L in the first polypeptide.

345. The composition of any of embodiments 341-344, wherein the parent polypeptide comprises 8

cysteine residues.

346. A composition comprising a polypeptide having SEQ ID NO: 37, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 37.

347. A composition comprising a polypeptide having SEQ ID NO: 38, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 38.

348. A composition comprising a polypeptide having SEQ ID NO: 39, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 39.

349. A composition comprising a polypeptide having SEQ ID NO: 40, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 40.

350. A composition comprising a polypeptide having SEQ ID NO: 41, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 41.

351. A composition comprising a polypeptide having SEQ ID NO: 42, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 42.

352. A composition comprising a polypeptide having SEQ ID NO: 43, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 43.

353. A composition comprising a polypeptide having SEQ ID NO: 44, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 44.

354. A composition comprising a polypeptide having SEQ ID NO: 45, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 45.

355. A composition comprising a polypeptide having SEQ ID NO: 46, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 46. 356. A composition comprising a polypeptide having SEQ ID NO: 47, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 47.

357. A composition comprising a polypeptide having SEQ ID NO: 48, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 48.

358. A composition comprising a polypeptide having SEQ ID NO: 49, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 49.

359. A composition comprising a polypeptide having SEQ ID NO: 50, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 50.

360. A composition comprising a polypeptide having SEQ ID NO: 51, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 51.

361. A composition comprising a polypeptide having SEQ ID NO: 52, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 52.

362. A composition comprising a polypeptide having SEQ ID NO: 53, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 53.

363. A composition comprising a polypeptide having SEQ ID NO: 54, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 54.

364. A composition comprising a polypeptide having SEQ ID NO: 55, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 55.

365. A composition comprising a polypeptide having SEQ ID NO: 56, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 56.

366. A composition comprising a polypeptide having SEQ ID NO: 57, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 57.

367. A composition comprising a polypeptide having SEQ ID NO: 58, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 58.

368. A composition comprising a polypeptide having SEQ ID NO: 59, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 59.

369. A composition comprising a polypeptide having SEQ ID NO: 60, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 60.

370. A composition comprising a polypeptide having SEQ ID NO: 61, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 61.

371. A composition comprising a polypeptide having SEQ ID NO: 62, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 62.

372. A composition comprising a polypeptide having SEQ ID NO: 63, or an amino acid sequence that differs by 3 or fewer amino acids from SEQ ID NO: 63.

373. The composition of any of embodiments 346-372, wherein the composition comprises a first

extension peptide that forms a helical secondary structure.

374. The composition of embodiment 373, wherein the composition comprises a second extension peptide that forms a helical secondary structure. 375. The composition of embodiment 374, wherein the polypeptide is positioned between the first extension peptide and the second extension peptide in the composition.

376. The composition of any of embodiments 373-375, comprising a first peptide linker positioned

between the polypeptide and the first extension peptide.

377. The composition of embodiment 375 or embodiment 376, comprising a second peptide linker

positioned between the polypeptide and the second extension peptide.

378. The composition of any of embodiments 346-377, wherein the composition comprises a first peptide linker.

379. The composition of embodiment 378, wherein the first peptide linker does not form a regular

secondary structure.

380. The composition of embodiment 378 or embodiment 379, wherein the composition comprises a

second peptide linker.

381. The composition of embodiment 380, wherein the second peptide linker does not form a regular secondary structure.

382. The composition of embodiment 380 or embodiment 381, wherein the polypeptide is positioned between the first peptide linker and the second peptide linker.

383. The composition of any of embodiments 346-382, comprising an antibody having one or more

modified CDRs to reduce antigen binding.

384. The composition of any of embodiments 346-383, comprising an antibody having a CDR selected from SEQ ID NOS: 21-33 and 101-123.

385. The composition of any of embodiments 346-384, comprising an antibody having a CDR with the sequence "FGG."

386. The composition of any of embodiments 346-385, comprising a first antibody region modified from a heavy chain variable domain of a palivizumab antibody having SEQ ID NO: 2, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody comprising SEQ ID NO: 2.

387. The composition of any of embodiments 346-386, comprising a second antibody region modified from a light chain variable domain of a palivizumab antibody having SEQ ID NO: 1, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody comprising SEQ ID NO: 1.

388. The composition of any of embodiments 346-385, comprising a first antibody region comprising SEQ ID NO: 101: SMITX(i)X(ii)X(iii)FDV, wherein X(i) is selected from F, A, G, and P; X(ii) is selected from G, A, S, T, and P; and X(iii) is selected from G, A, V, L, and P.

389. The composition of embodiment 388, wherein X(i) is F.

390. The composition of embodiment 388 or embodiment 389, wherein X(ii) is G.

391. The composition of embodiments 388 389, wherein X(ii) is A.

392. The composition of any of embodiments 388-391, wherein X(iii) is G. 393. The composition of any of embodiments 388-392, wherein the first antibody region further comprises one or more of SEQ ID NOS: 21 and 22.

394. The composition of any of embodiments 346-385, 388-393, comprising an second antibody region comprising one or more of SEQ ID NOS: 115 or 116.

395. The composition of any of embodiments 346-394, comprising an antibody sequence comprising SEQ ID NO: 118: FQX(iv)X(v)GYPFT, wherein X(iv) is selected from G, Y, F, W, P, L, V, and A; and X(v) is selected from S, N, G, A, V, L, and P.

396. The composition of embodiment 395, wherein X(iv) is Y and X(v) is S.

397. The composition of embodiment 395, wherein X(iv) is G and X(v) is N.

398. The composition of any of embodiments 346-385, wherein the composition comprises an amino acid sequence having Formula V: A-B-C, wherein A comprises a first amino acid sequence having a length of at least about 10, 20, 30, 40, or 50 amino acids, B comprises the polypeptide, and C comprises a second amino acid sequence having a length of at least about 10, 20, 30, 40, or 50 amino acids.

399. The composition of embodiment 398, wherein the first amino acid sequence is a first portion of an antibody, and the second amino acid sequence is a second portion of the antibody.

400. The composition of embodiment 399, wherein the first portion of the antibody comprises at least about 10 contiguous amino acids of a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

401. The composition of embodiment 399, wherein the first portion of the antibody comprises a sequence at least 90% identical to a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

402. The composition of any of embodiments 399-401, wherein the second portion of the antibody

comprises at least about 10 contiguous amino acids of a sequence selected from SEQ ID NOS: 1-6, 93-100, 21-32, and 101-124.

403. The composition of any of embodiments 399-402, wherein the second portion of the antibody

404. A composition comprising a peptide inhibitor of a voltage-gated channel and an antibody having one or more modified CDRs to reduce antigen binding.

405. A composition comprising a peptide inhibitor of a voltage -gated channel positioned within, or

replacing one or more amino acids of, a first CDR of a parent antibody variable domain to create a modified variable domain; wherein a second CDR and/or a third CDR of the modified variable domain has been modified from the parent variable domain to reduce binding of the modified variable domain to the antigen to which the parent variable domain binds.

406. The composition of embodiment 405, wherein the first CDR is a light chain CDR3.

407. The composition of embodiment 405, wherein the first CDR is a light chain CDR1.

408. The composition of embodiment 405, wherein the first CDR is a light chain CDR2.

409. The composition of embodiment 405, wherein the first CDR is a heavy chain CDR3. 410. The composition of embodiment 405, wherein the first CDR is a heavy chain CDR1.

411. The composition of embodiment 405, wherein the first CDR is a heavy chain CDR2.

412. The composition of any of embodiments 405-411, wherein the first CDR is selected from SEQ ID NOS: 21-33 and 101-123.

413. The composition of any of embodiments 405-412, wherein the first CDR comprises the sequence "FGG."

414. The composition of any of embodiments 404-413, comprising an antibody region modified from a heavy chain variable domain of a palivizumab antibody having SEQ ID NO: 2, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 2.

415. The composition of any of embodiments 404-414, comprising an antibody region modified from a light chain variable domain of a palivizumab antibody having SEQ ID NO: 1, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 1.

416. The composition of any of embodiments 404-415, comprising a first antibody region comprising SEQ ID NO: 101: SMITX(i)X(ii)X(iii)FDV, wherein X(i) is selected from F, A, G, and P; X(ii) is selected from G, A, S, T, and P; and X(iii) is selected from G, A, V, L, and P.

417. The composition of embodiment 416, wherein X(i) is F.

418. The composition of embodiment 416 or embodiment 417, wherein X(ii) is G.

419. The composition of any of embodiments 416 or 417, wherein X(ii) is A.

420. The composition of any of embodiments 416-419, wherein X(iii) is G.

421. The composition of any of embodiments 416-420, wherein the first antibody region further comprises one or more of SEQ ID NOS: 21 and 22.

422. The composition of any of embodiments 404-421, comprising an second antibody sequence

comprising one or more of SEQ ID NOS: 115 or 116.

423. The composition of any of embodiments 404-422, comprising an antibody sequence comprising SEQ ID NO: 118: FQX(iv)X(v)GYPFT, wherein X(iv) is selected from G, Y, F, W, P, L, V, and A; and X(v) is selected from S, N, G, A, V, L, and P.

424. The composition of embodiment 423, wherein X(iv) is Y and X(v) is S.

425. The composition of embodiment 423, wherein X(iv) is G and X(v) is N.

426. A method of treating an individual for an autoimmune disease or condition thereof, the method

comprising administering to the individual an effective amount of the composition of any of embodiments 233-435.

Claims

CLAIMS What is claimed is:

1. A polypeptide comprising SEQ ID NO: 36:

wherein:

X I is selected from S and K;

X2 is selected from S and P;

X3 is selected from P and K;

X4 is selected from P and L;

X5 is selected from K and P;

X6 is selected from R and G;

X7 is no amino acid or T;

X8 is selected from K and P;

X9 is selected from N and Y;

X10 is selected from Y and N;

X I I is selected from Y, R, F, and G; and

the polypeptide does not comprise the following combination of amino acids: Zl is C, Z2 is C, Z3 is C, Z4 is C, Z5 is C, Z6 is C, Z7 is C, Z8 is C, XI is S, X2 is S, X3 is P, X4 is P, X5 is K, X6 is R, X7 is no ammo acid, X8 is K, X9 is N, X10 is Y, and XI 1 is Y.

2. The polypeptide of claim 1, wherein (i) Zl is C, (ii) Z2 is C, (iii) Z3 is C, (iv) Z4 is C, (v) Z5 is C, (vi) Z6 is C, (vii) Z7 is C, (viii) Z8 is C, or (ix) any combination of (i) - (viii).

3. The polypeptide of claim 1, wherein (ι) XI is K, (ii) X2 is P, (hi) X3 is K, (iv) X4 is L, (v) X5 is P, (vi) X6 is G, (vii) X7 is T, (viii) X8 is P, (ix) X9 is Y, (x) X10 is N, (χι) XI 1 is selected from R, F, and G, or (xii) any combination of (i) - (xi).

4. The polypeptide of claim 1, comprising a sequence selected from SEQ ID NOS: 37-63.

5. A composition comprising the polypeptide of any of claims 1-4.

6. The composition of claim 5, wherein the composition comprises an antibody or antibody fragment connected to the polypeptide.

7. The composition of claim 6, wherein the antibody fragment comprises at least one, at least two, or at least three CDRs of an antibody light chain and/or heavy chain; wherein optionally one or more of the at least one, two, or three CDRs has been modified to reduce antigen binding.

8. The composition of claim 6, wherein the antibody or antibody fragment comprises one or more

sequences selected from SEQ ID NOS: 21-32 and 101-130.

9. The composition of claim 6, wherein the polypeptide is positioned within the antibody or antibody fragment.

10. The composition of claim 9, wherein at least about 10, 20, 30, 40 or 50 contiguous amino acids of the antibody or antibody fragment are positioned N-terminal to the polypeptide, and at least about 10, 20, 30, 40 or 50 contiguous amino acids of the antibody or antibody fragment are positioned C-terminal to the polypeptide.

11. A composition comprising an antibody region modified by insertion of the polypeptide of any of claims 1-4 into the antibody region; wherein the unmodified antibody region comprises a first CDR, a second CDR, and a third CDR, and the modification comprises:

(a) positioning the polypeptide (i) between two amino acids of the first CDR, (ii) between an amino acid of the antibody region and the first amino acid of the first CDR, (iii) between an amino acid of the antibody region and the last amino acid of the first CDR; or

(b) replacing at least one amino acid of the first CDR with the polypeptide.

12. The composition of claim 1 1, wherein the first CDR of the unmodified antibody region is selected from: a CDR1 of an antibody light chain, a CDR2 of an antibody light chain, a CDR3 of an antibody light chain, a CDR1 of an antibody heavy chain, a CDR2 of an antibody heavy chain, and a CDR3 of an antibody heavy chain.

13. The composition of claim 1 1, wherein the first CDR of the unmodified antibody region is selected from SEQ ID NOS: 21-32 and 101-123.

14. The composition of claim 1 1, wherein the antibody region comprises: (1) a heavy chain of an

antibody variable domain, (2) a light chain of an antibody variable domain; (3) at least about 10, 20, 30, 40 or 50 contiguous amino acids; or (4) any combination of (l)-(4).

15. The composition of any of claims 11-14, wherein the polypeptide is connected to the antibody region by one or more linkers and/or extension peptides.

16. The composition of claim 15, wherein the polypeptide is inserted into the antibody region in an insert region comprising a first extension peptide, the polypeptide, and a second extension peptide.

17. The composition of claim 16, wherein the first extension peptide and the second extension peptide each form a helical secondary structure.

18. A method of binding a channel selected from: Kvl. l, Kvl .2, Kvl .3, Kvl .4, Kvl .5, Kvl.6, Kvl.7, Kv2.1, Kv3.1, Kv3.2, Kvl l. l, Kcl . l, Kc2.1, Kc3.1, Navl .2, Navl .4, KCa3.1, Navl .5, and Cavl .2; the method comprising combining the polypeptide of any of claims 1-17 with the channel; wherein if the channel is in an in vitro solution, combining comprises combining the channel and the polypeptide in the in vitro solution; and wherein if the channel is located in a subject, the method comprises administering the polypeptide to the subject.

19. A method of treating a subject comprising a disease or condition, the method comprising

administering to the subject the polypeptide of any of claims 1-17.

20. The method of claim 1 , wherein the disease is an autoimmune disease or condition thereof.

21. A composition comprising an antibody region first modified by insertion of a therapeutic polypeptide into the antibody region; wherein the unmodified antibody region comprises a first CDR, a second CDR, and a third CDR; and wherein the first CDR, the second CDR, the third CDR, or a combination thereof, has been further modified to reduce or eliminate antigen binding.

22. The composition of claim 21, wherein the first modification comprises (a) positioning the therapeutic polypeptide (i) between two amino acids of the first CDR, (ii) between an amino acid of the antibody region and the first amino acid of the first CDR, (iii) between an amino acid of the antibody region and the last amino acid of the first CDR; or (b) replacing at least one amino acid of the first CDR with the therapeutic polypeptide; and wherein the modified antibody region comprises at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 amino acids.

23. The composition of claim 21 or claim 22, wherein the therapeutic peptide is a peptide inhibitor of a voltage-gated channel.

24. The composition of any of claims 21-23, wherein the first CDR of the unmodified antibody region is selected from: a CDR1 of an antibody light chain, a CDR2 of an antibody light chain, a CDR3 of an antibody light chain, a CDR1 of an antibody heavy chain, a CDR2 of an antibody heavy chain, and a CDR3 of an antibody heavy chain.

25. The composition of any of claims 21-24, wherein the first CDR is selected from SEQ ID NOS: 21 -32 and 101-123.

26. The composition of any of claims 21-25, wherein the first CDR comprises the sequence "FGG."

27. The composition of any of claims 21-26, wherein the antibody region is modified from a heavy chain variable domain of a palivizumab antibody having SEQ ID NO: 2, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 2.

28. The composition of any of claims 21-26, wherein the antibody region is modified from a light chain variable domain of a palivizumab antibody having SEQ ID NO: 1, and the composition exhibits reduced binding to RSV-F as compared to the palivizumab antibody having SEQ ID NO: 1.

29. The composition of any of claims 21-28, comprising SEQ ID NO: 101: SMITX(i)X(ii)X(in)FDV, wherein X(i) is selected from F, A, G, and P; X(ii) is selected from G, A, S, T, and P; and X(iii) is selected from G, A, V, L, and P.

30. A method of treating a subject comprising an autoimmune disease or condition thereof, the method comprising administering to the subject the composition of any of claims 21-29.

- I l l -